HEX
Server: Apache
System: Linux vps.rockyroadprinting.net 4.18.0 #1 SMP Mon Sep 30 15:36:27 MSK 2024 x86_64
User: rockyroadprintin (1011)
PHP: 8.2.29
Disabled: exec,passthru,shell_exec,system
Upload Files
File: //proc/3/cwd/lib64/dovecot/libdovecot.so.0
ELF>��@;.@8	@`�`� ��<�<ؗ�� 8	8	=8	=888$$@�@�@�  S�td@�@�@�  P�td8�8�8�����Q�tdR�td��<�<��GNU=��,V�>�wH�q:�Qt�P���Xl�H����.(�i`WT	b(m@�&Dz��!*�P `'H�DE��Ґp"I�|�$0�$�Y��l$��֡:Q)��4(Q�>$ HiUA	@a����`�S��Fe H�%��ŒLS$�(&
����%BQ4(`�	(V���H�,���|����PDCԤ��-@�R�$d%�0@ڛ���p��B�HP!��8zP�B���
�F�H��"����!AI<�0Ma;��-1T�2(�
-4,�S xH�eG$CB�4�
n@,��IP�B(}�
��00	�((�@�x�`B.#�Va.D���B� D$PCe�IKA�RD�*8�"�l"�@P�8%a4��h��@%�03xA[! �
22$�B͈�Jh� �5�"#�E�v#�hTAV��P�C�B`2�I�R��@\����w��ʼn=�$JQ	2@@�4�SI`���@!`�0]
@��6�U�B�0P���*q�D%�HTԺ�!�.[b;����
cf��C$PDtv��"�B"� �@�A��$J���H�$b	`� aR0gK��Aɀ�A�J! �̈C]�0�Q�‚<��B�N��ČB@���@8(
�<@ ���GA���J��Q(�:ID�0��P���P�
4��(�8�(2� @H�f �
@��
IMHAXBHA�X��*x
� �C���!�$$�Dd/!)�@(A0�-1P0`�&DZ,%�P�	DD!�����@�X�`)4�#�bV��S�R!�e���
��#P #	�)A@4C� "�d��� @�P��b�p���)q
H	 �bbC	�9�>U1 @�#@�"�E@�Q*3��!a0 fA$�X)�� (	� ��e�`F
H(��T���@V@@a��R��$c"��j08 DH<(۫k,�_�h�AQ$J	��
cf�"�bc!A
�X��2��HQ	b���,J��i�(���"	���e�Yo��j
�
F���)�@	tr1  @�P���L�R� �D�O���	t*@�Zո��8$#�j���E�C`���ƍ D�AT2��R@M 
ʸ�88M
��� @��z�6�p�8X��H��D@H�P �@�X ��B�B@$p���*
�pj0`�|��
����A$
�Z.���R�	 5� ���"b�	��R@C
$ CA� 2������a�D�Zb	 IT�z�J4n! �XK�ưX��B�N�AP!`��@��%-���X
[B��Q�0�`` ��
(����tT�&B �,������0����	4C�@@PF(8lj��c(���� ���h*V��@,��%_p&�B�$����%���T�
�T� ��D1��pRN7���C���p��
��I�aOc
P0(�$�P��>(%`t�P�ɠd`#����@P�@B�N`
��`")� #�
ཕȡ�``�X�q�F�r r��$Ԡ	0��  ���,R���ۤ"B	eb A56P Q�a�L�,�������R��f���P�P���@V܂���(0@�0�Ot6���aD%��@D���;���  �ZGK4D��i��Db���Kh`L�kJ���ƪ� $p�l��������������������������
%&(*+,-.024789:<=>@ADFHKNRSUXZ[\^acdfhjmoqrtuwyz{�������������������������������������������������������������������	
 !$&(,-.01238:;<=>?ACEGJMNOPQRSTVY[\]_behimnopqtw{|}~���������������������������������������������������������������	

"%'(*+-./12378:<=?CFHIMNOQSUX[\_`cegiklnoprtuxy|}~���������������������������������������������������������������������	
 "#&'(*-/13578;=@ACDEFIJLMQSY[_acefgjlpqtuvwxz{}~���������������������������������������������������������������������

!#&)+-.0468:;<>?AEFGHJLMNSTUVWX]^_dfhkloqruvwz{|}~����������������������������������������������������������������������������	
 #$%(*-/125678;?ACDEIJKMNPSUVWXYZ[_`abdefgjmnopqrsuxy{��������������������������������������������������������������������	 !"#%&()+-.025689;<=>?@BDEHJLMNRTUVXY[\_bdfgiloqrtuwxz|~���������������������������������������������������������������������	

!#&+-.0136:<=@ABEFIJMPQRSWY[]`abcdfikoptvx{|~����������������������������������������������������������������������				
											 	"	#	'	(	*	-	.	1	3	4	6	7	<	?	@	A	C	E	G	I	K	L	N	P	Q	R	T	U	V	W	Y	[	\	]	^	_	a	b	c	d	g	h	j	k	l	n	o	p	q	s	t	v	{	~	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	




	














#
$
%
'
(
)
*
+
,
-
/
4
7
9
:
;
=
?
A
C
D
F
G
K
L
M
O
Q
T
V
W
Y
Z
[
`
a
d
e
g
j
l
n
q
s
w
x
{
|
~

�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
	
!"&')+,013478;=ADEFIJMOPSVYZ[^_bdfgiknopqrsvwxz|����������������������������������������������������������������������	 !#$'()*+,/1234789;>ABCEFHJKNPQSTW���yF1�Ŀ7�p��^�Y[�U��,9�����#(�l���9�^��~[�&0��!K�V�)�;�2��ݰ?Qp�2�L|��C���	,��
._���#↡�>t���AˁU�<9�~o��i����6��Tc	ll�_�7���~�p�E1�-�2Nw�(*�N֭s�;������z�x�c֩�0
zr�ZέN^4'i9q]|��凉���Mŝ~Єm0�	>��M�X�����U�pF�6��1�
���ϟ���^r�9@
�*%�!_r�d5�:��\��SnZ��x-�x�O�Q�c�=0فr��D�s�9��C�[���"ٜC$RP�PB+M��3UQ����{·���Np󷭇�З�8C`Ų�C�kF�zd�� ��EƲ���Yc��k�X�^/P�	T�[�P����_/MzB1(n�F�>��߲��h��E��"���8h���\)��:K
�:.5�7�F�)���
_��_ӷ{�t}kBx�?Ր`���a�	7��bSϵ��[*Y�j|�o�Tf�0���MY���m�كX1��%e佤C�b�N��
t�H�ґwS���-1ח�17,��\�uu�j�Ϝs�����a�D�"�������2�,�����K�r�!d�8)���j*6w�z�W�a�n�G5�4$c���2{Sj�{�`W������4��|�iAX���z.��c��Ȃ�8����-�7��DH�����XyZD~X�E��\
'"�P0���\��kF4Y�pű�ů����#t�օ_�P^�-A��_�t��O!�V�e�mԤ��óh���*_i�p�gMa��>��/�8����Z~G��`sz�)�|p��LX��Z��vH�{K<�����W�Q�h���):C�c�l����O��1
=���v����a	��ʠ�6�-_�e
M��|=�
$0�w��C�6д�7n�z�a���x��wu?�qـ�
_
X�˟��ģ� �I��m��h�ݯG�L'�V/k�-�FR��qU2�1��q����_d�aq.(&���z�!����k5���Z�.t�f�ҞU�mo/�x+�aaU��ϥ�|��W��:��خ���Ej��F�Ic�m��6��~�C'�zL�����D �1�=v�A�P">to���@B��wo��ou���Q�E��<*	��c�;=4�s����/^���a�$x��1�sW=]L�Ӡ��������I%�XT23o|Tdb�}+�M#��ᐅo5�5s��B+����Dw�^c�^gg�
&v�=��Hf:�6�P���Sk�����>�s T"�n`�������ӏͼ�/�=?�J�u���M����s��E$�)j��/3�q����ԛ��z3����D-��Ԋi{��\ݞ@�H�hD��<KMv7j����K��k��R��}�Z	�O��Yi����͋�u<eG�{q�������L�/գga�W�	��1����dT+0�����k���a|�{{5��ԙ��t���.����>���B�A,Ln�&x��v �=�/W=3GYx�B!Zw�f�&�T��ρ��V���lه�㳉�B��O��>R��5�P�����_����iF]h�M�{)��a�&Z�kS����|�Z8����]�nf���Ч��~�3P'��#�ba�mq��?,u[��.�߬��t�t
JV_��5�7TD��r��?��r1m��ˁNNgF(IՈ�5�Xl�-��\I�e�Tu��6%��`�H�Z�G�b�ӽI벒Y��?�dJ�$'����cZ�=�B�Rg�M4`"[}]�SM�V�-��v�l�lA�4�$����L
����D�N<>����f�⼏vM/�E��yc~�K�<��b\�?f��Q˂̈e�^b�\�bOB��[�%��{�8i[��4�$9�kNF�'�q@�X�@���rG�� ���%=�m[F�b�M��<��=�^�ֽ_P�'9����M��<����FEᑸs7!�NĨj�9)|�.df���a�U����F	V��qg�+�,���x[�Pg��QI�����p��ʋ���1��Y��r�T���Kd��O4`m�m_��
�O��)Y�r�\j@�ח?�#��F�)���@��Τ�w�G�T�߹�#0�1��r�P����p:x��[�I�#(����� �*}=����\����(�Z�AGyW��և�l��K��(��I��#q ��C�lɃ���G8^xq2u��i���$�]_�HD��m9�W��l^V@�����dvNg��S�I@�\.��9^u�#�@ie���bV���@�lˉ
��m5���&.�#�t�9�`0�'�s�<Z�I�
���Xb}��@�3yA��K�MtF��X����G`Yj��G5��Y	A�`u>��S[�M�i?���#�iE��^\r�N� B���f��DY�����jG���V||�2��i����j~�����s��,s�T��lL�!��T�5���=d�D�;���{��D�ip	qH�%���jv�����7���H�`{��L#R��^��s���Η��,�3#�+��/?U�h��8��.d��v(�q�H�gZqF(r�oVڀ'-ې#��3%
��G5H�mW@��&�ܼ������&O��9�_��u�i����%ڃ�S��c��L�
&���+�B���[��~�e��
���WWS��klJ�anY��4�~��{�T����n
��ݵ�Q0�շ�o�ӊ�T��:�M��ʆF�9��~�~s�R��p-��	E걑S�+�6�p���j��~s�̭϶��\S�#�(T�2�7�T��C���dN��,d�<7�f!��y��<�	<׮���d�Z��)�6h�i��(�i$*
����x���*���l�@x�9�E�iG���xk�g����w��GR���꥜�*�Ёs\�%Y������h�Α�1¬�D��h��/�?�u{!u�V�ӱ�w�ct���Ex�ž�1"#���C*�>
��`A��H΃����l$�q>��l�f'q�-PS�P�w&��t$H�_"ͽa���@
�Gᕝ�/v��j�����ĸ&���&mr6��J�PX�*�:�z���I��q���ˌE>�yH��s>��+h~D�MS7A-�4�HMt�6�����Oti�����[�9K��3� �e��ģ_��\c�A�n��e!0&e����c��Ā�9�G�6�������q�d�h�����]��[K+-��zs5:�JV��n3x�%��K(��
9��$G�Xþ��.	�'&�GŞ�U^���,�����B���w����z��i~`⫰��H��J!��S7�ۗ��ڀ�j/Ůx&e
���8PB5;m��]�4VH���(ޤ��R՜h;x�*Mt��q�j?�x���:bsF9?��.�d���Iz�6G��rXMѣ�N�p`��D'�I���k���]UX<{���]�<Jڳ�k��*TX2�:���:3G�}��
��f���̀)�Gƚ!�Cga���~�ehO�+�ED��3�P=��Aw��^�����)�uP���Q����09#g�ιi�XsC�9h��*� J�L����6��?,K��`�᧩$��_>�]��'^�C�C{� J���.cH^�!-_#q�{��J�>tqĠ�l������SH��?���}J��Qcl2L)gH?3dvV	ү�[e$1%`A�� <�e��Q�jE���0�Fl~�۞tI�v�Aͅ�����bA��D���n@촼��E�N��6t�s2:[��r+|��m�Y}X ���\k�ᡤi ��^:��X�J�;����K4���w���|!f��}�Ë]ö��唔���i
��\h���E@~Y]�O�M>E��
�(��~�~���;��z[�ٲ"�9� ͪ�J-l�10W�O�s9n���&$_�x�X�A�s�A)�ޫTG�,��]�gv�WL���cRr���u�����
lU��wbZϚ���ӗ�i�NI�NF�L8��$����B09�xf����H0�H�-��p A�{f\N ��e	�=`L�
QJ�p���#�(@���H��SR`���LL���\������:��ҙ8����n;�@p��N��c�"�:N�eO�c�����)�I2i~�i��]|M�9,Z�4I5�H��!�Q��r���?���f���uE��0��L*E�ݳ�������R<us:4ͺE���b&Ly�s�F4Od�:ĖF�u�Y�"�B��ӟ��ҽl��E���Gꛩ%��)S�~$�dsR�iE��rQ�+�·l��zc{�wx���[�"��軣K)�7��h��h���D�k.a,�rm;�v��T�~h�������@�uu�m���]f?��;��tZm_׀�$rt�>��W�Ј�����w���
��
��ď0�*��?MC�y����+��>��ὢ�jM�0,M'�&ALt�8����d�?��#�_:�"�����x�j�Pή�[�LG��?���R�*�<�'�VZSGe���YJ9 �hBU#3�4��94Z��+\��N6�WکYe�5��4IRKi�Xo�EUۉX���*KIa�.ϲ��b1�%[e_����8�PT��	00C!=�u����+ѐI�R�$?��ocXŏ�$�1�r�����I06
��,?�O
t�6�6/���U]7>��bGէ�ǫH�"�����WK-D��&s�Ã�K�lg�T�{B+h��]�͚a�4��w�B-n0��+�1����p�d�)�4nĬ���6'���ػ��	�>$���n!RM�$
��l+��/��C�Fm�
9�W|���R�Dǹ�X6d[����5���me\��`x��E-By�
Bh�Q���=Tl�U��dT��w�G�rʥ��F���jV�����wv�	���PtZ�i��
��w6Au� ����Au��/I�QN�S�j�@�M��3��Z�" v%��hp$&�,@w�5��]�ъG"sk�Y%{\:�Z� �p��ᢸ���E���h(H➴�"���R�*�\�!5��1�`0 �!��l��a��`�Fj�M~�q��~-�JT���R��v�$�n��m������
wŸ=�4,ѻ~��v*�K�*�
k�,ͮօz��z9U=����2d��Txk�KS��l��O�`i��dw��4��V�B���#1S�;�d�l�~��^��׈�sRe* {����%���{�E��-�n��AB�ZC��Y�c�N��7��ȇ��xU[�v�d�b=Ψ�a�1�{z�	6�L��hZ�����*g�-���\5�� ��|�UVW��6���^�Ƭ�X�Z���dh��9��0�4%�Z�c(D�lk.��{�nE�␰4q��3�&k��\5�Z͓+�X$
ɣ���=Q/������D�rM-L�{T!�F�~\e���_�3U+�	RJ��o�l�O\��8Ve�8.���X�����
qI:�[�u=3Ưf��>���b��
Z(!��Hb1��Jv+̸�T̡r
?ܴ#J6�(��T��.ᵱs��'�t\�b\5���`�c�T�Uuw�AX��s夀��o����ƅ� �M�y��V�_F)<�w����E ��%�	�+��x-W9���uC쮝�΋OBOZRX���;s)���9a�{�W��H����k�1�������>�����Ȓی���t@ja�`2E'�xb`��#(.����[��:iE��B��b7ْ"G8�_e�M]h��}��~��D
��wG��ݞ��PINL�n�-�<�������=�6�T��1<M�4�z2������9�Mx4�“r�ʃԜ���J�\=Sx��c��㒅}t4�F������|��G��7��J��� ��uتb�p�R��	���V�7��y�}w��xg������4E��[S�����mC�!�z�.��BQ-Pe���H.�42?A�p ���db���Z�9R@l�#��;�WO^ἣM���I�iv[�}o�q/�N��IB���Ae��3BE��ťw6�K��#n�*²c�\[��e}n�B�+6��\�2rԃˎh�����P���TW�W��"F\�B�hdPO��yW,
��BPG&!���7�B=c���y�� �En���<cV����(a�(�B:�4i�m2rE�'=���Wq2����)�,���[�a��
ڟv��h1U������{I�&J^_��'c���q�m*����ZU���,f�MaT;_ؓј���]�J6w���՝�i[_ ���9��7��=ӕ�3�#v*���4�j�.�FX"c����
�K3��t��)*K|�^�O��}�V����=�+

�r$��Q�B2sG�'"1�7U$|�'�$�I����P,�����L�@vLt3��d�g�R���0gŭ��}���G(�V\�¹??k�˿�~~��-㶭��;,�@n�9Zz{-9_�(:�?p��UUE�%�!h.X"M̲=FC3��R!c�;tU�#=O�zSŸDU���
�>B7S�e��;Veuz�B���A5QU�W٢��7v�;	43�V��"�P���[Yl�(D�{D�Q�Xn7�,W�AH8z(�~�H(�ֿ���Xg|���vfS�xJS�s�>2<�n����=
ߎ�t~�Z@!~��I��]ƺ6㭴U2�_s�A������N;ڴ��1z9N���g��ˏ4s�)h����Zhc�1XXGấ变7�C ڽNp�k.���$j�Kj'o�Z<���7��h��lh�4d��U�F�Ӧ�-У�x���{�H:TAG{l��βcЮE�b�Rk5‘�H�0����s�+�B�0_<��ڿ��_�A�^���a��8J�u�j��\���ŷ
���
l#>�]I�e���n�5��IM�&����s�
�T��F�E1�Fan:Qd�b��e�7��K�:/����P���)2�1‡��`�`��8w�n���k`/l�ѿ����z/��t������{���yKe@�HȖ7�h�t`6d�/h�%2�)�v�v������f�ӑH����d�4��o�����F��Pگb+��I<��K�KY@v�g�w�4��5�܎z�u��Ku?�^L�*�S��6��I�l3|��U-����/��
�&�Ã�5����VϼDԡ<����x�@0T�~�j4�{�=�o28�x�ĭI� �J���F�U�%g��db��8���6�p���~۫w3<�=r�� �յh�{������փ�SC��ț�<Z.+�S_srU�q�W�/R+���%4{R��3Sӛ�|Hɹ}�����˷��s�qo����}�mW���;�-U���sy��]��+0g�X�֧*?�<k"Ks��#(�#���:��}^�~)�{-O~�l4@B�օȧ
�)�����Og��q�̥2;�`;,7P�B�Ü����C�h:>�r��f�U�4+2�y���Y�c�j[l�o��x&�#&E�9�q�����cu�8Љ��Bd.Ȝq����(�bz�/���\����81�5	�f,���Z_b��+���ٟ[p����|잳�֨@lgf���O�.o ��+w��Q*��l�s�pU��ٔ��h�n�l���0�@�M�#�d,̂��1J���3ב1�p�a����7>�Z�5�M+�룯�
�Hv��!s¬ێ�T�թ��� ��'�>�� J���O:+w_R[5I�p=��)�N��c�/�y�H�}�4Hm@Sϴ�� ��k��ȁ����GM���3��h��T�8�C+���t;L�UHOI݋��єU�Dc�X|u�;IK���Oع��J45�Ҩ���e�qZ`�蛀�����AS��B|�+hgPЎ�d*kT���
IgIq�\�&�X�H�dy�Egh:c�Z+q�i�dÑ
.��5wF��vK8�ٻf��ȍ��b�}0[���ݍ�`rq��=oc�����7�B�A�`��:A$�:S �c�W�\��<6i@��qX�A��Aِߙ�FK
*�?Gmy7��!��� 8�Z����2�t����`���@Csd�Ԅ�x�ی�T�3��S�V� 0�\�J�˄Ztj+5�o�L�^��O�J��G���[�
��t�K"z0&~���tbI�Z��>��x؅*�>a�0���Z��DuW�?U�:Qc��<sS����]~�;-%�f�ٓ\�!�7�2%EG�a,z<�o��rl������v֝B��ƺ�.�0J1�p�D���'���R�M�y��|�]��i����E�32����Bb���]@��
��)��35F����ljCG��7�}L��SC��Sb���]c�A�'�ª�s�ϓy�-�ȍ����e}^��ˀ؀��	����B<}O��{bΖ��Yv��O��+��>u�$�BF���l��;�?����q��XW��	��+��qD�H@�
</���w����϶�89y�|���V���y�`���3�#�'��0���R����B�ϩRu�T4P�*(4Ý7E}
W�h�=��y%*����d��e����b.R��$~G�b�%j��(=�N��$4B>wK8����r�h��(p�o�N��g�HnpEP���#(���
����ؙݠ�ِ����*�y��Q��eZ)7e�EK�sB��B>��(/0���v�E�
.>O�� ���M?�!袇�/����o�c8�#"6�*u��4�[�5��DC>L�Jt�h�54��Jz����Y����91��=��?�t6�ry��@��9�Z;Z�2+d�
�#U�W�Oz�t���C�*"�}�M1�������$��6�'�u��5Y&�;��F׻��LM�Ҝ��;!��P����K��q���hsuQZyz��U@�j+:}vp 1‹��:1JmV&���?����@�_�my]�c�3�9��pT#�X[��M��[��߾L��⊅���7�"�%���3�<���ל�R���[�t���z
�9����1���5���
aj�G&z�A�Ĭ��są"��H��x�
rs	VD��ug�CރtB����A3���Y�jo���ו\��cv�S-�WpQ����4`��p@!>�O
�������W��[����ςjv�6�V-�ú��>����P$�:��	�{���5�ߞ��h��Yh�p�D_�}h�k#1�&�ӵ����\�ܰJYH8�T��X�{no3DvF7O*حY��y��6��e=\�f<�9i@`���Z���y ��B=@�������������V��T��v�E��P�@�z����GJ��&Īg8AO����¯-=NҵC:y��9[�'���A��"/@�X�cA��\J��A�	��>(f��@7����e5�*�tD���2��K(�.�Ym��v�
��ל��	L�ߓv
���C�;�©=�rNz-�
��ѮC<��Y�U2� o
�0紓��0'�A�|��p�;�3�s�R��"k�H�VL�gYI���h�����g���!0��e��!� �1��7�F�pVHlM���$�[���t�B"t!��yB���5#�>n����s.��|C����èqg{���5�yd������i+�w��D~�XMݿ�+�øX�׍ڒ���Sd��g�U%��!ѡ^�N����5�"��%�d�%b�'p�7�/y��LV�h����3����y��E?mJ�Mヮ��|c�֛<o�ȇ��B��0��B	�"W�sc�}�Û�$*�c��'��?�J�X`���k
�`S=̻L�<�yH6C2��ၟ����h9��4���~EU�_�߾�;SP�$�~	#�������S)J���d���Em�I�KEc�"F�ցio]25�h��]ʙ��g��r�w��V ��<;����fDY�ڏv���C0oq�������	d׺M��#Br5���Ot�Pj\�o���L�>�vj�k�ʗ,酾�����������x���m�o�h]y�E�	
5�P+n�J~E�%
�1 	���>��i��`�###vLd�=���-,�(
!���En�A�8�+�U,�u��(�y\P�s�e�<���ϏѰ�����k��j�..y��3��?Y��	��0(��g���w>�������._	���D4+E���X��'�ȅ��$a('���T+A � �#6��L���r$Q���6�L�(QN^G�J�B_!ю�s��#I]��0u��R�+���7P�ȇ�3�M/	!��I��J�%�7���,
�;��#$1����MAB��S�A��c�+2�滯i�il�Gyٞ��C�������L�Kȥ�׬G���kj
K��a���@�rD١��rh�n��&��F7u�%[57'�y-=�#�1�y)NXϥ!8�S���{���fI�p��s��GT���{7ߝ�iҿ|����n��	�G�#�:���5�/gs2������v���{��(H �����	�� ��uT	i�)T��/�:(0�+8����.�Gg����ay�Qq��F2����U4������K�X�q8ic�qݾ�ˮ9���h�o9B�6吇\5潛*�`4��l� �4�<V�
i���������J�UK���m�yH7ݏ�.}�j��xne��#ra%`	E,�����Cpd���lQ�%\��F���me�8ύ+�"3}������[�g�}���H!�-˥��5�i�_M�����iobvd�<��ꫡ���.]-�9�SP" ����#Z|c0XQ��0�r{W��������΃׆��7�c���C�J�x�ԑu���S���ֈ5қ�	��$sŽh,;��j�=5��4W�2V����4��i`����
�[�I���8"i[����ō�̽=:�I�;�͛�b�:�߹P�{�U�;?�h��N�,���`W#	c�
��B�wLcL�O��m�wB-��f�E�"���6P�ﳅ������|������n�o�A���'��d�XG��c�yu��:ޣ��q�;�&�!�\c��
m7��sŞ6�@6�\Y;�XG�c��TH�p�i�~5ţ+����%+9*��v��/�RH/����\|=��ߣ(��[�!�.d�$ʑ��D��k+y�L��6U��%?��ztv�\vh��Il�H�p��yk�k�_�A	��746��]b)<���ꙕe�݅f��o�&k�P-�`�(��9�%��@��|�S�t�_���1�W�!Vh�C�9���I��M
�d
�HTFd����;���_](����N�#�O���[ ;��7�/�r,����Y���~���l����O�������R��x������L'�N��������`���YK�t���9d@�J���S=����%7���^
�� K�z�^�>�����d]�Q�Q�l!������ٞl�	��4�AV�&��r� ��m��5����[�
�J��w��?�k#������Q�0B������c?O8�F?�i�"�,
`�����7�����)�7������������I�I���LE�����J����6FK��{�M0�[:V���s)��`�uE��������T�����kAd��H��-�����, ����I�������F"���Q�����H
X��U����v7�i �0�?���~Y���8r`W
jp
q>2P���5����@[=0�^����X��a�\ �c��"W�'	$������h�8��U7`�h	֥�G
���n%7�`>�	5@��פ����j�_�"H$b�`Z=X��P�*f�	�,������Z!�*���/��k[)�TZ{�
Rm�
�r��
S��_#��F���Ф
�*���@���`i� �
�&Q@�)�����>`/R0����M:��7gQkp

04����L��2 ���WP@�Uұ����x��
_�>�h���:�Kf��0#Y�h`�	�\�0�$?�pPH������`8��z��
�{a	�G��/��0�
�� �(_@�	N�PK
�`\=@k��U���d�?p($`P�%L0��eW0(	J�u`u
�Fx :	���}
hX�Z	��������Y�0	u3�pm"A5���& !1Ѽe�
�TV�SХ�����΢P�t�j`�!bP{	*Q1�#�l�-W�`�_���T0� K�n/
�YiГ9�eX�`��}P�
�����p+� ���0jۡ��1�
��~R�#����=r��>
`�`#!'�������9�`���"}*��ad�@c=n���&������V[h��	���#�0�2� �qg,��$��
�� �q����IP�E?���z%$i��x~
��@p%(��+�i��<�T0��"0H�p=��� ��|k�

�
�{1QPw?�(�#)�<@��`�	�T0G!_�0	���P�~�~��J��)��Z� �	3����c=�� '��|J�,?��mvI��M4P �me��~
��Pw�
@X=��7P��@LL��}���K��!Z �0b���bG����� �b���
���ؑ=�
|p�*���W��3
 b��J����\��zt0�$,�h �	��q�T
O͝��~�+0���(�����ŭP�
���KKFXt�2�pqLPO�_+r��R��
@(�O.`a���4<����c��*�RP1	*ہP)���0�	j��.8`+�G\x�4��ۚ���Z�dT��6�Po%������;>r��ع0�<^H�Y�� ��
�T\�
�!I	�0s%�N������ �7f�`��`�b��P�Y����P
. �P|
=`����q
'�@���p*�r W
:�=@"vy��b����
��_�h	���	u��t�qb����\��jP
=����A�p�����rz�PW	t��J�w>�.�����%�0`� �)<e�`�U��������Eg`;F�p(���`�N@_��Lp�j���w
���c*�Id��:i��@9
��6�x���y�	`P�8	�Q 	52�Z~�F�sg�K@4Eٮ�1��@��.	�%C��ZS�@�<�G��������3�O��&� w� _`��T?�^BNP�g�h��	��i��hH��s��0���s� Np�At�@���@y~�`�
� �-�].:��L��д��$�C\Q	��[
P\\����<X� � �@D.l8��5� aG�
�"g�0Zl��`WH�`����.���N��}
� �{�Q�@�(��sPm
Pa��m"^x{
�k�����X~p�7���u�p���
 <*yT���i��5�@��W�@�T�`YS�f�\d��:9t�p�kw���J��0�'��u%��k�
�"����4��0Zoթ�
Q4 �+�l�
y�$�h����c
	�n[T= ��iP��4�?�x��
��K�yKv��;)`hxp@�`A"=�l
%��P5	Ic�o{{@�
{N)�B�	���l 
�������ۜ�}�PNS%"�G L�!�����h �	6[~�
1�`}
�#�o��e¿ >����C]��Rʰ��`��y
 �7����@�+p�����U�Z��	YJ�����`�
��0��?�@�\��0��[���l;��C� 	Aus
��J >=�|C��`�7����!t���< 7���&�0d|P����p�/3��)���|1��Pt%�`�:R0 O�0�
�����<@����Q��� a=PE$�G3��jV@gB��`�<X��@��o)�;'Rp	P� ��S�ma�mp"� ����m��B������@��=Iz`�
�N�#��
�SS�8��8B��q%̧Pj
��@�]�0����g�����`�k	s�@sh���*��@P�!
�3<
<��������`q�^K�g���3�)/����P| �

��8AC HA�@��M��	�]����P��@�yЂ
C�Н
H���(�i=q'P`)A��&|��
Qt����?0?�mA�LgmB P��@���]��8��'�� �)�
�?��a�� +7������w���’[�G�����	������Zb�`,��P}�JP�����rq��ԔP��E�
t��vAf?�=2��p#-���X�/	dP�	�
�t�r
"�_Ph	2�]��=MK�a=���I
FC��-A����V�p9�L� Z&����|�V�'	|��-����h��	���P9�һ��<@{S�#�{@S=@N��o%�00j;a��Z���V��^����[��pvX��`!3qG
:C�ptO��`�
��K��8!�U�vw
8����b�r%�� ��b��T1�:0>��0�!z��_=�Cd�Їq^��
�!s�L�`%,���Sڨ�
d�H@Z�џp�n��p}
���k� �X�����s
Ta��Lg�@u�s�n
��nM�V�'	mШucR	[��g�@�v/P.\3�@��E[n%Ez�P�cq�`�<0D���
Q���^=�2��jC?��
�s�n
�`�(}�� ����T��2�a@�h�mP�i�g��	��
0TS��;mpa=Ϧ�J
T��f$�QC�AFA�j�
2�5�eg�1м�@�
�B�>_ą�c��	c`6
H�A0�>���G�1�8��s%��72�������
Vg��	��������B?�(�%����U���~
�\Х	B�p�|� U5�`Z��OSl}0�
Jp`	�a@�Zt��\N9
RS������G�@~v�`x7���OJ�l�HM�"rIn`(
�4D�V$�&W"U��L�L��@��E��<Xn����I�"+����Sa��	M7�`^��	C[`8	���@�(�pLk��b=��`n����V�"	��L��)uG�4� Y=��3�N�kY�0!�@iV���
����<0�p`./��k�� 	����P6v�K���� k!�r�
�t"�G�%�E�P<��@��m�@	�0CbM%�a��:p.����#�P%!�G�;�_��U�"	5@�?��L�	���p���9p�� l!d��͉�1���i!L]!I�*CJ���˾p
���=�fp�	y�� ��U�P9
�8�P������d �	{�����@����@��N��S�p94�pIlj�
2ܴ[�g�P�Ub� "n��Og��	<5�L`F�P/p�p��n�0
�)�Aa�Fq�0u�m 
#.>�&��(`�)
 s9�P�g<I ���X�i`
ez�"yu��I���T�����	/P7k�P�V� �
f���y0I�^���<0�pD.�������J��������3�`�j��`w70� ��]pi����
{�'_)M���=;pdPo8���?�p��3p*QV�0l
�[�0o-t�`6������|��
���(u������``=0�g0A"z�@�I���� a^��<P�)���
PU��_F\`PN��Ё#�`�D;:��Go�3
2�$�`�T��SO��p���%�c�pXl_�@�0���^ �	��X@�*��P%��p���6NXY0		�Up"	 `��[i�����
m��Ss������C�c��:�� NW�pV�,0�$
��1���`yAus
����hX� �;� o�BD0e�]��E���T��H
u
� [ ��@���/]��.$��R�� ���q�G
��0Z��g0�	8>sPk
O�i�p�#�s�m
W�B`�<H���
�a��T�uPv
2w
�Rl#`eip��.h`�	mȠ�n��p<I�K D
@V��
+��G���
��@0�&�
�P��k"��BY/���T���E�r-� �`���G72�`j���
�zY 0		���~
��`Q������_W���"z�p�#(���,�vPw
4�X�/	
�@/NhP�	`�pt
�� �u�@@��1@*#���l"��IQN��`=0����
��Pl"ߗ�u��MP�A��u%���T� �
Q%� =���)o�2
}#�IQ	�@�C�`����kz��X}%���b���$�PBo���r%��P/*�HPr1f��Ep`8
��y�
W�@��~��
z��PZP�U�"	�����
`�/������ie0��B���0�M0=�d�� v+� �C~�����w	����0�;�M��R-0�A'�
�
P��ß0a"ٳ�O/fb {	�����B`���E<��8m=�p�A
���paz�@�)2��S)�����0b%�Np�	�[uF�w�'e@�		m0
JAh��	s)$` ��pw$� H
w�w
���u)���Y[P~#$G �7����P=�:y �
�X��=j�_�g	x��`|=�@m"�w y
	��XS~�6h�\?	-���vw8��+��	`e
B�OrqpG
j=	pN`"%~\��	����Q��0)$h�	U-Z@1	�pP:
�m�U�0��������2�`��Z��r0�
x��`D
i����	�)Y�09��_�h	+�� [S������sOT`�	{���_#��U�{��hD00�Lp��!��� �t�@�x���ESepTo�7P����IB:�s�U��0��H�6P��a@{	���_I�pz
�Vj1{��
YX�L?��&K��@��@�����I�N@ <��R�|s�	P[,0	b7�
��?�R�� �2�,-� ���n�1
}4
p�3_������
w# =ԪP�
�6��yW�%vC�0Ux��.2p�`�1g�@�(l������ _'��Aa����!��@_A�20vDe� 'p�#�o@7
=��AD��uA�6��9��i~� t%���PCLP���k��� ��ܠ�}
^���'���mP���S�	-�0��p�6�����p���Pyj'7��(��P�Զx1HP��'�p�
�?�A!v	P	��`g `�w���I
F�g��	ڙ��z������h��	��pr%��P�$� D���2	��
e��U?��=��QA�L<L�@�Up.���_!�B��j
N�]0[	'�@� .�?�e`�	[U�!	0z*У+�|0�
I��b��p��	<���
c�����D0i���@{3�#�Cʇ��1ِP�r>'@q
c�'�;��j'J�\z��2B<`�p��Z��"�� �|�P9ƴ�Z��@�
i���,]��������k�[�N	hPz�	�"��kP��`�_|]��C�5�A0N�g$@_�$�`�< >�pI���]�|��z{M� �<0��-5��s%Od�(��I�P��uL��3��Z�6	I36��2<� vA$8��,��������	
�G�� �s=�,A� �����`p9
<��c��(<�0�	��pi[Ǘ��(J��m"SP�8sJ���6@�$H���FN0H��pp%���jx�E�b�����_��[\�P�
���t%�0J��I!���w5�0�q;�p��U�P��E�m=B�/	��c��`u����N���\	�g��	4��_!31�#	U��7���l"U��vpp���<@U)pB4�O��P@���0f�Pf:j�`�(�^`�	j' qy~�
Okip��f��	NR���d��?n�7��ǫP�
E`f`�	#P���4u�]=@f� ��!@F�'`!)`v�v
@R���#�Pq%���:��
�Q\���S�Np���W��p6���G��}
S�������.��pfE��0}8G�`�N��@� �U��
W�0�A��@����`,Օ ��g�P�.N���E��|i-�$�J8���e�y��
�}� l"��Q��Im��4����
,�0���/�?�`�k����T�����r���,����
���p�+K^�<X8�`�	Xw�`.t`Mf(p08
+e@�	�2���e��	�#	"�� q��h��`$	wzЮ
M�`�
=�P�J��������o�4
���`���)�����0Hj���r%A�7��PBt�y��
�ƞ`b6���>���	
>�)��`�z�W�s'��pen�,X����hm�
B�p�^Xs`l
V�p�J�#�f%NF�B@'�F �1d��s%*��}
������=��0 F���
�(������0�1
�5M���B��`�`��b��� �����)��K�i ��FE`Ka�p�G��g=���c��X[2p$GG�5
g8��`6�US�qPU
-~����P�7�J`$x�m=U0�|�}�5Pý
V��
B&(�`��`e�9��ruZ 2	��)`�+���,��p�3t��7R���}�
&
v�v
#&l��c��c�i=R"�G�\v�?���=X��������}�(��_��6�2�_��@��?��
UA���[���e�3#��p���(P��Z d��Ts�������B��!�����3֘p���G"�l�
KY�0f2'6 O\��`^��8��9�P�R�P�m�0�NS��l
��Bx�n"��`Kp4i@�	U?���,e@�J'�l� jj���
L��v{���^L���$���
��w@y
�
pj��`���Y00	$ԲP��"���X�tJ"���*0Q���������B7���<p`jP���1%�ay��""������P�H��G?�����`�<0�w`y
�3�0:!���^F��7O�9a,Np=	<��5s e0H���'����@�<@�%�cV� �W���"c	@	d+��[p�i�������
����H�KFw�����a��@a���J�0�i��	 ���w*��:�b�$�o�6
{r���޵�XqJ60�ЕC� o%HBP9������+A� B����;�" �<@�Wp\"��V���2� �J=*�xG�(P���Z����n�W M���`c=��l��6`��H�@�@lb2�`�cH�@�!M
pR	�'��I��P��H9��
d^`]	m
\6����< �P��J�	&��U=�n�g�pI�M�#,�E�|oP4
2} �
��[@<	"�WNI� ���S�	����I�SNqPG
�q�T
c��P��@�
1R�`:���P�Y��\	����CU`!	&�v�w
N�P@R��0�p���#k�/:��p�y��J�!�<� ���0�)���p�j���
���	�-`����~��� f���G+���EE�@�Xjh��	[�P���e��fK'��9ӿ?�Ӛp�ʷ�zW� -'�`|h��\
� �@cu�s
x/g��	q����������pu%�(�����K>�(�z�@'1��\#uf��	��5��"�u@t
"�S�	ـP�
4� `���:�����7�d��	d����tP��P�
�Pp����A��{(ۓ��	&�5
!)��4
7p��P�������b�{	u��!@A3b���o��5
4�� �
��+@j~2�Jp�`�(lK�=�	` ��[�q��p�>P����}ڬ �
#��P'���c=;��<��D�Hjg��	h�&�!)���\����^�`��CLn��@^.� cM���ZB�N�k���������}pm�(�/>!�AI��@�ToIP�>+p�����4��^�		�	��f�0f��@�YS�p�������@LC��OfS08/Y�/	$�]Q9��/�`'`;
	m�0��r�V
T!i��	z����%�0�3��#-����.� �� �wrV�&	�?Y����C	Hf�	��L�������
lp
-Q���Y=���
���Q���� ���:���_0gE�m+����	|�0�N�#�C� S>�8	���'Ps��0�/N0y
	?��L�� 
#��
��yA����ܫP7dI�Єb5����i��$	B9��P����
Q�,�$�	0�C�����TH2�ap�	�	����S�5�c+���7 S�6m&0e!�kP
�7���l�ETl�e�@
����V\`�0�%�@[Jm( }[��@J
F� 	�_�hv[�p�j�tpr
3$
R�I� �_?�š��U��0M���P�p
���p��������~(A`��T��kep��DW�'	?%K�"S6� q �`s%��p�B�`�
G��c��F�sU,�����7���
��Љ^7	���Q�K9��r
sH [�e�	.�zP�
��

}���|�� zh�Q�fG�r^��	t>��}
�Yp0	P��5Pm 
�����f(���P��:�����xM�����pDh���&Pk�vh0�	I�;��5E�jq�=� K?�O��t��@�5LjK�p*�w���?��"a�� �e������B�n�PR����i��!�@,lVG |��P���<���� ����[��Z�@`�f�	j�:B�[�`�

�pW���`�` l	��1@�jM����0n"�W`�]"�P|y
0�8!3*%���V�`Ca9���{�p,.�� ����'cO���w�P�T�P��P���?�+"Fv�$��/P��s1��0_����HD�����0~<�ZP��Q�L*kl��x ~
���'��&��v��b�ep�	���?"�_�n� ,#���
�@�
y��^M������0&_���	pL�����@�m�e������`n%�� ��|$��P�
�*�3�� Z�$�����&~�`oi�c��]
5����m=����z� _b���_�p����(�0�e��P�	:���$��Tt���e-�@�$˖�=X�5��3�a`�=�J�$���Ph�Eb�^Z����	�	�Y`0	��R8N��Du�`��c|��
����
�j�
2P��:��=��
^���;E�k�

C4�����p���Y!�O �V5���f��o%l[9	*
���%`TH��7� ��	�q��R�0�� �+P�C% r�S<0s���n&kt��
�\:@zpL���di�T@�'����x���pA�B`W[�!�Cq]�����E �Q��&�KN'p�|�
#�P89� �	H�0�������PL]�0^h���GU��K�x�|
IJ��@�J%P*�%@�	�O��"2�Rp���� *��-0�$'~��
��
"�H��S�I�"���h�pP�j/ >	j@��XI0�d�@e��0C;ˑ��\я�:��4?�7��<����e��@�
:+��;0�D�� �G7@�AW�Pp�qN��+M�`�Eq�$	�K��`pe����ufk0����Z�>Q�0q?�.�Ve�P��WM������"9����B�a�
�#��,`�$�e0����R��R�6	��m.n�����B���a=�2 �b`@H;V�@	��[�JQ�L-��8��p,`�^��	��]PhȄPL�
�6p@�H������<0?}��
d�;	"�0^.�P�HӍp�"%��~���
�`���&Ss���
!
��H��G��0~@�B|n�@A&�dZ��o��T�'f��k"���;0I-��Q��P�
aHO�����`U$r<�1-��x7�r�E����S�P��(��m".��*>�H`�>�p���
 {��
�y���� c����;P*p�^���A��`�F�xBZ��^Wf�`GGv���
�	��b���l< ESے ��>d��`�� ��G�pM\�pPE
-���Q� j$��������&�c�p�D
c�F0		HS�	{dMn)�p�@X��\5��0�H�0� CI	�noP��q,��P.oP3
[�g �	��P2�����@��������`Y��^��	�&�@�������� ���@=�X�p�L��@r%]rpW
$�&�B
&(���9�-�B�0(;\�P^���5��MJ>G���Ynn)
��y�C
_�D`h� !	�І���P+P�@�$��Eb��a�PF�/�0�+B�O�p+�P{
���`SOv�0;n�� �"��	r�10�%K  7e9�p�
jdNP�,����$�D�a
���������n%�f�\T��c=�wPy
V
uy;���G���7���`��s���G
�	�)=��/�(��3�`W=�B��f&�re���	DeP�	�)� �rm`i	�6�����T=�7j�
]�� �:�6`6Pd�{��
�d�	��@>� �$ ���Mo���O>�@-� �<0�����c�	m=�`�<0i`��<�	��ГJm �� J�������;����;�A^��b����V��p���9��=K������1��I��`(\��P\� 3Wf@&Y}�PI
F��0�g$�G�0� A��<���a\d8e=��036"1qJ+z`�
���z� 8�f���x� >@O+������#Z1	(������@��F���		0�l�/ �!�\	�`��R�[\���N3����:k0

8e
�	ظ ���p#H%��s}���j�>�0�

���j��W�~��vM�@���P�4,@P�N]�sеP�eh��q%�L�����o�1���< ����!���s��`��h���'�IКk]p����P_a�2@Z`i	L�X\=�Par]P6o3F�v!A� [z2m�
|N��s%��0�	�� ;�?�BV#�4ijPO$ʊk�/.E���p�4���$�@
I�+ �ޛ�e=w�`PNs�.�<0"���i���B{��<X�@��~��Vph�Q`�O�@H/x�Z=PYcqd0=ZJ��2�[pTE`m^N�pDI�}�D�Pp�'6�@�,%�@H
%M� xR�B�V��OP�)��P�
PL���9��
�>��,���n=x
@�����|9�F��M��y��wAwy�\�+wx
r��
?�Cevr�B��t�/\v���@�v�w
4��b
�RS���l"9��g=�o`��8��%bo�@�b w	����<�5��?� �e0���i=na��>A��k�S0�����Z=XQ��S�i���@*
����
3�Z0w	�
 v
#>8���� �7�/�PjH�`q"�����~�
u���H��u \I����pp�����
�`]����6��8�0�	
�����i������@��f�@E������@��D0 B��p[)*�Pnl	�t%i�`����Y�@��-�T�ao	X����!N|�$	����R����� z�`�
R��Xx�����0�0�������3���.�q�E
��G2x��Q���C
P�� =X5n�U��p�4���,*P��������TT��`���Xx��Ry6p8�s9�lH
��3�~0%!��5�'9�z�� �v^��^MH(PH0#�IDB�@������5��
�P�Då�E
X�3�	��P�#]P?	*l.�>���Za7���k�I
<�?�~��[�;	a��p%�.�W<���s
8��@:�O����	p����R�+'�"�gp�	f�&�B
Y��`��@a�F
����v� q%�AG��o�R}���>�U�	�ƆHw�n`2
o00!/�`w�f��	�F�u2(���
���NqN
�wXi��l�
�x���̓�Fə��p1 7iА>J����|Ы
3����-r����p}�"E�m��@[%j��T��.D��}
��0ZP�PS���$����l�J ����Ю*�PQ�E��8
��� �d
�"�����
���Y�:�pH
W��7���6��o%/�0�
�I�Е
��!`FZ�%`c2&O0������p�P�9Y�/		p�7
��p�#&�`��3V�$	W3U`�R'x��#�X�/	<R��G
�p���@)!�t�r
pWS�~"�V�'	+�`�	��`�d����{��
z�����ׯp�
c9�H2����������
���a=h�`�Ys#�61Һ��w��0C��t�z`�
+�oP5
=����O���M0��'@t���Ђ�Np$/Hi��	$�`���g�@>� p@�hp�	�EHP�G��!NP��!��>P��P	���C�80W(8��[(8��X�!PE�E@`'���H����
K�_0����swy
	4��v���` ����
��P�o|�C) �o�P�j��R�;�>I��pE
�	�!\D�P 
yWPd�k�pq���A�W��-`�h	>���ʘ�������B3�p�`�-��
��
�}�0	(u�\yP�
$r��`=��tv��M2<�H�� `#± �A��J��!��9��:�J��:`w/
`s�M;p
B|U�!	����p%�E�tJ��x5^�`b����M3�@���P�W@�����>l��Dj.(;�y����%��b��N��� ��q:���%T�@�<X�pvAk5P�5���O�p��f�WS�e��	,<���\�����0�:˹6�A@R0�p�} �
B���
3���َ����oE���thk�pb3@}
��*��+�]�('���Q. `4O��yv,?pjg���$o
`US�L@�3���M��k�
8��@ o0��'[P��p��P���
Zz�Lm;wON�097��LgiH�_�	�]_��<X����!!�P0`,ALi��@���
PS\��o�ь�u�-S@\=��P����|�jc@w%g�`Q�*��\��`55�PY���O�[���;�'�$,{���ћ�~� ��Ո�f	G��Yl���5�Б=e�@�
h����Ot�p
��R`	�Бq%�@ 
���t%�� x5��-w���t�K�i���
e'����I��f>�)��o�,�,�j	
��d �	�P����p�p~
��\�`�����n��0�
+������],��Co��	-LP�I�@N�2�����P.!��0������]0?	GP�%�@)�M �	������Q�	*�`�!��`>�mO �����iE
�`aRN���m4��UW4��T��b.���6
Z���S/	�`+�C����4�*�ͨ@t
Y�mP
;�V�'	���eO%:�n�.��M�h���n�������2BI�p0��4��A_��		=G0������3~� �N�����P1\ף�6`\�x	'���}��R���P��
 Tao�3
[U��C��@�2-�0�a�k 
qܟ0�>�PJA� �%N0m=U�`,k�	
J�\e�����`�m	�c�Q=P�l��.`*yp�
r\�P�*�DR��bf� �! �0� k�	
?P�\	'�p\�=	�V�h@���o
T8������Y�PJ��~��
@�pB�r��	.��6�������`C
Yh��	���\G����PY��/P�Qt��Nl�AKw�x
xrp2{�p�t|LP���@u%H/�>���@|��Y��pube��	��N��41�0ũ��
M�C�cA�`�9c�--�� 4�E����`������������Ȭ�
���
F�# 7$;��]��@�6����+/ ���0p�?�sn
vZ� zR�L0�K�FPx~HV%	�XCb�K0Vl9�@�Q���w��@�	���0� ��$T@	����M����������a
��QP��	T�	k�~@(����)��</�W�*��p3�j��[�R !���H
|���ޖ�<X��гy��p
��Q�K����f� y5�`� �`�1��s�+��;��QRP�2����vЀ8%_�@�!K��%	��T�7c .J8�0�B���UZ�1	�{p�
P���9����b�b|	�H,@��	� i	s����`�2�P�>�@�x���w7���ED;v�v
# �zk�K�$U�p^&���S~g j�`�w
�p�
n$X0�(���Om00I�6��m����N	 v��!�g��	��t0r
4\Q5	��\�ca��p�2�!��\����$���`u��`jGn�� Np��� ��̂%Gls�l
�"
m�@ v	���i�p�>�@C�`�TjP
g��MSU�@�!����uv
}��z���@��%	V�0��=@ ���*��$�`��0y
�
 :1d�"�����~�
$�D_��V=���L���(^�<X��(4n�`�SP�p�a
�!��u$�� �<0�$�`b��1��S�k�
i��![����i�q��\
���g�j @�d��	N�0������;(�3�*__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizefs_iter_deinitt_strdupdefault_pooli_strdup__stack_chk_failfs_deinitstrstrbuffer_appendstr_ct_strdup_printft_str_newi_unreachedfs_file_initfs_writefs_file_deinitfs_deletefs_file_last_errorpool_alloconly_createfs_iter_initi_panicfs_read_streami_stream_readi_stream_get_data_sizei_stream_read_datai_stream_skipi_stream_get_errori_stream_unreffs_iter_nextt_strconcatdict_transaction_memory_initstrchrt_strdup_untilfs_initdict_driver_fsdict_transaction_memory_rollbackdict_transaction_memory_setdict_transaction_memory_unsetdict_drivers_register_builtindict_driver_clientdict_driver_registerdict_driver_filedict_driver_memcacheddict_driver_memcached_asciidict_driver_redisdict_drivers_unregister_builtindict_driver_unregisteroauth2_json_tree_buildi_stream_create_from_datajson_parser_initjson_tree_init_typejson_tree_appendjson_parse_nextjson_parser_deinitjson_tree_deinitoauth2_valid_tokenstrpbrktimeout_removeoauth2_request_parse_jsonjson_parse_skipbuffer_append_space_unsafep_strdupbuffer_create_dynamic_maxio_removei_stream_read_eofi_stream_refio_add_istreamstr_to_uint32ioloop_timehttp_client_request_url_strhttp_client_request_add_headerhttp_client_request_set_timeout_msecshttp_client_request_submithttp_client_request_get_origin_urltimeout_add_shorthttp_client_request_set_payloadnet_ipport2strpool_alloconly_create_cleanoauth2_refresh_starthttp_url_escape_paramoauth2_introspection_startoauth2_token_validation_startoauth2_passwd_grant_startoauth2_request_aborthttp_client_request_abortjson_tree_rootjson_tree_find_keystrcspnbuffer_append_cstr_to_int64iso8601_date_parsehash_method_lookupoauth2_validation_key_cache_lookup_hmac_keybase64url_schemet_base64_scheme_decodemem_equals_timing_safepool_datastack_createdict_lookupbase64_schemeoauth2_validation_key_cache_insert_hmac_keyoauth2_try_parse_jwtt_strsplitstr_array_lengtht_str_ucasestr_array_findt_strsplit_tabescapedt_strsplit_spacesstr_array_icase_findstr_append_tabescapeddcrypt_is_initializedoauth2_validation_key_cache_lookup_pubkeydcrypt_key_load_publicoauth2_validation_key_cache_insert_pubkeydcrypt_verifybuffer_get_poolbuffer_deletestr_sanitize_utf8oauth2_validation_key_cache_initstr_hashhash_table_createoauth2_validation_key_cache_deinitdcrypt_key_unref_publichash_table_destroyhash_table_lookupbuffer_set_used_sizehash_table_insertbuffer_create_dynamicoauth2_validation_key_cache_evicthash_table_try_removesmtp_parser_initsmtp_parser_parse_domain__ctype_b_locsmtp_parser_parse_address_literalsmtp_char_lookupt_strndupinet_ptonsmtp_parser_parse_quoted_stringsmtp_parser_parse_atomsmtp_parser_parse_stringsmtp_parser_parse_xtextsmtp_qpair_char_masksmtp_ehlo_greet_char_masksmtp_ehlo_param_char_masksmtp_esmtp_value_char_masksmtp_textstr_char_masksmtp_qtext_char_masksmtp_dcontent_char_masksmtp_atext_char_masksmtp_xtext_char_masksmtp_string_parsesmtp_string_writebuffer_insertsmtp_xtext_decodesmtp_xtext_parsesmtp_xtext_encodestr_printfasmtp_helo_domain_parsesmtp_ehlo_keyword_is_validsmtp_ehlo_param_is_validsmtp_ehlo_params_are_validsmtp_ehlo_params_str_is_validsmtp_ehlo_line_parsep_strdup_untilsmtp_address_parse_anysmtp_address_writesmtp_address_write_pathsmtp_address_encodesmtp_address_encode_pathsmtp_address_encode_rawsmtp_address_encode_raw_pathsmtp_address_initsmtp_address_detail_parsep_strconcatsmtp_address_detail_parse_tempsmtp_address_init_from_msgsmtp_address_clonememcpysmtp_address_parse_mailboxsmtp_address_parse_path_fullsmtp_address_parse_pathsmtp_address_parse_usernamesmtp_address_createsmtp_address_create_from_msgsmtp_address_clone_tempt_malloc0t_strdup_emptysmtp_address_create_tempsmtp_address_create_from_msg_tempsmtp_address_add_detailp_strdup_emptysmtp_address_add_detail_tempsmtp_address_cmpnull_strcasecmpnull_strcmpsmtp_address_cmp_icasesmtp_capability_find_by_namesmtp_capability_namessmtp_proxy_data_mergesmtp_param_parsesmtp_params_copysmtp_params_add_onesmtp_params_add_encodedsmtp_params_drop_onesmtp_param_writesmtp_params_get_paramsmtp_params_decode_paramsmtp_params_equalsmtp_params_mail_copysmtp_params_mail_add_extrasmtp_params_mail_parsestr_to_uoffsmtp_params_mail_encode_extrasmtp_params_mail_drop_extrasmtp_params_mail_writesmtp_params_mail_get_extrasmtp_params_mail_decode_extrasmtp_params_mail_add_to_eventevent_add_strevent_add_intsmtp_params_rcpt_copysmtp_params_rcpt_add_extrasmtp_params_rcpt_parsemessage_address_parsesmtp_params_rcpt_encode_extrasmtp_params_rcpt_drop_extrasmtp_params_rcpt_set_orcptsmtp_params_rcpt_writesmtp_params_rcpt_get_extrasmtp_params_rcpt_decode_extrasmtp_params_rcpt_equalsmtp_params_rcpt_add_to_eventsmtp_reply_initsmtp_reply_printft_strdup_vprintfsmtp_reply_get_enh_codesmtp_reply_get_text_lines_omit_prefixsmtp_reply_writesmtp_reply_write_one_linesmtp_reply_logsmtp_reply_get_messagesmtp_reply_copyp_strarray_dupsmtp_reply_clonesmtp_reply_add_to_eventi_strdup_vprintfsmtp_reply_parse_enhanced_codesmtp_reply_parser_initsmtp_reply_parser_deinitstr_freesmtp_reply_parser_set_streamsmtp_reply_parse_nextsmtp_reply_parse_ehloi_stream_get_disconnect_reasoni_strdup_untilbuffer_freeuni_utf8_get_char_nbuffer_free_without_datai_stream_get_max_buffer_sizeuni_utf8_non1_bytessmtp_command_parser_initsmtp_command_parser_deinitsmtp_command_parser_set_streamsmtp_command_parser_pending_datai_stream_have_bytes_leftsmtp_command_parse_nextsmtp_command_parse_data_with_sizei_stream_create_limiti_stream_create_min_sizedi_stream_create_error_strsmtp_command_parse_data_with_doti_stream_create_doti_stream_create_failure_atsmtp_command_parse_auth_responsesmtp_client_connection_trigger_outputsmtp_client_connection_failstr_sanitizeevent_set_append_log_prefixo_stream_finishsmtp_client_connection_handle_output_errorevent_createsmtp_client_command_newsmtp_client_command_refsmtp_client_command_unrefevent_want_levelevent_send_abortevent_unrefe_debugsmtp_client_command_name_equalsi_memcasecmpsmtp_client_command_locksmtp_client_command_unlocksmtp_client_command_drop_callbacksmtp_client_command_abortevent_create_passthroughsmtp_client_command_fail_replysmtp_client_connection_refsmtp_client_connection_unrefsmtp_client_commands_fail_delayedsmtp_client_command_failsmtp_client_commands_list_abortbuffer_get_modifiable_datasmtp_client_commands_list_fail_replysmtp_client_commands_abort_delayedsmtp_client_command_set_abort_callbacksmtp_client_command_set_sent_callbacksmtp_client_command_set_repliessmtp_client_command_send_moreo_stream_send_istreami_stream_get_namesmtp_client_connection_update_cmd_timeouto_stream_sendo_stream_create_dotsmtp_client_connection_state_namessmtp_client_command_submit_aftersmtp_client_connection_start_cmd_timeoutsmtp_client_command_plugsmtp_client_command_submitsmtp_client_command_set_flagssmtp_client_command_writesmtp_client_command_vprintfstr_vprintfasmtp_client_command_printfsmtp_client_command_set_streami_stream_get_sizesmtp_client_command_input_replysmtp_client_command_get_statei_stream_create_rangesmtp_client_command_noop_submit_aftersmtp_client_command_noop_submitsmtp_client_command_vrfy_submit_aftersmtp_client_command_vrfy_submitsmtp_client_command_rset_submit_aftersmtp_client_command_rset_submitsmtp_client_command_mail_submit_aftersmtp_client_connection_send_xclientsmtp_client_command_mail_submitsmtp_client_command_rcpt_submit_aftersmtp_client_command_rcpt_submitsmtp_client_command_data_submit_afteri_stream_set_max_buffer_sizesmtp_client_command_data_submitsmtp_client_transaction_mail_abortsmtp_client_transaction_rcpt_abortsmtp_client_transaction_rcpt_set_data_callbacksmtp_client_transaction_create_emptysmtp_client_transaction_createsmtp_client_transaction_refsmtp_client_transaction_unrefsmtp_client_transaction_abortsmtp_client_connection_abort_transactionsmtp_client_connection_next_transactionevent_refio_loop_time_refreshioloop_timevalsmtp_client_transaction_destroysmtp_client_transaction_fail_replysmtp_client_transaction_failsmtp_client_transaction_set_eventevent_set_forced_debugsmtp_client_transaction_set_timeouttimeout_addsmtp_client_transaction_startsmtp_client_connection_add_transactionsmtp_client_transaction_add_mailsmtp_client_transaction_start_emptysmtp_client_transaction_add_rcptsmtp_client_transaction_add_pool_rcptsmtp_client_transaction_sendi_stream_create_crlfsmtp_client_transaction_resetsmtp_client_transaction_set_immediatesmtp_client_transaction_connection_resultsmtp_client_transaction_connection_destroyedsmtp_client_transaction_get_timessmtp_client_transaction_get_statesmtp_client_transaction_get_state_namesmtp_client_transaction_state_namessmtp_client_transaction_get_state_destriptionsmtp_client_connection_get_statesmtp_client_transaction_switch_ioloopio_loop_move_timeout__xstatconnection_streams_changediostream_rawlog_createdsasl_client_freeconnection_client_connect__errno_locationconnection_init_client_ip_fromnet_ip2addrconnection_init_client_unixo_stream_set_flush_callbacki_stream_destroyo_stream_destroyio_stream_create_ssl_clientssl_iostream_set_handshake_callbackssl_iostream_handshakessl_iostream_is_handshakedssl_iostream_client_context_cache_getsmtp_client_init_ssl_ctxssl_iostream_context_refssl_iostream_get_last_errorssl_iostream_check_cert_validityi_strcasecmp_parray_lsearch_isafe_memsetbuffer_copyssl_iostream_settings_dupsmtp_client_connection_get_capabilitiessmtp_client_connection_get_size_capabilitysmtp_client_connection_accept_extra_capabilitysmtp_client_connection_get_extra_capabilitysmtp_client_connection_corko_stream_corko_stream_set_flush_pendingsmtp_client_connection_connectnet_addr2ipdns_client_lookupdns_lookupnet_gethostbynamenet_gethosterrorsmtp_client_connection_list_initsmtp_client_connection_disconnectdns_lookup_abortssl_iostream_destroyssl_iostream_context_unrefo_stream_nsend_stro_stream_uncorksmtp_client_connection_createsmtp_client_connection_create_ipsmtp_client_connection_create_unixssl_iostream_has_handshake_failedo_stream_get_erroro_stream_get_namesmtp_client_connection_uncorko_stream_flushe_warningdsasl_client_mech_get_namedsasl_client_newdsasl_client_outputbase64_encode_morebase64_encode_finishdsasl_client_mech_finddsasl_client_mech_plaindsasl_client_inputt_pusht_popnet_set_tcp_nodelaynet_getsocknamenet_set_recv_buffer_sizenet_set_send_buffer_sizesmtp_client_connection_closesmtp_client_connection_update_proxy_datasmtp_client_connection_switch_ioloopio_loop_move_iosmtp_client_initevent_add_categorysmtp_client_deinitconnection_list_deinitsmtp_client_switch_ioloopsmtp_server_command_is_repliedsmtp_server_command_replied_successsmtp_server_connection_reset_statesmtp_server_cmd_ehlo_reply_createsmtp_server_reply_create_ehlosmtp_server_cmd_helosmtp_server_cmd_ehlosmtp_server_reply_ehlo_add_paramssmtp_server_cmd_ehlo_reply_defaultsmtp_server_reply_submitsmtp_server_command_pipeline_blocksmtp_server_command_add_hooksmtp_server_command_refsmtp_server_command_unrefsmtp_server_connection_set_statesmtp_server_replysmtp_server_reply_ehlo_add_8bitmimesmtp_server_reply_ehlo_add_binarymimesmtp_server_reply_ehlo_add_chunkingsmtp_server_reply_ehlo_add_dsnsmtp_server_reply_ehlo_add_enhancedstatuscodessmtp_server_reply_ehlo_add_pipeliningsmtp_server_reply_ehlo_add_sizesmtp_server_reply_ehlo_add_starttlssmtp_server_reply_ehlo_add_vrfysmtp_server_reply_ehlo_add_xclientsmtp_server_connection_refsmtp_server_connection_unrefsmtp_server_connection_set_ssl_streamssmtp_server_connection_ssl_initsmtp_server_connection_clearsmtp_server_connection_input_unlocksmtp_server_connection_closesmtp_server_command_reply_status_equalssmtp_server_connection_flusho_stream_unset_flush_callbacksmtp_server_cmd_starttlssmtp_server_command_input_locksmtp_server_connection_input_locksmtp_server_connection_input_haltsmtp_server_connection_timeout_stopsmtp_server_cmd_authsmtp_server_cmd_auth_successsmtp_server_cmd_auth_send_challengesmtp_server_connection_reply_immediatesmtp_server_connection_timeout_resetsmtp_server_command_input_capturesmtp_server_transaction_createsmtp_server_command_reply_is_forwardedsmtp_server_cmd_mail_reply_successsmtp_server_cmd_mailstrncasecmpsmtp_server_connection_reason_beginevent_reason_endsmtp_server_recipient_destroysmtp_server_recipient_approvedsmtp_server_command_get_replysmtp_server_recipient_deniedsmtp_server_transaction_rcpt_countsmtp_server_command_is_rcptsmtp_server_cmd_rcptsmtp_server_cmd_rcpt_reply_successsmtp_server_recipient_replysmtp_server_recipient_createsmtp_server_recipient_data_repliedsmtp_server_command_input_unlocksmtp_server_transaction_finishedsmtp_server_cmd_data_check_sizesmtp_server_command_failsmtp_server_connection_data_check_statesmtp_server_transaction_has_rcptsmtp_server_command_abortsmtp_server_connection_timeout_startsmtp_server_transaction_receivedsmtp_server_transaction_data_commandi_stream_chain_appendi_stream_chain_append_eofsmtp_server_command_set_reply_countsmtp_server_cmd_datasmtp_server_connection_data_chunk_initi_stream_create_chainsmtp_server_connection_data_chunk_addsmtp_server_command_remove_hooksmtp_server_cmd_bdatsmtp_server_transaction_resetsmtp_server_cmd_rset_reply_successsmtp_server_cmd_rsetsmtp_server_cmd_noop_reply_successsmtp_server_cmd_noopsmtp_server_cmd_quitsmtp_server_reply_quitsmtp_server_cmd_vrfy_reply_defaultsmtp_server_cmd_vrfysmtp_server_connection_set_proxy_datasmtp_server_cmd_xclientsmtp_server_connection_is_trustednet_str2portstr_to_uintarray_idx_modifiable_iarray_idx_clear_ismtp_server_reply_set_statusp_strdup_printfsmtp_server_reply_get_statussmtp_server_reply_create_indexsmtp_server_reply_createsmtp_server_reply_create_forwardstr_c_modifiablesmtp_server_reply_freesmtp_server_reply_add_textsmtp_server_reply_prepend_textsmtp_server_reply_replace_pathbuffer_replacesmtp_server_command_submit_replysmtp_server_reply_submit_duplicatesmtp_server_reply_indexvsmtp_server_reply_indexsmtp_server_reply_index_forwardsmtp_server_reply_forwardsmtp_server_reply_allsmtp_server_reply_earlysmtp_server_reply_get_one_linesmtp_server_reply_get_messagesmtp_server_reply_sendsmtp_server_connection_handle_output_errorsmtp_server_reply_is_successsmtp_server_reply_add_to_eventsmtp_server_reply_ehlo_addsmtp_server_reply_ehlo_add_paramt_strarray_joinsmtp_server_command_registersmtp_server_command_unregistersmtp_server_command_overridesmtp_server_commands_initsmtp_server_command_new_invalidsmtp_server_command_newarray_bsearch_iarray_sort_ismtp_server_command_remove_hookssmtp_server_command_get_reply_countsmtp_server_command_ready_to_replysmtp_server_connection_trigger_outputarray_idx_get_space_ismtp_server_connection_input_resumesmtp_server_connection_input_capturesmtp_server_command_pipeline_unblocksmtp_server_command_call_hookssmtp_server_command_executesmtp_server_command_next_to_replysmtp_server_connection_terminatesmtp_server_connection_pending_command_datasmtp_server_command_completedsmtp_server_command_finishedsmtp_server_command_send_repliesevent_drop_parent_log_prefixessmtp_server_recipient_refsmtp_server_recipient_get_originalsmtp_server_recipient_data_commandsmtp_server_recipient_get_replysmtp_server_recipient_is_repliedsmtp_server_recipient_replyvsmtp_server_recipient_reply_forwardsmtp_server_recipient_resetsmtp_server_recipient_finishedsmtp_server_recipient_add_hooksmtp_server_recipient_remove_hooksmtp_server_recipient_call_hookssmtp_server_recipient_unrefsmtp_server_transaction_add_rcptsmtp_server_transaction_freesmtp_server_transaction_find_rcpt_duplicatesmtp_server_transaction_fail_datasmtp_server_transaction_write_trace_recordsmtp_server_connection_get_security_stringsmtp_server_connection_get_protocol_namemessage_date_createsmtp_server_event_initnet_set_nonblockguid_128_generatesmtp_server_connection_get_statsio_set_pendingsmtp_server_connection_set_streamso_stream_set_no_error_handlingsmtp_server_connection_corksmtp_server_connection_list_initsmtp_server_connection_send_lineo_stream_nsendio_stream_create_ssl_serverssl_iostream_server_context_cache_getmaster_servicemaster_service_ssl_initsmtp_server_init_ssl_ctxsmtp_server_connection_reply_lineso_stream_is_corkedsmtp_server_connection_logini_stream_add_datasmtp_server_connection_start_pendingsmtp_server_connection_haltsmtp_server_connection_createconnection_init_server_ipsmtp_server_connection_create_from_streamsi_stream_get_fdo_stream_get_fdconnection_init_from_streamssmtp_server_connection_resumesmtp_server_connection_startsmtp_server_connection_get_helo_datasmtp_server_connection_get_statessl_iostream_get_security_stringt_str_onelinesmtp_server_state_namesio_stream_get_disconnect_reasonsmtp_server_connection_uncorksmtp_server_connection_abortsmtp_server_connection_set_capabilitiessmtp_server_connection_add_extra_capabilitysmtp_server_connection_get_contextsmtp_server_connection_is_ssl_securedsmtp_server_connection_get_protocolsmtp_server_connection_get_transactionsmtp_server_connection_get_transaction_idsmtp_server_connection_get_proxy_dataconnection_update_propertiessmtp_server_connection_register_mail_paramarray_idx_set_ismtp_server_connection_register_rcpt_paramsmtp_server_connection_switch_ioloopevent_reason_codeevent_reason_beginsmtp_server_initmy_hostdomainsmtp_server_deinitsmtp_server_switch_ioloopsmtp_submit_setting_parser_infocurrent_ioloopio_loop_stopnet_str2hostportsmtp_submit_session_initssl_iostream_settings_init_fromsmtp_submit_session_deinitsmtp_submit_initsmtp_submit_init_simplesmtp_submit_deinitprogram_client_destroysmtp_submit_add_rcptsmtp_submit_sendmaster_service_get_nameiostream_temp_createsmtp_submit_run_asynciostream_temp_finishrestrict_access_initprogram_client_local_createprogram_client_set_inputprogram_client_run_asyncsmtp_submit_runio_loop_createio_loop_set_runningio_loop_is_runningio_loop_destroyio_loop_runiostream_pump_destroyi_close_fd_patho_stream_get_buffer_used_sizeprogram_client_set_labelprogram_client_disconnectedprogram_client_failprogram_client_connectediostream_pump_createiostream_pump_set_completion_callbackiostream_pump_startprogram_client_initprogram_client_set_outputprogram_client_set_output_seekableiostream_temp_create_sizedprogram_client_get_output_seekableprogram_client_set_extra_fdprogram_client_set_envprogram_client_init_streamso_stream_create_fdo_stream_set_namei_stream_create_fdi_stream_set_nameio_addprogram_client_switch_ioloopi_stream_switch_ioloopo_stream_switch_ioloopiostream_pump_switch_ioloopprogram_client_createprogram_client_net_createprogram_client_unix_createt_strcutprogram_client_runio_loop_set_currentchild_wait_freee_infochild_wait_switch_ioloopkillwaitpidchild_wait_deinittimeval_diff_msecspipechild_wait_new_with_pidrestrict_accessdev_null_fddup2env_put_arrayexecvp_consti_fatali_errorchild_wait_initdns_lookup_switch_ioloopnet_connect_unixeacces_error_geti_stream_statp_memdupnet_ip6_anynet_connect_ipnet_ip4_anyshutdowni_stream_get_datai_stream_read_memareanet_geterrori_stream_seekprogram_client_net_create_ipsaqueue_delete_tailaqueue_countnet_disconnectanvil_client_initaqueue_initanvil_client_deinitaqueue_deinitanvil_client_connecto_stream_send_strnet_connect_unix_with_retriesi_stream_read_next_lineo_stream_sendvanvil_client_queryaqueue_appendanvil_client_query_abortanvil_client_cmdanvil_client_is_connectedi_stream_next_lineipc_client_initipc_client_deinitipc_client_cmdo_stream_nsendvipc_client_cmd_abortmy_pidversion_string_verifyipc_server_initipc_server_deinitipc_cmd_sendipc_cmd_success_replyipc_cmd_successipc_cmd_failmaster_auth_inithash_table_create_directmaster_auth_deinithash_table_iterate_inithash_table_iteratehash_table_iterate_deinitmaster_auth_request_full__fxstatfd_sendtimeval_diff_usecsi_warningmaster_auth_requestmaster_auth_request_abortt_readlinkfile_dotlock_get_lock_pathfdatasyncfile_dotlock_replacefile_dotlock_deletei_stream_create_fd_autoclosestr_to_timefile_dotlock_open_modemaster_instance_list_initmaster_instance_list_deinitmaster_instance_list_updatemaster_instance_list_removemaster_instance_list_find_by_namemaster_instance_list_set_namemaster_instance_list_iterate_initmaster_instance_iterate_list_nextmaster_instance_iterate_list_deinitprocess_title_setmaster_service_client_connection_destroyedi_set_failure_prefixfd_readfd_close_on_execi_malloci_strndupmaster_login_auth_requestdec2strmaster_login_initmaster_login_auth_initmaster_login_deinitmaster_login_auth_deinitmaster_login_addmaster_login_stopmaster_login_auth_request_countmaster_login_auth_disconnectmaster_service_close_config_fdgetpidhash_table_clearstr_to_pidconnection_verify_versionmaster_service_stop_new_connectionsi_rand_limitevent_category_auth_clientmaster_login_auth_set_timeoutbinary_to_hex_appendhash_table_countlib_signals_syscall_errorlseekmaster_service_stopmaster_status_updatelib_signal_code_to_strmaster_service_getopt_stringmaster_getopt_str_is_validmaster_service_init_log_with_prefixgetenvsyslog_facility_findi_set_failure_syslogi_set_failure_timestamp_formathome_expandi_set_failure_filedefault_fatal_handleri_set_fatal_handlerdefault_error_handleri_set_error_handleri_set_failure_internali_set_debug_filei_set_info_filemaster_service_init_logmaster_service_init_log_with_pidmaster_service_init_stats_clientstats_client_initmaster_service_set_die_with_mastermaster_service_set_die_callbackmaster_service_set_idle_die_callbackmaster_service_parse_optionmaster_getoptoptargmaster_service_import_environmentenv_putmaster_service_env_cleanenv_clean_exceptmaster_service_set_client_limitmaster_service_get_client_limitmaster_service_get_process_limitmaster_service_get_process_min_availmaster_service_get_idle_kill_secsmaster_service_set_service_countmaster_service_initlib_initlib_signals_initlib_signals_ignoreprocess_title_initi_strconcatssl_module_loadi_strdup_printfevent_register_callbackevent_filter_createevent_filter_parseevent_set_global_debug_log_filterevent_filter_unrefi_strdup_emptymaster_service_config_socket_try_openrestrict_access_allow_coredumpsmaster_service_get_service_countmaster_service_get_socket_countmaster_service_get_socket_namemaster_service_set_avail_overflow_callbackmaster_service_get_config_pathmaster_service_get_version_stringmaster_service_get_configured_namemaster_service_runmaster_service_is_killedmaster_service_is_master_stoppedmaster_service_anvil_sendmaster_service_client_connection_createdmaster_service_client_connection_acceptmaster_service_io_listeners_addmaster_service_init_finishlib_set_clean_exitlib_signals_set_handlerprocess_title_get_countermaster_service_ssl_ctx_initmaster_service_io_listeners_removeevent_filter_matchi_set_failure_ignore_errorsmaster_service_client_connection_handledmaster_service_client_connection_callbacknet_acceptmaster_service_haproxy_newmaster_service_ssl_io_listeners_removeversion_string_verify_fullstrncmpstr_uint_equalsmaster_service_unset_process_shutdown_filtermaster_service_haproxy_abortmaster_service_ssl_ctx_deinitstats_client_deinitsettings_parser_deinitevent_unregister_callbackmaster_service_deinitlib_signals_deinitlib_atexit_runlib_deinitmaster_service_deinit_forkedmaster_service_set_process_shutdown_filterevent_filter_refrecvmemchri_infop_strndupnet_parse_rangenet_is_in_networkevent_set_global_core_log_filtert_binary_abspathexecv_constenv_removemaster_service_settings_get_filtersmaster_service_settings_readmaster_service_setting_parser_infomaster_service_ssl_setting_parser_infosettings_parser_init_listalarmsettings_parse_stream_readsettings_parse_environsettings_parse_set_key_expandedsettings_parse_linesettings_parser_get_errorsettings_parser_checksettings_parser_get_listsettings_parse_set_expandedmaster_service_ssl_server_setting_parser_infomaster_service_settings_read_simplemaster_service_settings_detachmaster_service_settings_getmaster_service_settings_parser_get_othersmaster_service_settings_get_othersmaster_service_get_settings_parsermaster_service_setmaster_service_set_has_config_overridesettings_parse_unaliasmaster_service_settings_cache_initmaster_service_settings_cache_init_filtermaster_service_settings_cache_deinitmaster_service_settings_cache_readdns_match_wildcardsettings_parser_dyn_updatepool_alloconly_get_total_alloc_sizesettings_parser_duppool_alloconly_get_total_used_sizenet_ip_cmpnet_ip_hashmaster_service_ssl_settings_getmaster_service_ssl_is_enabledmaster_service_ssl_server_settings_getssl_iostream_context_init_servermaster_service_ssl_settings_get_from_parsermaster_service_ssl_client_settings_to_iostream_setmaster_service_ssl_server_settings_to_iostream_setevent_exportevent_minimizeevent_set_global_debug_send_filtert_str_tabunescapeevents_get_headevent_get_globalevent_get_registered_categoriesevent_category_register_callbackevent_category_unregister_callbacksyslog_facilitiesparse_setting_from_defs__isoc99_sscanfsettings_read_ii_stream_set_return_partial_linestrrchrglobglobfreestr_unescapenull_settings_section_callbackstr_parse_uintmax__ctype_toupper_locsettings_parser_getsettings_parser_get_changessettings_parser_get_rootssettings_get_timesettings_get_time_msecssettings_get_sizesettings_parse_get_prev_infosettings_checkt_pop_pass_strsettings_var_expand_with_funcssettings_var_expandsettings_parse_var_skipsettings_vars_have_keyvar_has_keysettings_dup_with_pointerssettings_parser_info_updatesettings_find_dynamicstrcase_hashsettings_parser_apply_changessettings_section_escapesettings_parser_initsettings_parse_keyvaluestr_num_errornet_str2port_zerostr_to_ullong_octsettings_parse_is_valid_keysettings_parse_get_valuesettings_parse_is_changedsettings_parse_set_keys_expandedsettings_parse_streamt_strdup_noconstsettings_parse_filesettings_parse_execenv_get_environ_pt_str_lcasestats_registerstats_unregisterstats_alloc_sizestats_allocstats_copystats_field_countstats_field_namestats_field_valuestats_diffstats_addstats_have_changedstats_exportstats_importstats_fill_ptrstats_resetstats_connection_createstats_connection_refstats_connection_unrefstats_connection_sendstats_parser_diffstats_parser_addstats_parser_valuehttp_date_parseutc_mktimehttp_date_parse_tmhttp_date_create_tmhttp_date_createuri_append_schemeuri_parse_host_authorityuri_host_copyuri_data_decodeuri_append_path_datauri_parse_pathuri_parse_queryuri_parse_fragmenturi_parse_schemehttp_url_parseuri_parser_inithttp_url_request_target_parsehttp_url_init_authority_fromhttp_url_copy_authorityhttp_url_clone_authorityhttp_url_copyhttp_url_copy_with_userinfohttp_url_clonehttp_url_clone_with_userinfohttp_url_createuri_append_hosturi_append_porthttp_url_create_hosthttp_url_create_authorityhttp_url_create_targethttp_url_escape_pathuri_append_query_datahttp_parser_inithttp_parse_owshttp_parser_skip_token_http_char_lookuphttp_parse_tokenhttp_parse_token_list_nexthttp_parse_quoted_stringhttp_parse_token_or_qstring_http_token68_char_mask_http_ctext_char_mask_http_qdtext_char_mask_http_text_char_mask_http_value_char_mask_http_token_char_maskhttp_header_createhttp_header_field_addhttp_header_field_deletehttp_header_get_fieldshttp_header_field_findhttp_header_field_gethttp_header_field_find_uniquehttp_header_parser_inithttp_header_parser_deinithttp_header_parser_resethttp_header_parse_next_fieldi_stream_free_buffero_stream_get_buffer_avail_sizeo_stream_flush_parento_stream_copy_error_from_parenti_stream_try_allocio_stream_set_errorhttp_transfer_chunked_istream_createhttp_transfer_chunked_ostream_createo_stream_createhttp_auth_parse_challengeshttp_auth_parse_credentialshttp_auth_create_challengehttp_auth_create_challengeshttp_auth_create_credentialshttp_auth_challenge_copyhttp_auth_challenge_clonehttp_auth_credentials_copyhttp_auth_credentials_clonehttp_auth_basic_challenge_inithttp_auth_basic_credentials_inithttp_message_parser_inithttp_message_parser_deinithttp_message_parser_restarthttp_message_parser_get_poolhttp_message_parse_versionhttp_message_parse_finish_payloadhttp_message_parse_headershttp_message_parse_bodyi_stream_create_sized_with_callbackhttp_request_has_connection_optionhttp_request_get_payload_sizehttp_request_parser_inithttp_request_parser_deinithttp_request_parser_pending_payloadhttp_request_parse_finish_payloadhttp_request_parse_nexthttp_response_inithttp_response_has_connection_optionhttp_response_get_payload_sizehttp_response_parser_inithttp_response_parser_deinithttp_response_parser_get_last_offsethttp_response_parse_nexthttp_client_host_gethttp_client_host_submit_requesthttp_client_connection_outputhttp_client_connection_start_request_timeouthttp_client_connection_handle_output_errorevent_strlist_copy_recursivehttp_client_request_labelhttp_client_requesthttp_client_request_urlhttp_client_request_connecthttp_client_request_connect_iphttp_client_request_set_eventhttp_client_request_refhttp_client_request_unrefhttp_client_queue_drop_requesthttp_client_remove_request_errorhttp_client_request_destroyhttp_client_connection_request_destroyedhttp_client_request_set_porthttp_client_request_set_sslhttp_client_request_set_urgenthttp_client_request_set_preserve_exact_reasonhttp_client_request_add_missing_headerhttp_client_request_remove_headerhttp_client_request_lookup_headerhttp_client_request_set_datehttp_client_request_set_payload_datahttp_client_request_set_payload_emptyhttp_client_request_set_timeouthttp_client_request_set_attempt_timeout_msecshttp_client_request_set_max_attemptshttp_client_request_set_event_headershttp_client_request_set_auth_simplehttp_client_request_set_proxy_urlhttp_client_request_set_proxy_sockethttp_client_request_delay_untilhttp_client_request_delayhttp_client_request_delay_msecshttp_client_request_delay_from_responsehttp_client_request_get_methodhttp_client_request_get_targethttp_client_request_get_statehttp_client_request_get_attemptshttp_client_request_get_statsioloop_global_wait_usecsfile_lock_wait_get_total_usecsio_wait_timer_get_usecshttp_client_request_append_stats_texthttp_client_request_get_payload_typehttp_client_request_get_peer_addrhttp_client_request_finishhttp_client_request_resubmithttp_client_request_errorhttp_client_request_callbackhttp_client_request_error_delayedhttp_client_connection_refhttp_client_switch_ioloopdns_client_switch_ioloophttp_client_connection_unrefhttp_client_request_send_payloadhttp_client_request_finish_payloadhttp_client_delay_request_errorhttp_client_request_send_morehttp_client_connection_lostio_add_istream_tohttp_client_connection_stop_request_timeouthttp_client_request_sendo_stream_set_finish_also_parenthttp_client_request_redirecthttp_client_request_try_retryhttp_client_request_retryhttp_client_request_set_destroy_callbackhttp_client_request_start_tunnelhttp_client_connection_start_tunnelhttp_request_state_nameshttp_client_peer_refhttp_client_peer_unrefhttp_client_peer_connection_losti_stream_remove_destroy_callbackhttp_client_peer_shared_max_connectionstimeout_add_short_tohttp_client_peer_connection_failuretimeout_add_tohttp_client_connection_count_pendinghttp_client_connection_is_idlehttp_client_connection_is_activehttp_client_connection_check_idlehttp_client_connection_claim_idlehttp_client_connection_reset_request_timeouthttp_client_connection_list_inithttp_client_connection_createio_wait_timer_add_tohttp_client_peer_shared_labelhttp_client_peer_pool_refconnection_init_client_ipio_wait_timer_removehttp_client_peer_pool_unrefi_stream_create_timeouti_stream_add_destroy_callbackhttp_client_connection_lost_peerhttp_client_connection_closehttp_client_peer_connection_successo_stream_set_finish_via_childhttp_client_peer_claim_requesthttp_client_connection_check_readyi_stream_set_input_pendinghttp_client_peer_trigger_request_handlerhttp_client_connection_next_requesthttp_client_connection_switch_ioloopio_loop_move_io_toio_loop_move_timeout_toi_stream_switch_ioloop_toio_wait_timer_move_tohttp_client_queue_requests_pendinghttp_client_queue_peer_disconnectedhttp_client_peer_addr_hashhttp_client_peer_addr_cmphttp_client_peer_shared_refhttp_client_peer_shared_unrefhttp_client_peer_pool_closehttp_client_peer_shared_closehttp_client_peer_shared_switch_ioloophttp_client_peer_closehttp_client_peer_gethttp_client_peer_is_connectedhttp_client_peer_have_queuehttp_client_peer_link_queuehttp_client_queue_claim_requesthttp_client_queue_connection_successhttp_client_queue_connection_failurehttp_client_peer_active_connectionshttp_client_peer_unlink_queuearray_insert_space_ihttp_client_peer_pending_connectionshttp_client_peer_switch_iolooptimeval_cmptimeout_add_absolute_tot_strflocaltimetimeval_cmp_marginhttp_client_host_get_ip_idxhttp_client_host_refreshhttp_client_queue_gethttp_client_queue_freehttp_client_queue_connection_setuparray_bsearch_insert_pos_ihttp_client_queue_host_lookup_failurehttp_client_host_check_idlehttp_client_queue_submit_requesthttp_client_queue_host_lookup_donehttp_client_queue_requests_activehttp_client_queue_switch_ioloophttp_client_host_shared_freehttp_client_host_shared_switch_ioloophttp_client_host_freehttp_client_init_ssl_ctxnet_ip_comparehttp_client_host_switch_ioloophttp_client_get_pending_request_counthttp_client_context_createhttp_client_context_refhttp_client_init_sharedevent_get_parenthttp_client_init_privatehttp_client_context_unrefio_loop_remove_switch_callbackhttp_client_context_switch_ioloophttp_client_deinithttp_client_waitio_loop_have_iosio_loop_have_immediate_timeoutshttp_client_get_global_contextlib_atexit_priorityio_loop_add_switch_callbackhttp_client_inithttp_server_connection_switch_ioloop_tohttp_server_connection_unrefhttp_server_request_aborthttp_server_response_unrefhttp_server_response_finish_payload_outhttp_server_connection_refhttp_server_connection_start_idle_timeouthttp_server_connection_stop_idle_timeouthttp_server_connection_output_resumehttp_server_connection_output_halthttp_server_connection_handle_output_errorhttp_server_response_submithttp_server_ostream_output_availablewrapper_ostream_output_availablehttp_server_ostream_continuewrapper_ostream_continuehttp_server_ostream_get_sizewrapper_ostream_get_buffered_sizehttp_server_ostream_createhttp_server_response_refwrapper_ostream_createhttp_server_ostream_response_finishedwrapper_ostream_output_destroyedhttp_server_ostream_response_destroyedwrapper_ostream_notify_errorhttp_server_ostream_get_outputhttp_server_ostream_set_errorwrapper_ostream_set_errorhttp_server_connection_outputhttp_server_request_submit_responsehttp_server_response_request_freehttp_server_response_request_destroyhttp_server_response_request_aborthttp_server_request_refhttp_server_request_unrefhttp_server_response_add_headerhttp_server_response_createhttp_server_response_update_statushttp_server_response_set_datehttp_server_response_set_payloadhttp_server_response_set_payload_datahttp_server_response_get_payload_outputhttp_server_request_labelhttp_server_response_add_authhttp_server_response_add_auth_basichttp_server_response_submit_closehttp_server_request_connection_closehttp_server_response_submit_tunnelhttp_server_response_request_finishedhttp_server_request_finishedhttp_server_response_send_payloadhttp_server_response_finish_payloadhttp_server_response_abort_payloadhttp_server_response_send_morehttp_server_connection_closehttp_server_response_sendhttp_server_response_get_statushttp_server_response_get_total_sizehttp_server_response_add_permanent_headeri_stream_read_copy_from_parentiostream_pump_unrefiostream_pump_switch_ioloop_tohttp_server_connection_switch_ioloophttp_server_request_update_eventhttp_server_request_newhttp_server_connection_output_triggerhttp_server_request_destroyhttp_server_request_set_destroy_callbackhttp_server_request_immune_refhttp_server_request_immune_unrefhttp_server_request_gethttp_server_request_get_poolhttp_server_request_get_responsehttp_server_request_get_authhttp_server_request_is_finishedhttp_server_request_is_completehttp_server_connection_pending_payloadhttp_server_request_halt_payloadhttp_server_request_continue_payloadhttp_server_request_receivedhttp_server_request_ready_to_respondhttp_server_connection_tunnelhttp_server_request_failhttp_server_request_callbackhttp_server_resource_callbackhttp_server_request_fail_closehttp_server_request_fail_texthttp_server_request_fail_authhttp_server_request_fail_auth_basichttp_server_request_fail_bad_methodhttp_server_request_get_payload_inputhttp_server_payload_handler_destroyhttp_server_connection_input_resumehttp_server_connection_input_set_pendingiostream_pump_get_inputiostream_pump_get_outputhttp_server_payload_handler_switch_ioloophttp_server_request_forward_payloadhttp_server_request_buffer_payloado_stream_create_bufferhttp_server_request_handle_payloadhttp_server_request_add_response_headermy_hostnamehttp_server_connection_get_statshttp_server_connection_input_halthttp_server_connection_reset_idle_timeouthttp_server_connection_list_inithttp_server_connection_createconnection_init_serverhttp_server_connection_shut_downhttp_server_connection_flushhttp_server_init_ssl_ctxhttp_server_resource_createhttp_server_resource_freehttp_server_resource_get_poolhttp_server_resource_get_pathhttp_server_resource_get_eventhttp_server_resource_add_locationhttp_server_resource_findstr_matchhttp_server_resource_set_destroy_callbackhttp_server_inithttp_server_deinithttp_server_switch_ioloophttp_server_shut_downmodule_dir_unloadi_gettimeofdaystats_dist_addstats_dist_initfs_class_registerfs_class_dictfs_class_posixfs_class_randomfailfs_class_metawrapfs_class_sisfs_class_sis_queuefs_class_testlib_atexitfs_reffs_get_parentfs_get_driverfs_get_root_driverfs_file_set_flagsfs_get_propertiesfs_metadata_initfs_metadata_init_or_clearbuffer_append_buffs_default_set_metadatafs_metadata_findfs_set_metadatafs_file_init_with_eventevent_set_ptrfs_file_timing_endo_stream_abortfs_file_pathfs_unrefstats_dist_deinitt_str_replacemodule_dir_load_missingmodule_dir_initmodule_dir_findmodule_get_symbolfs_init_from_stringevent_get_ptrfs_file_fsfs_file_eventfs_prefetchfs_write_streamfs_write_stream_finish_asyncfs_write_stream_abort_errorfs_file_closefs_file_freefs_write_stream_abort_parentfs_write_set_hashfs_file_set_async_callbackfs_wait_asynci_stream_create_seekable_pathi_stream_create_fs_statsfs_switch_ioloopfs_lockfs_unlockfs_copy_finish_asyncfs_renamefs_iter_init_with_eventfs_iter_set_async_callbackfs_iter_have_morefs_get_statsfs_set_errorfs_get_metadata_fullfs_get_metadatafs_lookup_metadatafs_lookup_loaded_metadatafs_write_stream_finishfs_statfs_existsfs_get_nlinksfs_copyfs_set_error_errnofs_file_set_error_asyncfs_read_via_streamfs_readfs_write_via_streamfs_default_copyfs_stats_get_read_usecsstats_dist_get_sumfs_stats_get_write_usecsfs_file_init_parentfs_iter_init_parentfs_get_eventfs_api_module_registerdict_iterate_deinitdict_iteratedict_iterate_initdict_transaction_begindict_unsetdict_transaction_commitguid_128_to_stringdict_deinitdict_initdict_setfs_wrapper_copyfs_wrapper_file_get_pathfs_wrapper_set_async_callbackfs_wrapper_wait_asyncfs_wrapper_lockfs_wrapper_unlockfs_wrapper_existsfs_wrapper_renamefs_wrapper_deletefs_wrapper_iter_allocfs_wrapper_iter_initfs_wrapper_iter_nextfs_wrapper_iter_deinitfs_wrapper_get_nlinkso_stream_nsend_istreami_stream_create_concatiostream_temp_create_namedo_stream_create_metawrapi_stream_create_metawrapfs_wrapper_file_closefs_wrapper_set_metadatao_stream_create_failure_atclosediropendirfile_unlockstr_to_uint_octreaddir__lxstatmkdir_parentsi_unlink_if_existsutimessafe_mkstemp_hostpido_stream_create_fd_fileo_stream_create_error_strrmdirfile_dotlock_createfile_wait_lockfile_try_lockposix_fadvisei_strcmp_ptest_istream_create_datai_stream_create_errortest_fs_gettest_fs_file_gettest_fs_asynctest_begintest_assert_failedtest_endfs_wrapper_get_propertiesfs_wrapper_get_metadatafs_wrapper_prefetchfs_wrapper_readfs_wrapper_read_streamfs_wrapper_statfs_sis_try_unlink_hash_filestream_cmp_blockfs_sis_path_parseo_stream_cmp_equalso_stream_create_cmpfs_wrapper_writefs_wrapper_write_streamfs_wrapper_write_stream_finishi_stream_init_parenti_stream_create_fs_filememcmpdict_transaction_commit_async_noop_callbackevent_set_nameevent_find_field_recursive_strdict_switch_ioloopdict_pre_api_callbackdict_post_api_callbackdict_lookup_asyncdict_iterate_valuesdict_iterate_set_async_callbackdict_iterate_set_limitdict_iterate_has_moredict_transaction_no_slowness_warningdict_transaction_set_hide_log_valuesdict_transaction_set_timestampdict_transaction_commit_asyncdict_transaction_commit_async_nocallbackdict_atomic_incdict_escape_stringdict_unescape_stringdict_op_settings_dupdict_iter_unsupporteddict_transaction_unsupporteddict_op_settings_private_freedict_waitdict_transaction_rollbackio_wait_timer_moveio_wait_timer_addstr_tabescapeio_loop_is_emptyconnection_input_timeout_reasonconnection_disconnect_reasonnfs_safe_stathome_expand_tilde__open_2stat_first_parenthash_table_updatefchmodfchownstr_to_llonghash_table_lookup_fullfile_dotlock_openfile_lock_freecreatdict_transaction_memory_atomic_incbuffer_append_zerodict_driver_faildns_client_initdns_client_deinitstr_to_intdns_client_connectdns_client_lookup_ptrdns_lookup_ptrdns_ncomparedns_comparedns_compare_labelsimap_arg_get_atomimap_arg_get_quotedimap_arg_get_stringimap_arg_get_astringimap_arg_get_nstringimap_arg_get_literal_sizeimap_arg_get_list_fullimap_arg_get_listimap_arg_as_astringimap_arg_as_nstringimap_arg_as_literal_sizeimap_arg_as_listimap_arg_atom_equalsimap_get_base_subject_caseduni_utf8_to_decomposed_titlecasemessage_header_decode_utf8imap_append_stringimap_append_nstring_nolfimap_bodystructure_writeimap_envelope_writeimap_bodystructure_parse_argsimap_envelope_parse_argsimap_bodystructure_parse_fullimap_parser_createimap_parser_finish_lineimap_parser_unrefimap_parser_get_errorimap_bodystructure_parseimap_body_parse_from_bodystructureimap_parse_dateimap_parse_datetimeimap_to_datetimeutc_offsetimap_to_datetime_tzimap_to_dateimap_append_string_for_humansimap_append_nstringimap_envelope_parseimap_id_reply_generateimap_append_quotedunameimap_id_log_reply_appendimap_id_args_get_log_replyimap_keepalive_interval_msecscrc32_strimap_match_init_multipleimap_match_initimap_match_deinitimap_match_dupimap_match_globs_equalimap_matchimap_parser_refimap_parser_enable_literal_minusimap_parser_resetimap_parser_set_streamsimap_parser_read_argsuchar_empty_ptrimap_parser_get_literal_sizeimap_parser_read_last_literalimap_parser_read_wordimap_parser_read_tagimap_parser_read_command_nameimap_parser_client_read_tagimap_append_astringimap_url_parseuri_parse_slashslash_host_authorityhex_to_binaryimap_url_createuri_append_user_dataiso8601_date_createimap_url_add_urlauthbinary_to_heximap_seq_set_parseseq_range_array_add_rangeimap_seq_set_nostar_parseseq_range_existsimap_seq_range_parseuni_ucs4_to_utf8_cimap_escaped_utf8_hex_to_charuni_utf8_get_charimap_escaped_utf8_to_utf7t_imap_utf8_to_utf7imap_utf7_to_utf8imap_utf7_to_utf8_escapedimap_utf7_is_validimap_write_flagsimap_parse_system_flagimap_write_seq_rangeimap_write_argsimap_write_argstr_append_escapedimap_write_args_for_humanstr_nescapeuni_utf8_get_valid_dataimap_args_to_stristream_attachment_connector_beginistream_attachment_connector_addi_stream_create_base64_encoderi_stream_create_sizedi_stream_create_min_sized_rangeistream_attachment_connector_finishi_stream_create_sized_rangeistream_attachment_connector_aborthash_format_deinit_freei_stream_closei_stream_allochash_format_resethash_format_writebase64_decode_morehash_format_loopbase64_decode_finishmessage_parser_parse_next_blockrfc822_parser_initrfc822_skip_lwsprfc822_parse_content_typei_stream_create_attachment_extractori_stream_attachment_extractor_can_retry__memcpy_chkbuffer_create_from_datai_stream_create_binary_convertermemmovemessage_parse_header_deinitmessage_parse_header_nextbsearch_strcasecmpmessage_parse_header_initi_stream_default_snapshoti_stream_create_header_filteri_stream_header_filter_addnull_header_filter_callbacki_stream_create_nonulsi_stream_default_seek_nonseekableqp_decoder_finishi_stream_read_more_memareaqp_decoder_moreqp_decoder_deiniti_stream_create_qp_decoderqp_decoder_initqp_encoder_finishqp_encoder_moreqp_encoder_deiniti_stream_create_qp_encoderqp_encoder_initstr_to_uint32_hexmail_html2text_initmail_html2text_moremail_html2text_deinitmail_user_hashmd5_get_digestmbox_from_parsembox_from_createrfc822_parse_domainrfc822_parse_atomrfc822_parse_dot_atomrfc822_parse_quoted_stringrfc822_atext_charsrfc822_parse_phrasemessage_address_parse_fullmessage_address_parse_pathmessage_address_writemessage_address_to_stringmessage_address_first_to_stringmessage_address_initmessage_address_init_from_smtpmessage_header_is_addressmessage_binary_part_serializenumpack_encodemessage_binary_part_deserializenumpack_decodemessage_date_parsecharset_to_utf8_endcharset_to_utf8_begincharset_utf8_to_utf8_begincharset_to_utf8_resetmessage_decoder_initmessage_decoder_deinitmessage_decoder_set_return_binarymessage_decoder_parse_cterfc822_parse_mime_tokenmessage_decoder_current_content_typemessage_decoder_decode_resetmessage_decoder_decode_next_blockcharset_to_utf8rfc2231_parsecharset_is_utf8message_header_decodequoted_printable_q_decodemessage_header_encode_qmessage_header_encode_bbase64_encode_get_full_spacemessage_header_encode_datamessage_header_encodemessage_header_hash_moremessage_parse_header_set_limitmessage_parse_header_lower_limitmessage_parse_header_has_nulsmessage_parse_headermessage_header_line_writemessage_header_strdupmessage_header_name_is_validmessage_id_get_nextunsafe_data_stack_poolmessage_size_addmessage_parser_read_moremessage_parser_init_intmessage_parser_deinit_from_partsmessage_parser_parse_headermessage_parser_parse_bodynull_message_part_header_callbackmessage_parser_init_from_partsmessage_part_to_idxmessage_part_by_idxmessage_part_is_equalmessage_part_data_is_plain_7bitmessage_part_data_get_filenamemessage_part_envelope_parse_from_headermessage_part_data_parse_from_headermessage_part_has_content_typeswildcard_match_icasemessage_part_has_parametermessage_part_is_attachmentmessage_part_envelope_headersbuffer_writemessage_part_serializemessage_part_deserializestr_find_moremessage_search_initstr_find_initmessage_search_deinitstr_find_deinitmessage_search_resetstr_find_resetmessage_search_more_get_decodedmessage_search_moremessage_search_more_decodedmessage_search_msgmessage_get_header_sizemessage_get_body_sizemessage_skip_virtualmessage_snippet_generaterfc822_parse_content_paramrfc822_skip_commentdsasl_client_mech_externaldsasl_client_mech_loginjson_parse_skip_nextdsasl_client_mech_xoauth2dsasl_client_mech_oauthbearerdsasl_client_mech_registerdsasl_client_mech_unregisterdsasl_client_set_parameterdsasl_client_get_resultdsasl_clients_initdsasl_clients_deinitauth_client_initauth_client_connection_list_initauth_client_connection_initauth_client_deinitauth_client_connection_deinitauth_client_connectauth_client_connection_connectauth_client_disconnectauth_client_connection_disconnectauth_client_is_connectedauth_client_is_disconnectedauth_client_set_connect_timeoutauth_client_set_connect_notifyauth_client_get_available_mechsauth_client_find_mechauth_client_get_connect_idauth_client_request_newauth_client_connection_add_requestauth_client_request_get_idauth_client_request_get_server_pidauth_client_request_get_cookieauth_client_request_is_abortedauth_client_request_get_create_timeauth_client_request_continueauth_client_request_server_inputauth_client_send_cancelauth_client_request_abortauth_client_connection_remove_requestconnection_input_line_defaultauth_master_initauth_master_deinitauth_master_set_timeoutauth_master_get_socket_pathauth_user_info_exportauth_master_user_lookupauth_user_fields_parsestr_to_uidstr_to_gidauth_master_pass_lookupauth_master_cache_flushauth_master_user_list_initauth_master_user_list_nextauth_master_user_list_deiniticonv_closecharset_utf8_to_utf8iconv_opencharset_iconvuni_utf8_partial_strlen_ncharset_utf8_vfuncscharset_to_utf8_strcharset_utf8onlyssl_iostream_context_cache_freeiostream_ssl_module_initmodule_dir_loadmodule_dir_try_load_missingio_stream_ssl_global_initssl_iostream_context_init_clientssl_iostream_unrefssl_iostream_set_log_prefixssl_iostream_set_sni_callbackssl_iostream_change_contextssl_iostream_has_valid_client_certssl_iostream_has_broken_client_certssl_iostream_cert_match_namessl_iostream_get_peer_namessl_iostream_get_server_namessl_iostream_get_compressionssl_iostream_settings_equalsssl_iostream_settings_drop_stream_onlyssl_iostream_get_cipherssl_iostream_get_pfsssl_iostream_get_protocol_namessl_iostream_test_settings_serverssl_iostream_test_settings_clientdcrypt_deinitializedcrypt_initializedcrypt_set_vfsdcrypt_ctx_sym_createdcrypt_ctx_sym_destroydcrypt_ctx_sym_set_keydcrypt_ctx_sym_set_ivdcrypt_ctx_sym_set_key_iv_randomdcrypt_ctx_sym_get_keydcrypt_ctx_sym_get_ivdcrypt_ctx_sym_get_key_lengthdcrypt_ctx_sym_get_iv_lengthdcrypt_ctx_sym_set_aaddcrypt_ctx_sym_get_aaddcrypt_ctx_sym_set_tagdcrypt_ctx_sym_get_tagdcrypt_ctx_sym_get_block_sizedcrypt_ctx_sym_initdcrypt_ctx_sym_updatedcrypt_ctx_sym_finaldcrypt_ctx_sym_set_paddingdcrypt_ctx_hmac_createdcrypt_ctx_hmac_destroydcrypt_ctx_hmac_set_keydcrypt_ctx_hmac_get_keydcrypt_ctx_hmac_set_key_randomdcrypt_ctx_hmac_get_digest_lengthdcrypt_ctx_hmac_initdcrypt_ctx_hmac_updatedcrypt_ctx_hmac_finaldcrypt_ecdh_derive_secretdcrypt_ecdh_derive_secret_localdcrypt_ecdh_derive_secret_peerdcrypt_pbkdf2dcrypt_keypair_generatedcrypt_key_load_privatedcrypt_key_store_privatedcrypt_key_store_publicdcrypt_key_convert_private_to_publicdcrypt_key_string_get_infodcrypt_key_type_privatedcrypt_key_type_publicdcrypt_key_id_publicdcrypt_key_id_public_olddcrypt_key_id_privatedcrypt_key_id_private_olddcrypt_keypair_unrefdcrypt_key_ref_publicdcrypt_key_ref_privatedcrypt_key_unref_privatedcrypt_rsa_encryptdcrypt_rsa_decryptdcrypt_oid2namedcrypt_name2oiddcrypt_key_store_private_rawdcrypt_key_store_public_rawdcrypt_key_load_private_rawdcrypt_key_load_public_rawdcrypt_key_get_curve_publicdcrypt_key_get_id_publicdcrypt_key_get_id_privatedcrypt_key_set_id_publicdcrypt_key_set_id_privatedcrypt_key_get_usage_publicdcrypt_key_get_usage_privatedcrypt_key_set_usage_publicdcrypt_key_set_usage_privatedcrypt_signparse_jwk_keybuffer_create_from_const_datahash_method_sha256i_stream_nonseekable_try_seeki_stream_encrypt_get_formati_stream_encrypt_get_flagsi_stream_create_decrypti_stream_create_sym_decrypti_stream_create_decrypt_callbacko_stream_create_encryptrandom_fillo_stream_create_sym_encryptfuzzer_initlib_is_initializedfuzzer_deinitfuzzer_io_as_fdsocketpairo_stream_create_final_trickle__printf_chktest_has_failedstdoutfflush__longjmp_chktest_assert_failed_idxtest_assert_failed_strcmp_idxtest_assert_failed_cmp_intmax_idxtest_assert_failed_ucmp_intmax_idxtest_out_reasonfputsfwritetest_out_setjmptest_out_quiettest_expect_error_string_n_timestest_expect_error_stringtest_expect_errorstest_expect_no_more_errorstest_expect_fatal_stringtest_fatal_set_callbacktest_runtest_run_namedtest_run_with_fatalstest_run_named_with_fatalstest_forked_endt_pop_last_unsafetest_exitlib_exitmemarea_get_refcountmemarea_unrefmemarea_inittest_istream_createtest_istream_set_allow_eoftest_istream_set_max_buffer_sizetest_istream_set_sizetest_ostream_createtest_ostream_create_nonblockingtest_ostream_set_max_output_sizetest_subprocess_is_childterminatingsignalraisetest_subprocess_forklib_signals_ioloop_detachlib_signals_ioloop_attachhostpid_initlib_signals_clear_handlers_and_ignoretest_subprocess_kill_alltest_subprocess_set_cleanup_callbacktest_subprocess_notify_signal_sendtest_subprocess_notify_signal_send_parentgetppidtest_subprocess_notify_signal_resettest_subprocess_notify_signal_waiti_sleep_msecstest_subprocesses_inittest_subprocesses_deinitbuffer_get_space_unsafebuffer_write_zeroarray_cmp_ibuffer_cmparray_equal_fn_iarray_equal_fn_ctx_iarray_reverse_it_buffer_getqsortbuffer_get_writable_sizeaqueue_clearaqueue_deleteisattystderrfputctcgetattrtcsetattrt_askpassbacktrace_appendbacktracebacktrace_symbolsbacktrace_getbase32_encodebase32hex_encodebase32_decodebase32hex_decodet_base32_decode_strt_base32hex_decode_strbase32_is_valid_charbase32hex_is_valid_charbase64_get_full_encoded_sizebase64_encode_get_sizebuffer_get_avail_sizet_base64_scheme_encodenearest_powerbsearch_insert_pospool_get_exp_grown_sizebuffer_insert_zerobuffer_get_sizebuffer_verify_poolbuffer_truncate_rshift_bitsbuffer_append_full_istreambuffer_append_full_filei_stream_create_filechild_wait_add_pidlib_signals_set_expectedchild_wait_remove_pidlib_signals_switch_iolooplib_signals_unset_handleri_my_preadi_my_pwriteconnection_handshake_args_defaultio_add_toi_stream_create_unixo_stream_create_unixconnection_update_eventnet_getpeernamenet_getunixcredconnection_input_readconnection_input_defaultfd_close_maybe_stdioconnection_set_handlersconnection_set_default_handlersconnection_init_client_fdgetrusagesetrlimitcpu_limit_get_usage_msecscpu_limit_initgetrlimitcpu_limit_deinitcpu_limit_exceededcrc32_data_morecrc32_datacrc32_str_moredata_stack_frame_idt_try_realloct_get_bytes_availabledata_stack_frame_containsdata_stack_get_alloc_sizedata_stack_get_used_sizedata_stack_free_unuseddata_stack_initt_malloc_no0t_buffer_regett_buffer_alloct_push_namedt_buffer_alloc_last_fulldata_stack_deinit_eventdata_stack_deinitgeteuidgetegidrestrict_get_groups_listgetuidi_getpwuidi_getgrgidt_get_working_direacces_error_get_creatingeperm_error_get_chgrpunsetenvclearenvenv_backup_restoreenv_backup_freeenv_backup_saveevent_find_field_nonrecursiveevent_find_field_recursivei_snprintfevent_filter_create_fragmentevent_filter_parser_lex_initevent_filter_parser_set_extraevent_filter_parser_parseevent_filter_parser_lex_destroyevent_filter_category_to_log_typeevent_filter_category_from_log_typeevent_filter_remove_queries_with_contextevent_filter_mergeevent_filter_merge_with_contextevent_filter_exportevent_filter_get_expr_for_testingevent_filter_query_match_evalwildcard_matchevent_filter_match_sourceevent_filter_match_iter_initevent_filter_match_iter_nextevent_filter_match_iter_deinitevent_filter_initevent_filter_deinitevent_filter_parser__flush_bufferevent_filter_parser_get_extraevent_filter_parser_get_linenoevent_filter_parser_get_columnevent_filter_parser_get_inevent_filter_parser_get_outevent_filter_parser_get_lengevent_filter_parser_get_textevent_filter_parser_set_linenoevent_filter_parser_set_columnevent_filter_parser_set_inevent_filter_parser_set_outevent_filter_parser_get_debugevent_filter_parser_set_debugevent_filter_parser_get_lvalevent_filter_parser_set_lvalevent_filter_parser_alloccalloci_fatal_statusevent_filter_parser__create_bufferevent_filter_parser_lex_init_extraevent_filter_parser_reallocevent_filter_parser_restartevent_filter_parser__switch_to_bufferevent_filter_parser__scan_bufferevent_filter_parser__scan_bytesevent_filter_parser__scan_stringevent_filter_parser_push_buffer_stateevent_filter_parser_lexstdinevent_filter_parser_freeevent_filter_parser__delete_bufferevent_filter_parser_pop_buffer_stateevent_filter_parser_errorstr_to_intmaxevent_category_find_registeredstr_to_uintmaxevent_sendevent_vsendevent_want_log_levelevent_filter_replace_counterevent_logvevent_set_sourcee_logevent_logevent_unset_forced_debugevent_get_global_debug_log_filterevent_unset_global_debug_log_filterevent_get_global_debug_send_filterevent_unset_global_debug_send_filterevent_get_global_core_log_filterevent_unset_global_core_log_filterexecvexecvpsignal_term_counterpollprocess_title_getstr_append_maxfailure_exiti_log_typevi_log_typefailure_log_type_prefixesprintf_format_fixfailure_handleri_syslog_error_handleri_syslog_fatal_handleri_debugi_set_info_handleri_set_debug_handleri_get_failure_handlersopenlogi_unset_failure_prefixi_get_failure_prefixi_failure_parse_linestr_parse_uintfd_set_nonblocki_failure_handler_is_internali_set_failure_send_ipi_set_failure_send_prefixi_set_failure_exit_callbackfailures_deinit__syslog_chkfailure_log_type_namesfcntlfd_debug_verify_leaksfdatasync_pathsendmsgrecvmsgfile_cache_new_pathfile_cache_newfile_cache_freemunmap_anonfile_cache_set_sizemmap_get_page_sizemremap_anonmmap_anonfile_cache_readfile_cache_get_mapfile_cache_invalidatemy_madvisefile_cache_set_fdfile_cache_writefile_lock_set_unlink_on_freefile_lock_set_close_on_freefile_create_lockedsafe_mkstempmkdir_parents_chownsafe_mkstemp_groupmkdir_parents_chgrpfile_lock_set_pathfile_copyumaski_unlinknfs_safe_lstatnfs_flush_file_handle_cachenfs_flush_attr_cache_unlockedi_randi_sleep_usecsftruncatefile_lock_wait_startio_add_notifyfile_lock_wait_endnfs_safe_linknfs_flush_attr_cache_maybe_lockedutimefile_dotlock_open_groupfile_dotlock_touchfile_dotlock_is_lockedfile_lock_method_parsefile_lock_method_to_strfile_lock_findfile_lock_from_dotlockfile_lock_get_pathflockfile_lock_try_updatefile_set_sizeposix_fallocate__memset_chkfile_preallocateguid_generateclock_gettimeguid_128_host_hash_getsha1_get_digestguid_128_is_emptyguid_128_equalsguid_128_from_stringguid_128_hashmem_hashguid_128_cmpguid_128_to_uuid_stringguid_128_from_uuid_stringprimes_closesthash_table_freezehash_table_thawhash_table_copystrfastcase_hashhash_format_inithash_format_deinithash_methodshash_method_get_digestt_hash_datahash_method_md4hash_method_md5hash_method_sha1hash_method_sha384hash_method_sha512hash_method_sha3_256hash_method_sha3_512hash2_createhash2_destroyhash2_clearhash2_lookuphash2_iteratehash2_insert_hashhash2_inserthash2_removehash2_remove_iterhash2_countbinary_to_hex_ucasedec2hexhex2dect_hmac_datat_hmac_buffert_hmac_strhmac_hkdfuchar_nulhmac_md5_get_cram_contexthmac_md5_set_cram_contexthome_try_expandi_getpwnamhook_build_inithook_build_updatehook_build_deinitgethostnamehostpid_deiniti_realloci_memdupp_strdup_vprintfvstrconcatstatic_system_poolipwd_deinitgetpwnam_rgetpwuid_ri_getgrnamgetgrnam_rgetgrgid_rio_stream_initio_stream_refio_stream_unrefio_stream_freeio_stream_closeio_stream_set_max_buffer_sizeio_stream_add_destroy_callbackio_stream_remove_destroy_callbackio_stream_set_verrorio_stream_switch_ioloop_toio_stream_get_ioloopo_stream_get_max_buffer_sizeiostream_pump_refiostream_pump_stopiostream_pump_is_waiting_outputiostream_proxy_createiostream_proxy_startiostream_proxy_set_completion_callbackiostream_proxy_get_istreamiostream_proxy_get_ostreamiostream_proxy_refiostream_proxy_unrefiostream_proxy_stopiostream_proxy_is_waiting_outputiostream_proxy_switch_ioloopi_stream_create_rawlogo_stream_create_rawlognet_connect_ip_blockingiostream_rawlog_initiostream_rawlog_closeiostream_rawlog_writeiostream_rawlog_create_prefixiostream_rawlog_create_pathiostream_rawlog_create_from_streami_stream_create_rawlog_from_streamo_stream_create_rawlog_from_streamio_stream_copypwrite_fullo_stream_temp_move_to_memoryi_stream_get_absolute_offsetiso8601_date_parse_tmiso8601_date_create_tmmemarea_free_without_callbackmemarea_refi_stream_copy_fdi_stream_set_init_buffer_sizei_stream_set_persistent_buffersi_stream_set_blockingi_stream_snapshot_freei_stream_get_last_read_timei_stream_seek_marki_stream_synci_stream_last_line_crlfi_stream_get_modifiable_datai_stream_read_limitedi_stream_compressi_stream_grow_bufferi_stream_try_alloc_avoid_compressi_stream_memarea_detachi_stream_get_root_ioi_stream_set_ioi_stream_unset_ioio_is_pendingmemarea_init_emptyi_stream_create_base64_decoderi_stream_create_base64url_decoderi_stream_create_base64url_encoderi_stream_create_callbacki_stream_callback_appendi_stream_callback_append_stri_stream_callback_get_bufferi_stream_callback_set_errori_stream_create_lfi_stream_create_copy_from_datai_stream_create_failure_at_eofi_stream_file_closei_stream_file_readi_stream_create_file_commoni_stream_create_hashi_stream_create_jsonstri_stream_multiplex_add_channeli_stream_create_multiplexi_stream_multiplex_get_channel_ido_stream_create_fd_autoclosepread_fulli_streams_mergei_stream_create_seekabletee_i_stream_createtee_i_stream_create_childtee_i_stream_child_is_waitingistream_try_createi_stream_unix_set_read_fdi_stream_unix_unset_read_fdi_stream_unix_get_read_fdpriorityq_peekpriorityq_countpriorityq_itemsio_set_never_wait_alonepriorityq_removepriorityq_addio_loop_run_get_wait_timeio_loop_stop_delayedio_loop_set_max_fd_countio_loop_set_time_moved_callbackpriorityq_initio_loop_get_rootio_loop_add_destroy_callbackio_loop_remove_destroy_callbackio_loop_context_newio_loop_context_refio_loop_handle_addio_loop_handler_inittimeout_add_absoluteio_loop_context_unrefio_loop_handle_removeio_loop_notify_removeio_remove_closedio_loop_context_add_callbacksio_loop_context_remove_callbacksio_loop_context_activateevent_push_globalio_loop_context_deactivateevent_pop_globalio_loop_handle_timeoutsio_loop_call_ioio_loop_handler_runio_loop_handler_run_internalio_loop_context_switchio_loop_get_current_contextio_loop_get_wait_usecsio_loop_find_fd_conditionsio_loop_notify_handler_deinitpriorityq_poppriorityq_deinitio_loop_handler_deinitio_loop_get_active_global_rootioloop_iolist_addioloop_iolist_delio_notify_fd_addio_notify_fd_freeio_notify_fd_findinotify_add_watchinotify_initinotify_rm_watchio_loop_extract_notify_fdepoll_createepoll_ctli_sleep_intr_msecsepoll_waitjson_parser_init_flagsjson_parse_next_streamjson_append_escaped_ucs4ostream_escaped_json_formatjson_append_escaped_datajson_append_escapedjson_tree_find_child_withi_getopt_resetoptindrandom_initlib_event_initvar_expand_extensions_initvar_expand_extensions_deinitlib_event_deinitrestrict_access_deinitprocess_title_deinitrandom_deinitdovecot_build_infoevent_has_all_categoriesevent_passthrough_vfuncsevent_reason_code_prefix__ctype_tolower_locevent_replace_log_prefixevent_set_log_prefix_callbackevent_set_log_message_callbackevent_unset_log_message_callbackevent_set_always_log_sourceevent_set_min_log_levelevent_get_min_log_levelevent_add_categoriesevent_has_all_fieldsp_array_const_string_joinevent_strlist_appendevent_strlist_replaceevent_add_int_nonzeroevent_inc_intevent_add_timevalevent_copy_fieldsevent_add_fieldsevent_field_clearevent_get_create_timeevent_get_last_send_timeevent_get_last_durationevent_get_fieldsevent_get_categoriesevent_copy_categoriesevent_flattenevent_import_unescapedevent_importevent_dupevent_enable_user_cpu_usecssigemptysetsigactionsigfillsetsigprocmaskdec2str_buflog_throttle_initlog_throttle_deinitlog_throttle_acceptmd4_initmd4_updatemd4_finalmd4_get_digestmd5_initmd5_updatemd5_finalmemarea_getmemarea_get_sizememarea_free_callback_nooppool_allocfree_createpool_allocfree_create_cleanpool_allocfree_get_total_used_sizepool_allocfree_get_total_alloc_sizepool_system_freemalloc_usable_sizemkdir_chownmkdir_chgrpmmapmremapmunmapmmap_filemmap_ro_filemmap_rw_filegetpagesizedlclosemodule_get_symbol_quietdlerrordlsymmodule_dir_deinitmodule_file_get_namedlopenmodule_get_plugin_namemountpoint_iter_initsetmntentmountpoint_iter_nextgetmntentmountpoint_iter_deinitendmntentmountpoint_getnet_try_bindi_strocpyusleepnet_set_corksetsockoptnet_set_tcp_quickacknet_listen_unixnet_listen_unix_unlink_stalenet_receivenet_gethostbyaddrgetnameinfoin6addr_anynet_getunixnamegetsockoptinet_ntopnet_connect_udpnet_listen_fullnet_listeninet_atongetaddrinfofreeaddrinfonet_ipv6_mapped_ipv4_convertgai_strerrornet_get_hosterror_typenet_hosterror_notfoundnet_getservbyportis_ipv4_addressis_ipv6_addressnet_ip6_loopbacknet_ip4_loopbacknfs_flush_attr_cache_fd_lockednfs_safe_opennfs_flush_read_cache_lockednfs_flush_read_cache_unlockednumpack_decode32o_stream_seeko_stream_ignore_last_errorso_stream_pwriteo_stream_get_last_write_timeo_stream_flush_parent_if_neededo_stream_create_erroro_stream_create_passthrougho_stream_create_failure_at_flusho_stream_file_closeo_stream_file_writevo_stream_file_sendvsafe_sendfileo_stream_create_file_commono_stream_create_fd_file_autocloseo_stream_create_fileo_stream_create_hasho_stream_multiplex_add_channelo_stream_create_multiplexo_stream_multiplex_get_channel_ido_stream_create_nullo_stream_unix_write_fdwrapper_ostream_trigger_flushgetcwdt_normpatht_normpath_tot_realpatht_realpath_tot_abspath_tot_abspathpkcs5_pbkdfprintf_format_fix_get_lenprintf_format_fix_unsafeseteuidstr_to_uint64sysconfprocess_stat_read_startprocess_stat_read_finishgetrandomsrandgetgroupssetresgidsetuidgetgidinitgroupssetgidsetgroupsrestrict_access_set_envrestrict_access_get_envrestrict_access_by_envrestrict_access_get_current_chrootrestrict_access_set_dumpableprctlrestrict_access_get_dumpablerestrict_access_use_priv_gidsetegidrestrict_access_drop_priv_gidrestrict_access_have_priv_gidrestrict_process_sizerestrict_process_countrestrict_fd_limitrestrict_get_process_sizerestrict_get_core_limitrestrict_get_process_limitrestrict_get_fd_limitsafe_mkdirsafe_mkstemp_hostpid_groupseq_range_array_addseq_range_array_add_with_initseq_range_array_add_range_countseq_range_array_mergeseq_range_array_merge_nseq_range_array_removeseq_range_array_remove_rangeseq_range_array_remove_seq_rangeseq_range_array_intersectseq_range_array_have_commonseq_range_countseq_range_array_invertseq_range_array_iter_initseq_range_array_iter_nthseq_range_array_remove_nthseqset_builder_initseqset_builder_addseqset_builder_try_addseqset_builder_deinitsha1_initsha1_padsha1_loopsha1_result_libmysqlclient_craps_all_oversha256_initsha256_loopsha256_resultsha256_get_digestsha384_initsha384_loopsha384_resultsha384_get_digestsha512_initsha512_loopsha512_resultsha512_get_digestsha3_256_initsha3_512_initsha3_loopsha3_256_resultsha3_512_resultsha3_256_get_digestsha3_512_get_digestnanosleepi_sleep_secsi_sleep_intr_usecsi_sleep_intr_secsbsearch_strcmpstats_dist_init_with_sizestats_dist_resetstats_dist_get_countstats_dist_get_minstats_dist_get_maxstats_dist_get_avgstats_dist_get_medianstats_dist_get_variancestats_dist_get_percentilestats_dist_get_samplest_str_new_conststr_free_without_datastr_equals__vsnprintf_chkstr_truncate_utf8uni_utf8_data_truncatestr_find_get_match_end_posstr_sanitize_appendstr_sanitize_append_utf8str_table_initstr_table_deinitstr_table_is_emptystr_table_refstr_table_unrefstr_append_unescapedstr_unescape_nextstr_append_tabescaped_nstr_append_tabunescapedt_strsplit_tabescaped_inplacep_strsplit_tabescapedt_noalloc_strdup_vprintfi_strstr_arrt_str_trimp_str_trimt_str_ltrimp_str_ltrimt_str_rtrimp_str_rtrimtiming_safety_unoptimizationstr_equals_timing_almost_safei_memspni_memcspnp_strsplitp_strsplit_spacesp_strsplit_freestr_array_removestr_is_numericstr_is_floatstr_parse_uint32str_parse_ulongstr_parse_uint64str_parse_ullongstr_to_ulongstr_to_ullongstr_parse_uintmax_hexstr_parse_uint_hexstr_parse_uint32_hexstr_parse_ulong_hexstr_parse_uint64_hexstr_parse_ullong_hexstr_to_uintmax_hexstr_to_uint_hexstr_to_ulong_hexstr_to_uint64_hexstr_to_ullong_hexstr_parse_uintmax_octstr_parse_uint_octstr_parse_uint32_octstr_parse_ulong_octstr_parse_uint64_octstr_parse_ullong_octstr_to_uintmax_octstr_to_uint32_octstr_to_ulong_octstr_to_uint64_octstr_parse_intmaxstr_parse_intstr_parse_int32str_parse_longstr_parse_int64str_parse_llongstr_to_int32str_to_longstr_to_inostr_parse_uoffi_nanosecondstime_to_local_day_startt_strftimet_strfgmtimestr_to_timevalunix_socket_createfchdirunlink_directoryunlink_old_filesutf8_replacement_charuni_strlenuni_utf8_to_ucs4uni_utf8_to_ucs4_nuni_ucs4_to_utf8uni_utf8_strlen_nuni_utf8_strlenuni_ucs4_to_titlecaseuni_utf8_str_is_validuni_utf8_data_is_validuri_parse_pct_encodeduri_parse_unreserveduri_parse_unreserved_pcturi_parse_path_segmenturi_parser_init_datauri_cut_schemeuri_parser_get_tmpbufuri_parse_reg_nameuri_parse_host_nameuri_parse_hosturi_parse_authorityuri_parse_slashslash_authorityuri_parse_absolute_genericuri_check_datauri_checkuri_data_encodeuri_append_userinfouri_append_host_nameuri_append_host_ipuri_append_path_segment_datauri_append_path_segmenturi_append_pathuri_append_queryuri_append_fragment_datauri_append_fragmenturi_append_unreserveduri_append_unreserved_pathtimegmvar_expand_longvar_get_keyvar_get_key_rangevar_expand_ifvar_expand_register_func_arrayvar_expand_unregister_func_arrayvar_expand_merge_tablesregerrorregcompregexecregfreelibdl.so.2libc.so.6__environ__cxa_atexit_edata__bss_startlibdovecot.so.0GLIBC_2.2.5GLIBC_2.25GLIBC_2.27GLIBC_2.11GLIBC_2.14GLIBC_2.3.4GLIBC_2.10GLIBC_2.3.2GLIBC_2.4GLIBC_2.7GLIBC_2.17GLIBC_2.3/usr/local/cpanel/3rdparty/lib64	
				
V ui	�a�������
��������
�ti		�����ri	�ii
ii

���ui	�ii
�<D�<�C �< �<@�<-�P�<2�`�<;�p�<F���<K���<_���<h���<q���<|���<����<����<���<�� �<A�(�<�60�<�8�<��@�<
8H�<x6P�<D�X�<.�h�<Лp�<P�x�<����<���<���<���<���<c���<��<pV�<�Y`�<�7h�<��p�<�x�<2���<-���<�7��<�7��<���<!���<�=��<`�<��< �<��<�n �<��0�<��8�<�=H�<�=h�<���<�=��<�=��<�=��<�=�<>@�<�_H�<�_��<`	��<p	��<�	�<�_�<�<�<`�<8�<pR	`�<E{h�<V{p�<Ix�<$i��<����<����<g{��<����<����<����<����<�}��<w{��<���<�{(�<�{H�<�{h�<�{��<�{��<�{��<�{��<y�<y(�<!yH�<�{h�<�{��<�{��<|��<|��<-|�<>|(�<P|H�<i|��<�y��< �<��<��<��<�Q=��<����<����<����<���<���<��(�<ȂH�<тh�<ق��<���<���<��<1��<��<�<`�<8�<�y	`�<
�h�<��p�<��x�<����<����<����<����<����<����<���<"���<����<����<1��<-�(�<4�H�<G�h�<Y���<i���<x���<����<���<��(�<��H�<҃h�<���<����<���<)���<5��<O�H�<�	h�<��	��<S���<`��<���<��<
��<� �<�(�<%�0�<,�@�<5�H�<9�P�<=�X�<A�`�<E�h�<I�p�<M���<Q���<U���<Y���<]���<a���<e���<i���<m���<q���<u���<y���<}���<��
��<�
��<��
H�<дX�< ���<N���<H��<`��<>��<��<"��<����<΀��<[��<i��<p��<��<���<`Y�<@U(�<�X0�<PU8�<�^@�<YH�<`XP�<`UX�<pU`�<�Uh�<�Up�<@]x�< ^��<�U��<�\��<`\��<�W��<�^��<�U��<�]��<�[��<�_��<�`��<`[��<�^��<�W��<@V�<Vh�<����<���< ���<p���<@�(�<@	
0�<�
8�<�
��< )
��<�
��<�.
��<g<��<k<H�<�8
P�<7
h�<�<
��<Q���<U���<Y���<]���<a���<e���<i���<m���<q���<u���<y���<}��<9`�<�{ �<�`0�<��@�<�`P�<�``�<�`p�<DU��<�`��<�`��<�`��<�`��<�`��<Va��<[��<�`�<�`�<�` �<�`0�<�`@�<�`P�<�``�<�`p�<�`��<�`��<Ba��<�`��<a��<a��<ga��<a��<a�<a�<a �<%a0�<,a@�<3aP�<:a`�<Aap�<Ha��<Na��<Ua��<Za��<`a��<fa��<ma��<ta��<{a�<�a�<�a �<�a0�<�a@�<�aP�<�a`�<�ap�<�a��<�a��<�a��<�a��<�a��<����<�a��<�a��<�a�<�a�<�a �<�a0�<�a@�<�aP�<�a`�<bp�<b��<b��<b��<b��<#b��<)b��<0b��<7b��<>b�<Db�<Ib �<Pb0�<Wb@�<]bP�<bb`�<fbp�<mb��<tb��<{b��<�b��<�b��<�b��<�b��<�b��<�b�<�b�<�b �<�b0�<�b@�<�bP�<�b`�<�bp�<�b��<�b��<�b��<�b��<Ia��<Oa��<�b��<�b��<�b�<�b�<c �<	c0�<c@�<cP�<c`�<cp�<#c��<*c��<-c��<0c��<3c��<;c��<>c��<Bc��<Hc�<Lc�<Tc �<Xc0�<\c@�<`cP�<fc`�<lcp�<qc��<wc��<}c��<�c��<�b��<�c��<�c��<�c��<�c�<�c�<�c �<�c0�<�c@�<�cP�<�c`�<�cp�<�c��<�c��<�c��<�c��<�c��<�c��<�c��<�c��<�c�<�c�<�c �<�c0�<d@�<	dP�<d`�<dp�<d��<d��< d��<&d��<,d��<2d��<8d��<>d��<Dd�<Jd�<Qd �<Xd0�<]d@�<ddP�<kd`�<qdp�<wd��<~d��<�d��<�d��<�d��<�d��<�d��<�d��<�d�<�d�<�d �<�d0�<�d@�<�dP�<�d`�<�dp�<�d��<�d��<�d��<�d��<�d��<�d��<@m��<g��<���<�d�<�d �<�d0�<e@�<eP�<	e`�<
ep�<e��<e��< e��<%e��<�e��<o���<�e��<+e��</e�<3e�<7e �<>e0�<Be@�<GeP�<K�`�<Mep�<tp��<�d��<Xe��<Se��<We��<\e��<ae��<fe��<le�<se�<xe �<}e0�<�e@�<�eP�<�e`�<�ep�<�e��<�e��<�e��<�e��<�e��<�e��<Q���<U���<Y���<]��<a��<e��<i��<m� �<q�(�<u�0�<y�8�<}�@�<5�H�<9�P�<=�X�<A�`�<E�h�<I�p�<M���<�g��<�g��<7v��<�g��<�g��<�g��<�g��<�g��<�g��<�g��<�g��<5���<9���<=���<A��<E��<I��<M� �<Q�(�<U�0�<Y�8�<]�@�<a�H�<e�P�<i�X�<m�`�<q�h�<u�p�<y�x�<}���<���<���<P���<E���<����<��<:��<�� �<��@�<��X�<��`�<��h�<��p�<p���<���<����<����<����<p���<���<7���<7�H�<'P�<  `�<#x�<���<���<�_��<�_�<p/�<P2 �<0/(�<�-8�<0+`�<@Xh�<@Up�<Ux�<W��<�[��<�[��<�[��<�[��<y�<w��<ߋ�<����<s��<`��<�� �<H�(�<s�0�<V�8�<f�@�<l�H�<-�P�<�X�<s�`�<�h�<�Gp�<�x�<w���<�f��<{���<P���<����<����<d���<;M��<���<�7��<�.�<�.�<�. �<"\8�<б@�<�H�<P�`�<�@x�<����<����<���<����<����<���<p���<���<���<���<���<p��<���<����<���<���<��<@��<�� �<��8�<p�@�<��H�<��`�<�x�<���<���<��<���<���< ��<P��<����<P��<���<�� �<��8�<�@�<@
H�<�
`�<��x�<`��<@
��<�
��<@���<����<���<���<0��<���<P��<P��<�(�<М8�<��`�<_�p�<q���<h���<����<K���<;���<F��<2��<���<���<n.�<P
�<p(�<00�<�8�<�@�<@H�<��<���<@��<���<P�<��<��<��<���<`�<�h�<.p�<`x�<���<��<`��<�%��<���<0��<�<��<0�<p%�<@%�<�#��<�#�<#�<�(�<p0�<@�<q�<`&�<�(�<�%�<�(��<�4=�(=0(8=`0@=`4H=0P=�2X=�/`=�3h= 3p=�0x=%o�=`/�=/�=�.�=@.�=.�=�4�=2�=&�=1�=�-(=X0=�S8=�:H=5P=�5X=pS`=�9h=�8p=�7�=�Q�=Q�=0P�=0K�=PJ�=`R�=@N�=�7�=�>�=�=�=@C�=�M=L=@S=P6= ? =�5�=L�=�f�=Pq�=`f�=�s�=�o�= o�=�n=n =@s(=r`=@h�=]�=�v�=�z=pv= } =�|(=�zx=z�=0|�=�{�=pxP=�P=�LP=E P= I(P=�H0P=�J8P=D@P=@LHP=�F�P=�XQ=�=xQ=�=�Q=�`�Q=Ȇ�Q=6c�Q=ц�Q=؆�Q=܆R=�R=�� R=�0R=$i@R=�PR=��`R=�pR=���R=���R=��R=��R=��R=��R= �S=~yS=�y@S=A�HS=�PS=�XS=�v`S=�hS=!�pS=D�xS=.��S=���S=�T=�8T=�XT=n.�T=R�T=p��T=���T=��T=���T=���T=��T=���T=���T=��T= ��T=���T=���T=@��T=@��T= �U=��U=��U=��U=@��U=���U=��U=���U=���U=@��U=���U=P��V=s1�V=���V=���V=`�`W=n5hW=`	
pW=�
�W=�
�W=�
�W=�
@X=�7HX=�
PX=�
XX=�
`X=�+
�X=3
�X=@)
�X=�'
�X=�$
�X=$
�X=�"
 Y=w(Y=4
0Y=04
8Y=`5
@Y=@4
HY=`4
PY=p4
XY=�4
`Y=�4
hY=�4
pY=p5
xY=5
�Y= 5
�Y=05
�Y=@5
�Y=P5
�Z=g<�Z=���Z=�u�Z=�g�Z=�g[=7v[=�g[=�g[=�g [=4v([=@vH\=7��_=@`=`=��`=�`=W�`=�� `=��(`=�0`=F�8`=@�@`=P�H`=��P`=/�X`=0�``=w�h`=ߋp`=��x`=s��`=`��`=���`=��`=�`=�`=�`=�`="`a=�<�a=�r�a=s�a=Pt�a=�t�a=@u�a=�x�a= y�a=��b=P~b=`�b=��b=� b=p�(b=�0b=��8b=�@b=�h�b=���b=`��b=���b=0��b=��b=���b=���b=�c=��c=��c=p�c=��(c=��0c=�8c=��@c=c=`c=pc=pc=�c=�c=���c=���c=P��c=���c=���c=���c=@��c=��h�<Zx�<=��<W��<���<x��<��<��<��<P��<�p�<��=�XN=��<0HO=0��<=�=8=�M=��<+ =+�=+@=+�N=+�<N(=N�=NH=N�L=N�<B0=B�=B�M=B�<�8=��=�xO=� �<?@=?�=?HL=?8�<�X=��=�HM=�@�<�`M=�H�<Th=T�=T�M=TP�<�p=��=��O=�X�<��K=�`�<��N=�p�<.�=.�=.PO=.=U0=UhO=U0=��=�P=�(L=��=�=��K=��=S
X=S
N=S
=�`=��M=�=�h=�`K=�=p=�K=H=~�=~�N=~P={�={O={K=
	K=OK=,K= K=�	(K=q0K=�8K=�@K=~HK=�PK=wXK=hK=�	pK=xK=R	�K=�K=�K=�K=��K=��K=*�K=U�K=��K=��K=��K=��K=��K=�L=L=�L=	L=� L=�0L=	8L=�@L=�PL=0XL=
`L=hL=
pL=fxL=m�L=��L=��L=?�L=�
�L=��`=��L=��L=�	�L=�	�L=^�L=��L=��L=|�L=a�L=�L=�	M=eM=!	M=gM=� M=�	(M=�0M={8M=H	@M=PM=XM=hM=BpM=!xM=��M="�M=�M=�M=��M=��M=7�M=��M=m�M=@�M=�M=�
�c=�
�M=�N=�N=�N=� N=(N=C0N=8N=	@N=tHN=�PN=�
`N=�	hN=�pN=�xN=��`=��`=��`=��N=��N=G�N=�N=d�N=�N=�N=��N=�8a=��N=�N=��Q=��N=C	�N=��N=�O=�O=�O=|	 O=&(O=�0O=v8O=�@O=�XO=�`O=VpO=��O=R�O=Y	�O=	�O=e�O=p�O=��O=��O=��O=i�O=*
�O=1�O=b�O=�PP=��U=��W=�XP=�U=�W=`P=2V=2�W=2V=a�W=aZ=g`Z=gX\=A a=-	(a=0	0a=E@a=�Ha=Pa=^Xa=Ipa=R�b=R c=4`=h=�	p=nx=s
�=��=d�=N�=&�=�=�=R�=M�=d�=��=d�=��=��=_�=u�="=�=b=t=Y =)(=�0=8=@=H=	P=[X=`=?
h=p=�x=��=��=K�=��=��=��=��=y�=��=��=��=&�=�=d
�=��=��=�
=@
=;
=8
=� 
=(
=�0
=8
=@
=�H
=�P
=�X
=`
=�h
=�p
=x
=��
=�
=��
=�
=��
=�	�
=`�
=��
=��
=��
=��
=�
=��
=b�
=�
=	�
=�	=,=�=�=� =(=0=�8=
@=�H=�P=%X=�`=!h=ep=;x=�=��=��=�=�=��=��=Q
�=��=C�=d�=�=�=4
�=��=��=�=(=�=z=�
 =9(=�0=�8=D@=GH=8P=�	X=
`=�h=bp=�x=�
�=��=�=��=�=��=w�=��=P�=�=��=�	�=A�=	�=�
�=��==X=-=�=k =t
(=�0=v	8=�@=�H=�P=�
X=�`=h=
p=�x=f�=)�=T	�=D
�=��=��=��=��=��={�=��=<	�=��=?�=p�=�
�=w=�=�=}=2 =�(=�0=8=N@=^H=�P=�X=�
`=�h=zp=x=�=�=��=H�={�=��=_�=�	�=4�=t	�=#�=<�=V�= �=��=�
�=F==-=�=} =(=�0=�8=I@=H=wP= 	X=`=Ph=�p=�x=N�=N�=�=s�=��=Y�=��=~�=�=
�=��=$�=:�=��=��=��=c=x=�==� =�(=�
0={8=�@=�H=-P=X=�
`=T
h=%p=�x=>�=�=��=U
�=��=��=�=�=��=��=�=�	�=	�=�
�=��=��=n
=�=�=�	= =n(=0=o8=&@=�H=JP=�	X= `=[	h=�p=`
x=4	�=A�=!�=�=��=��=�	�=��=��=��=$
�=��=��=�=*�=��=�=�=G=	=� =�	(=�0=8=�@=�H=P=>X=_`=
h=�p=�x="�=��=�=
�=#�=��=$�=%�=��=��=
�=��=�=7	�=��=&�====�=1 =4(=	0=�
8=�@==H=�P=�X='`=�h=?p=Jx=�=k�=��=��=��=i�=x�=��=@�=w�=��=��=��==	�=��=�=&=r=�=�=[ =U(=e0=�	8=V	@=H=
P=	X=�`=8h=Ep=V
x=6�=��=��=��=A�=S�=��=F�=��=(�=[
�=�=��=>�=�
�=�	�=�=`=�===6 =)(=^	0=�8=5@=�H=P=
X=H`=�h=�p=)x=�=�	�=�
�=)�=

�=��=u�=�
�=e�=��=��=L	�=9�=~�=M	�=	�=>=�=�=�=� =(=+0=�8=�@=H=P=@X=<`=�h=�p=,x=q�=-�=�=��=��=S�=;�=��=1�=��=��=x�=�
�=/�=��=2�=�=:=�=�=� =�(=0=�8=�@=�H=%P=.X=�`=Fh=�p=�x=T�=/�=�=��=`�=��=�=f�=	�=	�=�
�=
�=c�=0�=�=�=j=�
=|=J=5 =�(=0=18=
@=H=�P=9
X=g
`=2h=�	p=	x=3�=��=��=��=&�=4�=x�=5�=��=�
�=c�=8�=��=��=��=�	�=�= =6==7 =8(=�0=�	8=
@=�H=�P=�X=�`=Ah=p=�x=S�=��=��=��=��=(�=��=
�=`�=�
�=Y�=�=�	�=��=��=��=9==8	=&=� =�(=h0=�8=�@=MH=:P=�X= `=h=�p=$x=\
�=�	�=��=�
�=��=�=E�=T�=��=u�=��=G�=>�=�=��=(�=�=^=%=;=�
 =A(=�0=8=�@=�
H=fP=�X=�`=	h=Yp=�x=`�=�=�
�=_�=W�=P	�=�
�=��=%�=��=�
�=��=O�=K�=]
�=<�===>=�
=�=� =d(=?0=@8=@=�H=pP=�X=`=Ah=Bp=x=��=��=H
�=C�=��=q	�=��=��=��=	�=��=��=��=��=D�=r�=+ =� =� =' =?	  =�( =�
0 =#8 =H@ =�H =�P =�X =` =Qh =|p =�x =� =o� =� =4� =�� =8� =� =_� =0� =�	� =�� =�� =� =�� =�� =�� =!=�!=�!=!=_	 !=�(!=�0!=	8!=�	@!=TH!=�P!=�
X!=E`!=�h!=
p!=Ux!=��!=g�!=(	�!=j�!=F�!=��!=<�!=��!=O
�!=��!=�!=]�!=O�!=?�!=t�!=u�!="=�
"=�"=Q"=a
 "=y("=#0"=�8"=�@"=�H"=BP"=�X"=G`"=)h"=p"=\x"=l	�"=�"=��"=��"=��"=��"=��"=��"=��"=H�"=��"=V�"=��"=H�"=��"=	�"=B#=S#=/
#=I#=� #= (#=�0#=J8#=T@#=^H#=�
P#=pX#=W`#=�	h#=Np#=w	x#=5�#=�#="�#=��#=$�#=k�#=3�#=X�#=�#=�
�#=K�#=�#=+�#=H�#=L�#=��#=�$=M$=�$=�$=�	 $=S($=�0$=#	8$=�@$=NH$=�P$=�
X$=�`$=j
h$=@p$=�x$=��$=O�$=P�$=Q�$=��$=Y�$=\�$=�$=��$=��$=8�$=�$=*�$=F�$=R�$=I�$=%=g%=%==%=� %=�(%=�
0%=u
8%=�	@%=hH%=P%=�
X%=)`%=�h%=p%=Sx%=T�%=�
�%=��%=|�%=h	�%=U�%=��%=9�%=V�%=9�%=W�%=�%=j�%= �%=�	�%=H�%=-&=�&=�&=
&=� &=�(&=�0&=8&=�@&=�H&=P&=�X&=�
`&=�h&=Yp&=ix&=��&=Z�&=�	�&=��&=P�&=x	�&=��&=��&=x
�&=�	�&=��&=��&= �&=-�&=U	�&=[�&=g'=d	'=K'=�'=� '=�	('=�0'=�8'=%@'=\H'=�	P'=�	X'=�`'=]h'=\p'=�x'=��'=�'=��'=h�'=�
�'=��'=��'=��'=v�'='�'=��'=�	�'=3�'=�	�'=p�'=��'=�(=�(=K(=W(=� (=((=�0(=^8(=_@(=�H(=KP(=+X(=�`(=�h(=Jp(=�x(=�
�(=��(=��(=e�(=�(=�(=��(=��(=`�(=�(=/�(=��(=��(=L�(=��(=�(=�)=K)=�)=�)='	 )=b()=�0)=
8)=O@)=H)=zP)=0X)=i`)=eh)=�p)=x)=��)=��)=�	�)=�)=��)=�)=��)=x�)=��)=��)=��)=#
�)=g�)=c�)=l
�)=,�)=F*=�*=,*=x*=^ *=�	(*=	0*=d8*=�@*=+
H*=P*=+X*=V`*=�h*=�p*=�x*=�
�*=f�*=��*=�*=�	�*=��*=�*=	�*=.�*=F�*=��*=G�*=7�*=�*=��*=�	�*=�+=�+=a+=�+=c +=B
(+=�0+=Q8+=�@+=�H+=	P+=�X+=L`+=�h+=^
p+=yx+=��+=m
�+=h�+=i�+=�+==�+=>�+=��+=G�+=��+=��+=��+=��+=j�+=j�+=k�+=5	,=,=�,=�
,=� ,=�(,=X0,=�8,=@,=H,=�P,=X,=Q`,=0h,=�p,=kx,=`�,=M�,=�
�,=l�,=��,=P�,=S�,=m�,=��,=$	�,=��,=D�,=
�,=n�,=�,="�,=�-=�-=�-=?-=o -=p(-= 
0-=8-=�@-=�H-=�P-=R
X-=l`-=�h-=�p-=cx-=<�-=��-=
�-=��-=��-=q�-=i�-=��-=��-=��-=��-=��-=1�-=�-=�-=r�-=�.=�.=�
.=i.=%	 .=�(.=�0.=s8.=.@.=7H.=%P.=�X.=�`.=Oh.=3p.=K
x.=�.=t�.=��.=v�.=u�.=>�.=Y�.=��.=�.=(�.=�.=��.=�.=��.=S�.=Q�.=�/=j/=�/=�/=7 /=�(/=�0/=�8/=�@/=AH/=mP/=@X/=d`/=�
h/=�
p/=vx/=��/=��/=��/=|
�/=�
�/=�
�/=;�/=w�/=��/=��/=w
�/=��/=(�/=�/=[�/=��/=�0=�0=�0=�0=� 0=3(0=�00=�80=�@0=�	H0=�P0=�	X0=`0=gh0=p0=�x0=��0=w�0=	
�0=_�0=x�0=y�0=z�0=��0=L�0=��0==�0=��0=��0=��0={�0=��0=�1=�1=�
1=V1=� 1=%(1=|01=}81=�@1=�H1=�P1=X1=�	`1=Dh1=?p1=�x1=j�1=��1=�1=!�1=)�1=~�1=V�1=y�1=��1=�1=Z�1=f�1=��1=��1=��1=_�1=�2=�2=42=G2=h 2=�(2=�02=v82=�@2=�H2=CP2=X2=:`2=Bh2=�p2=x2=��2=�2=:
�2=�
�2=�	�2=!
�2=��2=��2=-�2=2�2=�2=�	�2=}
�2=p	�2=��2=��2=�
3=3=A3=m3=j 3=C(3=03=~	83=�@3=VH3=�P3=�X3=�`3=h3=�p3=x3=J�3=��3=m�3=��3=��3=��3=��3=��3=��3=��3=�3=��3=��3=�3=��3=��3=Z4=I4=x4=.	4=� 4=4(4=204=�84=�@4=�H4=�
P4=/X4=�`4=h4=�p4=|x4=��4=!�4=�4=i	�4=P�4=��4=7
�4=��4=�
�4=�
�4=��4=L�4=��4='�4=�4=r�4=M5=�5=	5=�5=� 5=I
(5=005=�85=E@5=~
H5=�P5=�X5=�`5=Oh5=
p5=Kx5=��5=1�5=��5=:�5="�5=�	�5=��5=��5=�
�5=;�5= �5=I	�5=��5=��5=*�5=��5=�6=6=P6=�6=� 6=k(6=}06=r	86=5@6=nH6=qP6=(
X6=
`6=�h6=Dp6=�x6=��6=��6=��6=q�6=��6=��6=��6=%�6=�6=��6=h�6=7�6=s�6=�
�6=�
�6=�6=�7=37=�7=7=r
 7=�(7=07=H87=�	@7=�H7=�P7=0X7=e`7=�h7=�
p7=�x7=��7=
�7=��7=�7=��7=��7=z�7=��7=1
�7=�7=��7=��7=��7=��7=/�7=��7=�8=9	8=�8=�8=G 8=W(8='
08=R88=�@8={H8=�P8=�X8=:	`8=�h8=�p8=�	x8=��8=�	�8=�	�8=,�8=
�8=��8=�
�8=��8=��8=��8=��8=�8=��8=��8=F
�8=��8=�9=�9=�9=Q9=� 9=}(9=�09=�89=y@9=DH9=*P9=]	X9=�
`9=�h9=�p9=�x9=��9=B�9=S�9=��9=3�9=��9=�	�9=�9=�9=�
�9=��9=��9=�	�9=��9=��9=��9=�:=|:=�:=P:=� :=}(:=�0:=8:=�@:=�H:=�
P:=zX:=+`:=�h:=�p:=+x:=��:=�:=k
�:=�:=��:=�	�:=��:=T�:=��:=��:=��:=��:=��:=��:=�	�:=-�:=�;=;=q;=�;= ;=�(;=t0;=�8;=G@;=fH;=�	P;=dX;=�`;=.
h;=�
p;=�x;=l�;=�;=��;=�;=��;=��;=��;=��;=�	�;=��;=�;=>�;=r�;=��;=m�;=G�;=h<=�<=(<=�
<== <=�(<=5
0<=�8<=�@<=(H<=�P<=�X<=`<=�h<=�p<=�x<=�	�<=��<=��<=�	�<=l�<=
�<=��<=~�<=�
�<=��<=2
�<=�<=��<=�<=�<=�<===�==�==o==C ==9(==�	0==�8==*@==H==oP==
X==�	`==�h==p==7x==�==��==�
�==��==Z�==��==�==��==<�==�
�==��==�==��==�	�==�==��==�>=>=c	>=�>=� >=�(>=�0>=r8>=@>=�H>=�P>=�X>=@`>=h>=
p>=x>=�
�>=��>=#�>=�
�>=U�>=��>=��>=��>=]�>=��>=��>=�>={�>=l�>=��>=0�>=�?=L?=p
?=�?=� ?=�(?=�0?=T8?=�@?=�H?=�P?=�X?=2`?=�h?=�p?=�
x?=\�?=��?=��?=��?=��?=
�?=��?=��?=��?=3�?=<�?=@�?=��?=�?=��?=D�?=5@=Z@=�	@=D@=� @=(@=]0@='8@=�@@=�H@=sP@=X@=/`@=�	h@=�p@=.x@=-�@=��@=�@=��@=I�@=��@=	�@=1	�@=\�@=��@=�@=��@=a�@=��@=��@=��@=h
A=�
A=�A=�
A=�
 A=�(A=C0A=�8A=E	@A=zHA=�PA=^XA=<`A=hA=�pA=�xA=$�A=�A=m�A=��A=��A=b�A=<�A=��A=��A=;	�A={�A=i
�A=��A=��A=��A=��A=1B=�B=�B=;
B=�	 B=�(B=�0B=�
8B=%@B=�	HB=gPB=XB=�
`B=�hB=0pB=�xB=W�B=��B=�B=)	�B=��B=��B=��B=��B=
�B=6�B=��B=2	�B=C�B=��B=�B=��B=xC=�C="C==C=; C=9(C=�0C=k	8C=9@C=0HC=VPC=�XC=�`C=�	hC=�pC=9xC=��C=&�C=�
�C=�C=��C=
�C=s�C=�C=��C=�C=��C=�	�C=�C=s�C=��C=5�C=�D=�
D=�D=�D=� D=3
(D=90D=�	8D=v@D=�HD=wPD=O	XD=Z`D=�hD=XpD=�	xD= �D=��D=��D=J
�D=�
�D=�D=6�D=��D=�	�D=:�D=	�D=��D=��D=�D=X�D=E�D=�	E=�E=�E=UE=� E=�(E=Q0E=D	8E=�@E=�HE=B	PE=`XE=�`E=�hE=_pE=�xE=��E=��E=*�E=c�E=�	�E=��E=��E=I�E=��E=T�E=;�E=��E=6�E=:�E=$�E=�	�E=<
F=�F=�F=qF=� F=�(F=�0F=�8F=�@F=�HF=�PF=�XF=�`F=)hF=�pF=�xF==�F=��F=��F=�	�F=��F=A�F=��F=c�F=N�F=y�F=��F=��F=9�F=��F=��F=R�F=�
G=�G=G=�G=z G=�(G=O0G=/8G=L@G=�HG=�PG=,	XG=K`G=8
hG=�	pG=�xG='�G=�
�G=6	�G=��G=:�G=Z
�G=��G=N
�G=*�G=c�G=7�G=^�G=��G=B�G=��G=��G=�H=H=
H="H=* H=�
(H=�0H=�8H=b	@H=sHH=GPH=�XH=�`H=�	hH=�	pH=�xH=n�H=�
�H=*�H=f�H=��H=��H=��H=��H=��H=��H=R�H=��H=�
�H=	�H=\	�H=.�H=�	I=n	I=�I=�I=� I=(I=L0I=i8I=X@I=gHI=�PI=!XI=z`I=�hI=�
pI=	xI=&
�I=&	�I=J�I="
�I=m	�I=��I=L�I=��I=^�I=��I=��I=��I=,�I=}�I=6
�I=p�I=�J=dJ=J=J=� J=	(J=�0J=�8J=u@J=1HJ=�PJ=XJ=F	`J=EhJ=�pJ=�xJ=��J=��J=�J=D�J=��J=�
�J=��J=��J=��J=�J=~�J=��J=��J=4�J=��J=b�J=��H��H�!i9H��t��H����5Z'9�%['9��h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h	��Q������h
��A������h��1������h��!������h
��������h��������h������h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h��Q������h��A������h��1������h��!������h��������h��������h������h �������h!��������h"�������h#�������h$�������h%�������h&�������h'��q������h(��a������h)��Q������h*��A������h+��1������h,��!������h-��������h.��������h/������h0�������h1��������h2�������h3�������h4�������h5�������h6�������h7��q������h8��a������h9��Q������h:��A������h;��1������h<��!������h=��������h>��������h?������h@�������hA��������hB�������hC�������hD�������hE�������hF�������hG��q������hH��a������hI��Q������hJ��A������hK��1������hL��!������hM��������hN��������hO������hP�������hQ��������hR�������hS�������hT�������hU�������hV�������hW��q������hX��a������hY��Q������hZ��A������h[��1������h\��!������h]��������h^��������h_������h`�������ha��������hb�������hc�������hd�������he�������hf�������hg��q������hh��a������hi��Q������hj��A������hk��1������hl��!������hm��������hn��������ho������hp�������hq��������hr�������hs�������ht�������hu�������hv�������hw��q������hx��a������hy��Q������hz��A������h{��1������h|��!������h}��������h~��������h������h��������h���������h��������h��������h��������h��������h��������h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���������h��������h��������h��������h��������h��������h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���������h��������h��������h��������h��������h��������h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h�������h�������h������h������h������h������h������h���q���h���a���h���Q���h���A���h���1���h���!���h������h������h�������h�������h�������h������h������h������h������h������h���q���h���a���h���Q���h���A���h���1���h���!���h������h������h�������h�������h�������h������h������h������h������h������h���q���h���a���h���Q���h���A���h���1���h���!���h������h������h�������h�������h�������h������h������h������h������h������h���q���h���a���h���Q���h���A���h���1���h���!���h������h������h�������h�������h�������h������h������h������h������h������h���q���h���a���h���Q���h���A���h���1���h���!���h������h������h��������h�������h�������h������h������h������h������h������h��q����h��a����h	��Q����h
��A����h��1����h��!����h
������h������h�������h�������h�������h������h������h������h������h������h��q����h��a����h��Q����h��A����h��1����h��!����h������h������h�������h �������h!�������h"������h#������h$������h%������h&������h'��q����h(��a����h)��Q����h*��A����h+��1����h,��!����h-������h.������h/�������h0�������h1�������h2������h3������h4������h5������h6������h7��q����h8��a����h9��Q����h:��A����h;��1����h<��!����h=������h>������h?�������h@�������hA�������hB������hC������hD������hE������hF������hG��q����hH��a����hI��Q����hJ��A����hK��1����hL��!����hM������hN������hO�������hP�������hQ�������hR������hS������hT������hU������hV������hW��q����hX��a����hY��Q����hZ��A����h[��1����h\��!����h]������h^������h_�������h`�������ha�������hb������hc������hd������he������hf������hg��q����hh��a����hi��Q����hj��A����hk��1����hl��!����hm������hn������ho�������hp�������hq�������hr������hs������ht������hu������hv������hw��q����hx��a����hy��Q����hz��A����h{��1����h|��!����h}������h~������h�������h��������h��������h�������h�������h�������h�������h�������h���q����h���a����h���Q����h���A����h���1����h���!����h�������h�������h��������h��������h��������h�������h�������h�������h�������h�������h���q����h���a����h���Q����h���A����h���1����h���!����h�������h�������h��������h��������h��������h�������h�������h�������h�������h�������h���q����h���a����h���Q����h���A����h���1����h���!����h�������h�������h��������h��������h��������h�������h�������h�������h�������h�������h���q����h���a����h���Q����h���A����h���1����h���!����h�������h�������h��������h��������h��������h�������h�������h�������h�������h�������h���q����h���a����h���Q����h���A����h���1����h���!����h�������h�������h��������h��������h��������h�������h�������h�������h�������h�������h���q����h���a����h���Q����h���A����h���1����h���!����h�������h�������h��������h��������h��������h�������h�������h�������h�������h�������h���q����h���a����h���Q����h���A����h���1����h���!����h�������h�������h��������h��������h��������h�������h�������h�������h�������h�������h���q����h���a����h���Q����h���A����h���1����h���!����h�������h�������h���������h��������h��������h�������h�������h�������h�������h�������h��q�����h��a�����h	��Q�����h
��A�����h��1�����h��!�����h
�������h�������h��������h��������h��������h�������h�������h�������h�������h�������h��q�����h��a�����h��Q�����h��A�����h��1�����h��!�����h�������h�������h��������h ��������h!��������h"�������h#�������h$�������h%�������h&�������h'��q�����h(��a�����h)��Q�����h*��A�����h+��1�����h,��!�����h-�������h.�������h/��������h0��������h1��������h2�������h3�������h4�������h5�������h6�������h7��q�����h8��a�����h9��Q�����h:��A�����h;��1�����h<��!�����h=�������h>�������h?��������h@��������hA��������hB�������hC�������hD�������hE�������hF�������hG��q�����hH��a�����hI��Q�����hJ��A�����hK��1�����hL��!�����hM�������hN�������hO��������hP��������hQ��������hR�������hS�������hT�������hU�������hV�������hW��q�����hX��a�����hY��Q�����hZ��A�����h[��1�����h\��!�����h]�������h^�������h_��������h`��������ha��������hb�������hc�������hd�������he�������hf�������hg��q�����hh��a�����hi��Q�����hj��A�����hk��1�����hl��!�����hm�������hn�������ho��������hp��������hq��������hr�������hs�������ht�������hu�������hv�������hw��q�����hx��a�����hy��Q�����hz��A�����h{��1�����h|��!�����h}�������h~�������h��������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h���������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h���������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h���������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h���������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h���������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h���������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h���������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h���������h��������h��������h�������h�������h�������h�������h�������h��q�����h��a�����h	��Q�����h
��A�����h��1�����h��!�����h
�������h�������h��������h��������h��������h�������h�������h�������h�������h�������h��q�����h��a�����h��Q�����h��A�����h��1�����h��!�����h�������h�������h��������h ��������h!��������h"�������h#�������h$�������h%�������h&�������h'��q�����h(��a�����h)��Q�����h*��A�����h+��1�����h,��!�����h-�������h.�������h/��������h0��������h1��������h2�������h3�������h4�������h5�������h6�������h7��q�����h8��a�����h9��Q�����h:��A�����h;��1�����h<��!�����h=�������h>�������h?��������h@��������hA��������hB�������hC�������hD�������hE�������hF�������hG��q�����hH��a�����hI��Q�����hJ��A�����hK��1�����hL��!�����hM�������hN�������hO��������hP��������hQ��������hR�������hS�������hT�������hU�������hV�������hW��q�����hX��a�����hY��Q�����hZ��A�����h[��1�����h\��!�����h]�������h^�������h_��������h`��������ha��������hb�������hc�������hd�������he�������hf�������hg��q�����hh��a�����hi��Q�����hj��A�����hk��1�����hl��!�����hm�������hn�������ho��������hp��������hq��������hr�������hs�������ht�������hu�������hv�������hw��q�����hx��a�����hy��Q�����hz��A�����h{��1�����h|��!�����h}�������h~�������h��������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h���������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h���������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h���������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h���������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h���������h���������h���������h��������h��������h��������h��������h��������h���q�����h���a�����h���Q�����h���A�����h���1�����h���!�����h��������h��������h�������h��������h���������h��������h��������h��������h��������h��������h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���������h��������h��������h��������h��������h��������h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h�������h��ѿ�����h�������h�鱿�����h�顿�����h�鑿�����h�避�����h��q������h��a������h	��Q������h
��A������h��1������h��!������h
��������h��������h������h�������h��Ѿ�����h�������h�鱾�����h�顾�����h�鑾�����h�遾�����h��q������h��a������h��Q������h��A������h��1������h��!������h��������h��������h������h �������h!��ѽ�����h"�������h#�鱽�����h$�顽�����h%�鑽�����h&�遽�����h'��q������h(��a������h)��Q������h*��A������h+��1������h,��!������h-��������h.��������h/������h0�������h1��Ѽ�����h2�������h3�鱼�����h4�顼�����h5�鑼�����h6�遼�����h7��q������h8��a������h9��Q������h:��A������h;��1������h<��!������h=��������h>��������h?������h@�������hA��ѻ�����hB�������hC�鱻�����hD�须�����hE�鑻�����hF�遻�����hG��q������hH��a������hI��Q������hJ��A������hK��1������hL��!������hM��������hN��������hO������hP�������hQ��Ѻ�����hR�������hS�鱺�����hT�顺�����hU�鑺�����hV�遺�����hW��q������hX��a������hY��Q������hZ��A������h[��1������h\��!������h]��������h^��������h_������h`�������ha��ѹ�����hb�������hc�鱹�����hd�项�����he�鑹�����hf�遹�����hg��q������hh��a������hi��Q������hj��A������hk��1������hl��!������hm��������hn��������ho������hp�������hq��Ѹ�����hr�������hs�鱸�����ht�顸�����hu�鑸�����hv�選�����hw��q������hx��a������hy��Q������hz��A������h{��1������h|��!������h}��������h~��������h������h��������h���ѷ�����h��������h��鱷�����h��顷�����h��鑷�����h��遷�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���Ѷ�����h��������h��鱶�����h��顶�����h��鑶�����h��遶�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���ѵ�����h��������h��鱵�����h��页�����h��鑵�����h��遵�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���Ѵ�����h��������h��鱴�����h��顴�����h��鑴�����h��遴�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���ѳ�����h��������h��鱳�����h��顳�����h��鑳�����h��遳�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���Ѳ�����h��������h��鱲�����h��顲�����h��鑲�����h��遲�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���ѱ�����h��������h��鱱�����h��顱�����h��鑱�����h��遱�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���Ѱ�����h��������h��鱰�����h��顰�����h��鑰�����h��遰�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h�������h��ѯ�����h�������h�鱯�����h�顯�����h�鑯�����h�遯�����h��q������h��a������h	��Q������h
��A������h��1������h��!������h
��������h��������h������h�������h��Ѯ�����h�������h�鱮�����h�顮�����h�鑮�����h�遮�����h��q������h��a������h��Q������h��A������h��1������h��!������h��������h��������h������h �������h!��ѭ�����h"�������h#�鱭�����h$�顭�����h%�鑭�����h&�遭�����h'��q������h(��a������h)��Q������h*��A������h+��1������h,��!������h-��������h.��������h/������h0�������h1��Ѭ�����h2�������h3�鱬�����h4�顬�����h5�鑬�����h6�遬�����h7��q������h8��a������h9��Q������h:��A������h;��1������h<��!������h=��������h>��������h?������h@�������hA��ѫ�����hB�������hC�鱫�����hD�顫�����hE�鑫�����hF�遫�����hG��q������hH��a������hI��Q������hJ��A������hK��1������hL��!������hM��������hN��������hO������hP�������hQ��Ѫ�����hR�������hS�鱪�����hT�顪�����hU�鑪�����hV�遪�����hW��q������hX��a������hY��Q������hZ��A������h[��1������h\��!������h]��������h^��������h_������h`�������ha��ѩ�����hb�������hc�鱩�����hd�顩�����he�鑩�����hf�適�����hg��q������hh��a������hi��Q������hj��A������hk��1������hl��!������hm��������hn��������ho������hp�������hq��Ѩ�����hr�������hs�鱨�����ht�顨�����hu�鑨�����hv�遨�����hw��q������hx��a������hy��Q������hz��A������h{��1������h|��!������h}��������h~��������h������h��������h���ѧ�����h��������h��鱧�����h��顧�����h��鑧�����h��遧�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���Ѧ�����h��������h��鱦�����h��顦�����h��鑦�����h��遦�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���ѥ�����h��������h��鱥�����h��顥�����h��鑥�����h��遥�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���Ѥ�����h��������h��鱤�����h��顤�����h��鑤�����h��遤�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���ѣ�����h��������h��鱣�����h��顣�����h��鑣�����h��遣�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���Ѣ�����h��������h��鱢�����h��顢�����h��鑢�����h��遢�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���ѡ�����h��������h��鱡�����h��顡�����h��鑡�����h��遡�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���Ѡ�����h��������h��鱠�����h��顠�����h��鑠�����h��遠�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h�������h��џ�����h�������h�鱟�����h�顟�����h�鑟�����h�遟�����h��q������h��a������h	��Q������h
��A������h��1������h��!������h
��������h��������h������h�������h��ў�����h�������h�鱞�����h�類�����h�鑞�����h�遞�����h��q������h��a������h��Q������h��A������h��1������h��!������h��������h��������h������h �������h!��ѝ�����h"�������h#�鱝�����h$�顝�����h%�鑝�����h&�遝�����h'��q������h(��a������h)��Q������h*��A������h+��1������h,��!������h-��������h.��������h/������h0�������h1��ќ�����h2�������h3�鱜�����h4�顜�����h5�鑜�����h6�遜�����h7��q������h8��a������h9��Q������h:��A������h;��1������h<��!������h=��������h>��������h?������h@�������hA��ћ�����hB�������hC�鱛�����hD�顛�����hE�鑛�����hF�遛�����hG��q������hH��a������hI��Q������hJ��A������hK��1������hL��!������hM��������hN��������hO������hP�������hQ��њ�����hR�������hS�鱚�����hT�顚�����hU�鑚�����hV�遚�����hW��q������hX��a������hY��Q������hZ��A������h[��1������h\��!������h]��������h^��������h_������h`�������ha��љ�����hb�������hc�鱙�����hd�顙�����he�鑙�����hf�遙�����hg��q������hh��a������hi��Q������hj��A������hk��1������hl��!������hm��������hn��������ho������hp�������hq��ј�����hr�������hs�鱘�����ht�願�����hu�鑘�����hv�遘�����hw��q������hx��a������hy��Q������hz��A������h{��1������h|��!������h}��������h~��������h������h��������h���ї�����h��������h��鱗�����h��顗�����h��鑗�����h��遗�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���і�����h��������h��鱖�����h��顖�����h��鑖�����h��遖�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���ѕ�����h��������h��鱕�����h��顕�����h��鑕�����h��違�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���є�����h��������h��鱔�����h��顔�����h��鑔�����h��達�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���ѓ�����h��������h��鱓�����h��顓�����h��鑓�����h��道�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���ђ�����h��������h��鱒�����h��顒�����h��鑒�����h��遒�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���ё�����h��������h��鱑�����h��顑�����h��鑑�����h��遑�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���ѐ�����h��������h��鱐�����h��顐�����h��鑐�����h��遐�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h�������h��я�����h�������h�鱏�����h�顏�����h�鑏�����h�遏�����h��q������h��a������h	��Q������h
��A������h��1������h��!������h
��������h��������h������h�������h��ю�����h�������h�鱎�����h�顎�����h�鑎�����h�過�����h��q������h��a������h��Q������h��A������h��1������h��!������h��������h��������h������h �������h!��э�����h"�������h#�鱍�����h$�額�����h%�鑍�����h&�遍�����h'��q������h(��a������h)��Q������h*��A������h+��1������h,��!������h-��������h.��������h/������h0�������h1��ь�����h2�������h3�鱌�����h4�題�����h5�鑌�����h6�遌�����h7��q������h8��a������h9��Q������h:��A������h;��1������h<��!������h=��������h>��������h?������h@�������hA��ы�����hB�������hC�鱋�����hD�顋�����hE�鑋�����hF�運�����hG��q������hH��a������hI��Q������hJ��A������hK��1������hL��!������hM��������hN��������hO������hP�������hQ��ъ�����hR�������hS�鱊�����hT�顊�����hU�鑊�����hV�遊�����hW��q������hX��a������hY��Q������hZ��A������h[��1������h\��!������h]��������h^��������h_������h`�������ha��щ�����hb�������hc�鱉�����hd�顉�����he�鑉�����hf�遉�����hg��q������hh��a������hi��Q������hj��A������hk��1������hl��!������hm��������hn��������ho������hp�������hq��ш�����hr�������hs�鱈�����ht�顈�����hu�鑈�����hv�遈�����hw��q������hx��a������hy��Q������hz��A������h{��1������h|��!������h}��������h~��������h������h��������h���ч�����h��������h��鱇�����h��顇�����h��鑇�����h��遇�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���ц�����h��������h��鱆�����h��顆�����h��鑆�����h��遆�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���х�����h��������h��鱅�����h��顅�����h��鑅�����h��遅�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���ф�����h��������h��鱄�����h��顄�����h��鑄�����h��遄�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���у�����h��������h��鱃�����h��顃�����h��鑃�����h��遃�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���т�����h��������h��鱂�����h��顂�����h��鑂�����h��遂�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���с�����h��������h��鱁�����h��顁�����h��鑁�����h��遁�����h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���р�����h��������h��鱀������%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݧ8D���%է8D���%ͧ8D���%ŧ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݦ8D���%զ8D���%ͦ8D���%Ŧ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݥ8D���%ե8D���%ͥ8D���%ť8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݤ8D���%դ8D���%ͤ8D���%Ť8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݣ8D���%գ8D���%ͣ8D���%ţ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݢ8D���%բ8D���%͢8D���%Ţ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݡ8D���%ա8D���%͡8D���%š8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݠ8D���%ՠ8D���%͠8D���%Š8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݟ8D���%՟8D���%͟8D���%ş8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݞ8D���%՞8D���%͞8D���%Ş8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݝ8D���%՝8D���%͝8D���%ŝ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݜ8D���%՜8D���%͜8D���%Ŝ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݛ8D���%՛8D���%͛8D���%ś8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݚ8D���%՚8D���%͚8D���%Ś8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݙ8D���%ՙ8D���%͙8D���%ř8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݘ8D���%՘8D���%͘8D���%Ř8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݗ8D���%՗8D���%͗8D���%ŗ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݖ8D���%Ֆ8D���%͖8D���%Ŗ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݕ8D���%Օ8D���%͕8D���%ŕ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݔ8D���%Ք8D���%͔8D���%Ŕ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݓ8D���%Փ8D���%͓8D���%œ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݒ8D���%Ւ8D���%͒8D���%Œ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݑ8D���%Ց8D���%͑8D���%ő8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݐ8D���%Ր8D���%͐8D���%Ő8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݏ8D���%Տ8D���%͏8D���%ŏ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݎ8D���%Վ8D���%͎8D���%Ŏ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%ݍ8D���%Ս8D���%͍8D���%ō8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%݌8D���%Ռ8D���%͌8D���%Ō8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%݋8D���%Ջ8D���%͋8D���%ŋ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%݊8D���%Պ8D���%͊8D���%Ŋ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%݉8D���%Չ8D���%͉8D���%ʼn8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%݈8D���%Ո8D���%͈8D���%ň8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%݇8D���%Շ8D���%͇8D���%Ň8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%݆8D���%Ն8D���%͆8D���%ņ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%݅8D���%Յ8D���%ͅ8D���%Ņ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%݄8D���%Մ8D���%̈́8D���%ń8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%݃8D���%Ճ8D���%̓8D���%Ń8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%݂8D���%Ղ8D���%͂8D���%ł8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%݁8D���%Ձ8D���%́8D���%Ł8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%��8D���%��8D���%�8D���%�8D���%݀8D���%Հ8D���%̀8D���%ŀ8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%��8D���%}�8D���%u�8D���%m�8D���%e�8D���%]�8D���%U�8D���%M�8D���%E�8D���%=�8D���%5�8D���%-�8D���%%�8D���%�8D���%�8D���%
�8D���%�8D���%�8D���%�8D���%�8D���%�8D���%�8D���%�8D���%�8D���%�8D���%�8D���%�8D���%�8D���%�8D���%�8D���%�8D���%�8D���%�8D���%}8D���%u8D���%m8D���%e8D���%]8D���%U8D���%M8D���%E8D���%=8D���%58D���%-8D���%%8D���%8D���%8D���%
8D���%8D���%�~8D���%�~8D���%�~8D���%�~8D���%�~8D���%�~8D���%�~8D���%�~8D���%�~8D���%�~8D���%�~8D���%�~8D���%�~8D���%�~8D���%�~8D���%�~8D���%}~8D���%u~8D���%m~8D���%e~8D���%]~8D���%U~8D���%M~8D���%E~8D���%=~8D���%5~8D���%-~8D���%%~8D���%~8D���%~8D���%
~8D���%~8D���%�}8D���%�}8D���%�}8D���%�}8D���%�}8D���%�}8D���%�}8D���%�}8D���%�}8D���%�}8D���%�}8D���%�}8D���%�}8D���%�}8D���%�}8D���%�}8D���%}}8D���%u}8D���%m}8D���%e}8D���%]}8D���%U}8D���%M}8D���%E}8D���%=}8D���%5}8D���%-}8D���%%}8D���%}8D���%}8D���%
}8D���%}8D���%�|8D���%�|8D���%�|8D���%�|8D���%�|8D���%�|8D���%�|8D���%�|8D���%�|8D���%�|8D���%�|8D���%�|8D���%�|8D���%�|8D���%�|8D���%�|8D���%}|8D���%u|8D���%m|8D���%e|8D���%]|8D���%U|8D���%M|8D���%E|8D���%=|8D���%5|8D���%-|8D���%%|8D���%|8D���%|8D���%
|8D���%|8D���%�{8D���%�{8D���%�{8D���%�{8D���%�{8D���%�{8D���%�{8D���%�{8D���%�{8D���%�{8D���%�{8D���%�{8D���%�{8D���%�{8D���%�{8D���%�{8D���%}{8D���%u{8D���%m{8D���%e{8D���%]{8D���%U{8D���%M{8D���%E{8D���%={8D���%5{8D���%-{8D���%%{8D���%{8D���%{8D���%
{8D���%{8D���%�z8D���%�z8D���%�z8D���%�z8D���%�z8D���%�z8D���%�z8D���%�z8D���%�z8D���%�z8D���%�z8D���%�z8D���%�z8D���%�z8D���%�z8D���%�z8D���%}z8D���%uz8D���%mz8D���%ez8D���%]z8D���%Uz8D���%Mz8D���%Ez8D���%=z8D���%5z8D���%-z8D���%%z8D���%z8D���%z8D���%
z8D���%z8D���%�y8D���%�y8D���%�y8D���%�y8D���%�y8D���%�y8D���%�y8D���%�y8D���%�y8D���%�y8D���%�y8D���%�y8D���%�y8D���%�y8D���%�y8D���%�y8D���%}y8D���%uy8D���%my8D���%ey8D���%]y8D���%Uy8D���%My8D���%Ey8D���%=y8D���%5y8D���%-y8D���%%y8D���%y8D���%y8D���%
y8D���%y8D���%�x8D���%�x8D���%�x8D���%�x8D���%�x8D���%�x8D���%�x8D���%�x8D���%�x8D���%�x8D���%�x8D���%�x8D���%�x8D���%�x8D���%�x8D���%�x8D���%}x8D���%ux8D���%mx8D���%ex8D���%]x8D���%Ux8D���%Mx8D���%Ex8D���%=x8D���%5x8D���%-x8D���%%x8D���%x8D���%x8D���%
x8D���%x8D���%�w8D���%�w8D���%�w8D���%�w8D���%�w8D���%�w8D���%�w8D���%�w8D���%�w8D���%�w8D���%�w8D���%�w8D���%�w8D���%�w8D���%�w8D���%�w8D���%}w8D���%uw8D���%mw8D���%ew8D���%]w8D���%Uw8D���%Mw8D���%Ew8D���%=w8D���%5w8D���%-w8D���%%w8D���%w8D���%w8D���%
w8D���%w8D���%�v8D���%�v8D���%�v8D���%�v8D���%�v8D���%�v8D���%�v8D���%�v8D���%�v8D���%�v8D���%�v8D���%�v8D���%�v8D���%�v8D���%�v8D���%�v8D���%}v8D���%uv8D���%mv8D���%ev8D���%]v8D���%Uv8D���%Mv8D���%Ev8D���%=v8D���%5v8D���%-v8D���%%v8D���%v8D���%v8D���%
v8D���%v8D���%�u8D���%�u8D���%�u8D���%�u8D���%�u8D���%�u8D���%�u8D���%�u8D���%�u8D���%�u8D���%�u8D���%�u8D���%�u8D���%�u8D���%�u8D���%�u8D���%}u8D���%uu8D���%mu8D���%eu8D���%]u8D���%Uu8D���%Mu8D���%Eu8D���%=u8D���%5u8D���%-u8D���%%u8D���%u8D���%u8D���%
u8D���%u8D���%�t8D���%�t8D���%�t8D���%�t8D���%�t8D���%�t8D���%�t8D���%�t8D���%�t8D���%�t8D���%�t8D���%�t8D���%�t8D���%�t8D���%�t8D���%�t8D���%}t8D���%ut8D���%mt8D���%et8D���%]t8D���%Ut8D���%Mt8D���%Et8D���%=t8D���%5t8D���%-t8D���%%t8D���%t8D���%t8D���%
t8D���%t8D���%�s8D���%�s8D���%�s8D���%�s8D���%�s8D���%�s8D���%�s8D���%�s8D���%�s8D���%�s8D���%�s8D���%�s8D���%�s8D���%�s8D���%�s8D���%�s8D���%}s8D���%us8D���%ms8D���%es8D���%]s8D���%Us8D���%Ms8D���%Es8D���%=s8D���%5s8D���%-s8D���%%s8D���%s8D���%s8D���%
s8D���%s8D���%�r8D���%�r8D���%�r8D���%�r8D���%�r8D���%�r8D���%�r8D���%�r8D���%�r8D���%�r8D���%�r8D���%�r8D���%�r8D���%�r8D���%�r8D���%�r8D���%}r8D���%ur8D���%mr8D���%er8D���%]r8D���%Ur8D���%Mr8D���%Er8D���%=r8D���%5r8D���%-r8D���%%r8D���%r8D���%r8D���%
r8D���%r8D���%�q8D���%�q8D���%�q8D���%�q8D���%�q8D���%�q8D���%�q8D���%�q8D���%�q8D���%�q8D���%�q8D���%�q8D���%�q8D���%�q8D���%�q8D���%�q8D���%}q8D���%uq8D���%mq8D���%eq8D���%]q8D���%Uq8D���%Mq8D���%Eq8D���%=q8D���%5q8D���%-q8D���%%q8D���%q8D���%q8D���%
q8D���%q8D���%�p8D���%�p8D���%�p8D���%�p8D���%�p8D���%�p8D���%�p8D���%�p8D���%�p8D���%�p8D���%�p8D���%�p8D���%�p8D���%�p8D���%�p8D���%�p8D���%}p8D���%up8D���%mp8D���%ep8D���%]p8D���%Up8D���%Mp8D���%Ep8D���%=p8D���%5p8D���%-p8D���%%p8D���%p8D���%p8D���%
p8D���%p8D���%�o8D���%�o8D���%�o8D���%�o8D���%�o8D���%�o8D���%�o8D���%�o8D���%�o8D���%�o8D���%�o8D���%�o8D���%�o8D���%�o8D���%�o8D���%�o8D���%}o8D���%uo8D���%mo8D���%eo8D���%]o8D���%Uo8D���%Mo8D���%Eo8D���%=o8D���%5o8D���%-o8D���%%o8D���%o8D���%o8D���%
o8D���%o8D���%�n8D���%�n8D���%�n8D���%�n8D���%�n8D���%�n8D���%�n8D���%�n8D���%�n8D���%�n8D���%�n8D���%�n8D���%�n8D���%�n8D���%�n8D���%�n8D���%}n8D���%un8D���%mn8D���%en8D���%]n8D���%Un8D���%Mn8D���%En8D���%=n8D���%5n8D���%-n8D���%%n8D���%n8D���%n8D���%
n8D���%n8D���%�m8D���%�m8D���%�m8D���%�m8D���%�m8D���%�m8D���%�m8D���%�m8D���%�m8D���%�m8D���%�m8D���%�m8D���%�m8D���%�m8D���%�m8D���%�m8D���%}m8D���%um8D���%mm8D���%em8D���%]m8D���%Um8D���%Mm8D���%Em8D���%=m8D���%5m8D���%-m8D���%%m8D���%m8D���%m8D���%
m8D���%m8D���%�l8D���%�l8D���%�l8D���%�l8D���%�l8D���%�l8D���%�l8D���%�l8D���%�l8D���%�l8D���%�l8D���%�l8D���%�l8D���%�l8D���%�l8D���%�l8D���%}l8D���%ul8D���%ml8D���%el8D���%]l8D���%Ul8D���%Ml8D���%El8D���%=l8D���%5l8D���%-l8D���%%l8D���%l8D���%l8D���%
l8D���%l8D���%�k8D���%�k8D���%�k8D���%�k8D���%�k8D���%�k8D���%�k8D���%�k8D���%�k8D���%�k8D���%�k8D���%�k8D���%�k8D���%�k8D���%�k8D���%�k8D���%}k8D���%uk8D���%mk8D���%ek8D���%]k8D���%Uk8D���%Mk8D���%Ek8D���%=k8D���%5k8D���%-k8D���%%k8D���%k8D���%k8D���%
k8D���%k8D���%�j8D���%�j8D���%�j8D���%�j8D���%�j8D���%�j8D���%�j8D���%�j8D���%�j8D���%�j8D���%�j8D���%�j8D���%�j8D���%�j8D���%�j8D���%�j8D���%}j8D���%uj8D���%mj8D���%ej8D���%]j8D���%Uj8D���%Mj8D���%Ej8D���%=j8D���%5j8D���%-j8D���%%j8D���%j8D���%j8D���%
j8D���%j8D���%�i8D���%�i8D���%�i8D���%�i8D���%�i8D���%�i8D���%�i8D���%�i8D���%�i8D���%�i8D���%�i8D���%�i8D���%�i8D���%�i8D���%�i8D���%�i8D���%}i8D���%ui8D���%mi8D���%ei8D���%]i8D���%Ui8D���%Mi8D���%Ei8D���%=i8D���%5i8D���%-i8D���%%i8D���%i8D���%i8D���%
i8D���%i8D���%�h8D���%�h8D���%�h8D���%�h8D���%�h8D���%�h8D���%�h8D���%�h8D���%�h8D���%�h8D���%�h8D���%�h8D���%�h8D���%�h8D���%�h8D���%�h8D���%}h8D�gH�=������!H�=���n���L���H�
��1���H�5��H�=���6���L���H�
x�1���H�5��H�={�����L���H�
P�1���H�5��H�=S����L���H�
��1���H�5��H�=+�较��L�(DH�
��1���H�5>�H�=�薃��L���H�
�1��H�5��H�=���n���L���H�
��1��H�5��H�=���F���L�.;H�
�1��|H�5��H�=������L���H�
��1��H�5��H�=c����L���H�
��1��>H�5q�H�=;��΂���H�=r��͖��L�P�H�
��1���H�5Q�H�=�蕂��L�f�H�
��1��H�5��H�=���m���H�=��1��_���L���H�
��1��CH�5��H�=���7���L���H�
��1��BH�5��H�=|�����L���H�
q�1��H�59�H�=T����L���H�
��1��rH�5o�H�=,�迁��L�;�H�
a�1���H�5G�H�=�藁��M��H��$1�H�5'�H�=���w���H��H�=h�1��f���M��H��(1�H�5��H�=���F���L�	�H�
(�1��nH�5��H�=������L�W�H�
��1���H�5��H�=c����L�W�H�
X�1���H�5q�H�=;��΀����H�=Y��͔���H�=H�輔��L���H�
��1���H�5'�H�=��脀��L���H�
��1���H�5��H�=���\���L���H�
�1��TH�5��H�=���4���L�U�H�
&�1��2H�5��H�=y�����L���H�
.�1��FH�5��H�=Q�����L���H�
�1��GH�5��H�=)����L���H�
��1��zH�5^�H�=����L�7�H�
��1��yH�56�H�=���l��PXL�;�H�
4��H�5��H�=��P1��A��L�r�H�
C�1��3H�5I�H�=������H�=1�����L���H�
��1���H�5��H�=M���~��L���H�
�1��IH�5��H�=%��~���G���L��H�
��1��]H�5��H�=���~��L�$�H�
=�1��mH�5��H�=���c~����L���H�
�1���H�5f�H�=���6~��L�g�H�
�1���H�5��H�={��~��L���H�
��1���H�5��H�=S���}����H�=v����L���H�
w�1���H�5U�H�=��}��L�&�H�
o�1��
H�5-�H�=���}��L���H�
��1��H�5�H�=���]}��L�a�H�
O�1��+H�5��H�=���5}��L���H�
��1��aH�5��H�=z��
}��PXL���H�
%��H�57�H�=R�P1���|��L���H�
�1��H�5��H�='��|��L���H�
��1��H�5�H�=���|��L��H�
�1��_H�5��H�=���j|��L�;�H�
<1���H�5�H�=���B|��L���H�
1��H�5W�H�=���|��L���H�
�1���H�5/�H�=_���{��L���H�
��1��H�5�H�=7���{��L�3�H�
|�1���H�5��H�=��{��L��H�
T�1���H�5��H�=���z{��L���H�
�1��4H�5��H�=���R{��L��H�
�1��5H�5g�H�=���*{��L��H�
�1��tH�5?�H�=o��{��L�j�H�
�1��sH�5�H�=G���z��L�V�H�
L�1���H�5��H�=��z��L�.�H�
�1���H�5��H�=���z��L�&�H�
\�1���H�5��H�=���bz��L���H�
4�1���H�5w�H�=���:z��L���H�
��1���H�5O�H�=��z��L���H�
D�1��GH�5'�H�=W���y��L��H�
�1��\H�5��H�=/���y��L�:�H�
T�1���H�5��H�=��y��L��H�
�1���H�5��H�=���ry���tH�=���q���L��H�
�1���H�5v�H�=���9y��L���H�
��1���H�5N�H�=~��y��L�Z�H�
c�1���H�5&�H�=V���x��L�*�H�
{�1��2H�5��H�=.��x��L�moH�
��1��H�5��H�=��x��L�
�H�
�1���H�5��H�=���qx��L���H�
�1���H�5��H�=���Ix��L�Q�H�
{�1���H�5^�H�=���!x��L��H�
S�1���H�56�H�=f��w��L�MH�
��1��tH�5�H�=>���w��L��H�
{�1��+H�5��H�=��w��������L��H�
��1��	H�5��H�=���ww��L���H�
�	1���H�5s�H�=���Ow��L�XH�
�	1��pH�5K�H�=���'w��L��H�
�1���H�5#�H�=l��v��L��H�
�1���H�5��H�=D���v��L��H�
Y1���H�5�H�=��v��L��H�
Q1��vH�5��H�=���v��L��H�
91���H�5��H�=���_v��L���H�
�1��H�5[�H�=���7v��L���H�
)1��H�53�H�=|��v��L�A�H�
11��-H�5�H�=T���u��L�v�H�
	1��*H�5�H�=,��u��L���H�
Q1���H�5��H�=��u��L�=�H�
i1���H�5��H�=���ou��L��H�
�1��H�5k�H�=���Gu��L��H�
�1���H�5C�H�=���u��L�i�H�
�1��pH�5�H�=d��t��L��H�
�1��oH�5�H�=<���t��L��H�
�1��AH�5�H�=��t��L�8�H�
y1��YH�5��H�=���t��L��H�
�1���H�5{�H�=���Wt��L� �H�
�1���H�5S�H�=���/t��L�8�H�
�1���H�5+�H�=t��t��L�;�H�
i1���H�5�H�=L���s��L���H�
�1���H�5�H�=$��s��L��H�
�1���H�5��H�=���s��L��H�
�1���H�5��H�=���gs��L��H�
�1��"H�5c�H�=���?s��L���H�
�1��`H�5;�H�=���s��L���H�
	1���H�5�H�=\���r��L�9�H�
A1��$H�5�H�=4���r��L�n�H�
1��H�5�H�=��r��L���H�
�1��|H�5��H�=���wr��L��H�
	1���H�5s�H�=���Or��L���H�
�1���H�5K�H�=���'r��L��H�
�1���H�5#�H�=l��q��L��H�
11��	H�5��H�=D���q��L�}�H�
�1��BH�5�H�=��q��L�{�H�
��1��AH�5��H�=���q��L��H�
y�1��DH�5��H�=���_q��L��H�
�1��gH�5[�H�=���7q��L��H�
�1��fH�53�H�=|��q��L���H�
��1��iH�5�H�=T���p��L�X�H�
i�1���H�5��H�=,��p��L�e�H�
A�1���H�5��H�=��p��L�c�H�
�1���H�5��H�=���op��L��H�
�1���H�5k�H�=���Gp��L���H�
�1���H�5C�H�=���p��L���H�
��1��IH�5�H�=d��o��L���H�
Y�1��?H�5��H�=<���o��L���H�
1�1��>H�5��H�=��o��L�8�H�
	�1��=H�5��H�=���o��L�9�H�
��1��0H�5{�H�=���Wo��L��H�
I�1��DH�5S�H�=���/o��L�y�H�
�1��RH�5+�H�=t��o��L�H�
Y1�� H�5�H�=L���n��L�H�
q1���H�5�H�=$��n��L�QH�
�1���H�5hH�=���n��L��H�
A1�� H�5@H�=���gn��L�8�H�
1��H�5��H�=���?n��L�TH�
�1��"H�5�H�=���n��L��H�
1��TH�5A�H�=\���m��L�QH�
1���H�5�H�=4���m��L��H�
Y1���H�5xH�=��m��L�BH�
�1��>H�5PH�=���wm��L��H�
I1���H�5(H�=���Om��L�	H�
A1��VH�5H�=���'m��L�X	H�
�1��UH�5�H�=l��l��L�gH�
�1���H�5��H�=D���l��L�H�
�1���H�5��H�=��l��1�H�=��1��l��L�oH�
A1���H�5P�H�=���wl��L�[H�
�1��	H�5(�H�=���Ol��L��H�
1���H�5�H�=���'l��L�GH�
�1��H�5�H�=l��k��L��#H�
�1���H�5��H�=D���k��L�?H�
)1��$H�5��H�=��k��L�3H�
!1���H�5`�H�=���k��L�PH�
�1���H�58�H�=���_k��L��H�
q1���H�5�H�=���7k��L��H�
1��-H�5�H�=|��k��H�=h1��k��L�_�H�
�1��;H�5��H�=F���j��L��"H�
�1��zH�5��H�=��j��L��H�
1��|H�5b�H�=���j��L�B
H�
�
1���	H�5:�H�=���aj��L�R
H�
s
1���	H�5�H�=���9j��L��H�
K
1���	H�5�H�=~��j��L��H�
�1��H�5aH�=V���i��L��H�
{1���H�59H�=.��i��L��H�
S1���H�5H�=��i��L��H�
{1��fH�5�H�=��qi��L�zH�
s1��zH�5\H�=���Ii��L�zH�
K1���H�54H�=���!i��L�rH�
�1��-H�5H�=f��h��L��H�
�1��XH�5�H�=>���h��L�'H�
�1��bH�5�H�=��h��L�zH�
�1���H�5�H�=��h��L��H�
1��uH�5�H�=��Yh��L��H�
�1��yH�5�H�=���1h��L��H�
�1���H�5^H�=v��	h��L�:H�
{1���H�56H�=N���g��L��H�
c1��<H�5H�=&��g��L�bH�
;1��9H�5�H�=���g��L��H�
C1���H�5�H�=ֿ�ig��L�rH�
{1��+H�5�H�=���Ag��L��H�
S1��)H�5H�=���g��L��H�
+1��&H�5WH�=^���f��L�bH�
�1���H�5/H�=6���f��L�UH�
�1���H�5H�=��f��L��H�
�1���H�5�H�=��yf��L�J�H�
s1��H�5��H�=���Qf��L��H�
�1��DH�5�H�=���)f��L��H�
�1��BH�5�H�=n��f��L�RH�
s1��?H�5{H�=F���e��L��H�
1���H�5SH�=��e��L�
H�
C1���H�5+H�=���e��L�Z�H�
�1��H�5��H�=ν�ae��L��H�
�1���H�5�H�=���9e��L��H�
�1���H�5�H�=~��e��L��
H�
�1���H�5�H�=V���d��L�
H�
�1���H�5�H�=.��d��L�oH�
c1���H�5kH�=��d��L��H�
1���H�5CH�=޼�qd��L�H�
�1���H�5H�=���Id��L�H�
{1���H�5�H�=���!d��L�jH�
�1��'H�5�H�=f��c��L��H�
�1��6H�5�H�=>���c��L��H�
�1��H�5{H�=��c��L�WH�
�1��H�5SH�=��c��L�rH�
�1���H�5+H�=ƻ�Yc��L��H�
{1���H�5H�=���1c��L�H�
S1���H�5�H�=v��	c��L�JH�
+1��hH�5�H�=N���b��L��H�
1��cH�5�H�=&��b��L�gH�
�1��bH�5cH�=���b��L�H�
�1���H�5;H�=ֺ�ib��L��H�
�1���H�5H�=���Ab��L��H�
�1���H�5�H�=���b��L�ZH�
�1���H�5�H�=^���a��L��H�
�1��4H�5�H�=6���a��L�
H�
�1��5H�5sH�=��a��L�OH�
1��GH�5KH�=��ya��L�"
H�
�1��H�5�H�=���Qa��L�JH�
�1��CH�5aH�=���)a��L�Z
H�
�1��3H�59H�=n��a��L��H�
31��1H�5�H�=F���`��L�

H�
;1��$H�5�H�=��`��L��	H�
C1��H�5H�=���`��L�:H�
�1��FH�5QH�=θ�a`��L��	H�
�1��$H�5)H�=���9`��L��H�
�1��&H�5�H�=~��`��L��H�
3#1��$H�5�H�=V���_��L��H�
+#1��HH�5sH�=.��_��L��H�
3!1��7H�5KH�=��_��L�YH�
!1��0H�5#H�=޷�q_��L��H�
� 1��.H�5�H�=���I_��L�:H�
� 1��>H�5�H�=���!_��L�H�
� 1��AH�5�H�=f��^��L�@H�
{!1��LH�5�H�=>���^��L��H�
S!1��7H�5[H�=��^��L��H�
+!1��?H�53H�=��^��L��H�
!1��>H�5H�=ƶ�Y^��L�rH�
� 1��TH�5�H�=���1^��L��H�
�!1���H�5�H�=v��	^��L��H�
�!1��qH�5�H�=N���]��L��H�
s!1��yH�5kH�=&��]��L��H�
K!1��dH�5CH�=���]��L��H�
C!1���H�5H�=ֵ�i]��L�TH�
� 1���H�5�H�=���A]��L��H�
� 1���H�5�H�=���]��L��H�
{ 1���H�5�H�=^���\��L�H�
�1���H�5{H�=6���\��L��H�
�1���H�5SH�=��\��L��H�
c1��H�5+H�=��y\��L�oH�
1��dH�5H�=���Q\��L�H�
�1��^H�5�H�=���)\��L��H�
�1��tH�5�H�=n��\��L�H�
c1��vH�5�H�=F���[��L�H�
;1��uH�5cH�=��[��L��H�
�1���H�5;H�=���[��L��H�
�1���H�5H�=γ�a[��L�EH�
�1���H�5�H�=���9[��L��H�
K1���H�5�H�=~��[��L�TH�
#1���H�5�H�=V���Z��L�H�
�1���H�5sH�=.��Z��L�Z!H�
�1���H�5KH�=��Z��L��H�
�1���H�5#H�=޲�qZ��L�7H�
�1���H�5�H�=���IZ��L��H�
+1���H�5�H�=���!Z��L��H�
�1���H�5�H�=f��Y��H�=R�1���Y��L�H�
-1��iH�5uH�=0���Y��L��H�
1��kH�5MH�=��Y��L�EH�
�1��qH�5%H�=��sY��L��H�
�1���H�5�H�=���KY��L�wH�
M1���H�5�H�=���#Y��L�H�
1���H�5�H�=h��X��L�'H�
�1���H�5�H�=@���X��L��H�
�1���H�5]H�=��X��L��H�
]1���H�55H�=��X��L�gH�
�1���H�5
H�=Ȱ�[X��L��H�
�1���H�5�H�=���3X��PXL��H�
� �H�5]�H�=x�P1��X��H��H�=�1��W��L�(H�
�!1��yH�5�H�=<���W��L�.H�
a!1��tH�5�H�=��W��L�SNH�
� 1���H�5�H�=��W��L��H�
� 1���H�5uH�=į�WW��L�H�
I 1���H�5MH�=���/W�������L�{H�
�1���H�5H�=j��V��L�oH�
O1���H�5�H�=B���V�����L�]H�
b1��1H�5�H�=��V���p����EH�=��j��L���H�
D 1��,H�5�H�=׮�jV��L��H�
< 1��H�5`H�=���BV��L�nH�
�1��OH�58H�=���V�����L��H�
�1��YH�5H�=Z���U��L�vH�
�1��EH�5�H�=2���U��L��H�
w1���H�5�H�=
��U��L��H�
O1��	H�5�H�=��uU��L�H�
'1��H�5kH�=���MU��L��H�
�1��H�5CH�=���%U��L��H�
�1���H�5H�=j��T��L�6H�
1���H�5�H�=B���T��L�
H�
� 1��PH�5�H�=��T��L��H�
O 1���H�5�H�=��T��L�F�H�
' 1���H�5eH�=ʬ�]T��L��H�
�1���H�5=H�=���5T��L��H�
w1���H�5H�=z��
T��L���H�
/1���H�5�H�=R���S��L���H�
�1��H�5�H�=*��S��L��H�
�1��!H�5�H�=��S��L��H�
w1��H�5uH�=ګ�mS���hH�=]�lg��L��H�
>1��aH�5<H�=���4S��L�}H�
�1���H�5H�=y��S��L��H�
�1���H�5�H�=Q���R��L�
 H�
� 1���H�5H�=)��R��L�4H�
~ 1���H�5�H�=��R��L�H�
& 1���H�5�H�=٪�lR��L��H�
�1���H�5�H�=���DR��L��H�
�1��H�5n�H�=���R��L�f H�
N(1��DH�5, H�=a���Q��L�E#H�
�'1���H�5 H�=9���Q��L�= H�
~'1���H�5�H�=��Q���H�=��e��H�=��1��Q��H�=��1��wQ��H�=��1��iQ��H�=#1��[Q��L�� H�
&1���H�5kH�=���3Q��L�� H�
�%1���H�5CH�=x��Q��L�I�H�
&1���H�5H�=P���P��L��H�
�%1���H�5�H�=(��P��L���H�
�%1��UH�5�H�=��P��L�� H�
&1��IH�5�H�=ب�kP��L�` H�
�%1��7H�5{H�=���CP���H�=c�Bd��L�["H�
d$1��%H�5BH�=w��
P��H�=c�1��O��L�MH�
^$1���H�5H�=A���O��L�� H�
�#1���H�5�H�=��O��L�}"H�
�#1���H�5�H�=��O��L�-"H�
v#1���H�5�H�=ɧ�\O��L��!H�
N#1���H�5lH�=���4O��L��EH�
�"1��GH�5DH�=y��O��L��EH�
~"1��YH�5H�=Q���N��L�}'H�
(1��H�5�%H�=)��N��L�m&H�
(1���H�5�%H�=��N��L��&H�
&(1���H�5�%H�=٦�lN��L�y&H�
�'1���H�5g%H�=���DN��L�%'H�
�'1���H�5?%H�=���N��L��H�
'1��H�5F�H�=a���M��L�n&H�
'1���H�5�$H�=9���M��L��'H�
~*1���H�5e'H�=��M��L���H�
V+1���H�5='H�=��|M��L�r�H�
.+1���H�5'H�=���TM��L��'H�
�*1��uH�5�&H�=���,M��L�"�H�
�*1��UH�5�&H�=q��M��L��H�
v*1��TH�5�&H�=I���L��L���H�
*1���H�5��H�=!��L��L��&H�
�*1���H�5M&H�=���L��L�'H�
�)1��H�5%&H�=Ѥ�dL��L�'H�
V)1��H�5�%H�=���<L��L�"'H�
)1��XH�5�%H�=���L��L�&'H�
�(1��rH�5�%H�=Y���K��L�R�H�
^(1���H�5�%H�=1���K��L�X*H�
�/1���H�5*H�=	��K��L�x*H�
01���H�5�)H�=��tK��L�k*H�
�/1���H�5�)H�=���LK��PXL��H�
\/�H�5v�H�=��P1��!K������H�t$(H�=.1��Ii��H�t$(H�=M.1��6����.�L�c*H�
C/1���H�5B)H�=6���J��H�t$(H�=].1��h��L��*H�
�.1��VH�5)H�=���J��H�t$(��H�=H.1��h��H�t$(H�=�-1�覷����H�t$(H�=}-1��h��L��*H�
p.1��XH�5�(H�=���&J��L�e*H�
H.1��WH�5w(H�=k��I��H�t$(��H��1��-������PXH�=0P1���I����H�=a.��]��L��.H�
21���H�5@.H�=��I��L��.H�
21���H�5.H�=ߡ�rI��L��.H�
�11���H�5�-H�=���JI��L��0H�
�11���H�5�-H�=���"I����H�=�-�!]��L��1H�
C31��DH�5�1H�=V���H��L��1H�
�21���H�5�1H�=.��H��H�3H�=�.1����+�H�=�1��H��L��H�=�11��̵��雮H�uH�=�11�赵��H���]��H�3H�=�1�1�蒵��H��[�9�L��1H�
;21���H�5
1H�=���!H��L��H�
21��H�5K�H�=f��G��H�=�11���G��H�3H�=�D1�������H�=.�1���G��H��H�=U21�����d�H�u1�H�=���ߴ��H�} u&I��H�
>���1�H�52���H�E ���ܴL�G2H�
�31��dH�5C2H�=���EG��H�sH�=x�1��s���I��H�
i��lH�52�'賱��H�C([�H�sH�=�C1��;����%�1�H�=m2�(����{��<�H���ֶ�/�H�=*�1���F��L��2H�
�21���H�5�1H�=��F��L��1H�
�21���H�5q1H�=��sF��L��1H�
U21���H�5I1H�=���KF��H�s8H�=C1��yd��H�=��1��+F��H�=41��]d��L��2H�
/51���H�5g2H�=b��E��L��3H�
51���H�5?2H�=:���E��L�n4H�
�41��H�52H�=��E����H�=�41��E��H�T$H��H�=�41�迲���G�H�t$H�=�41�觲��L���v������L�5H�
�51���H�5�4H�=���/E��H�=��1��!E��H�=z�1��E��H�sH�=�t1��A�����H�sH�=�41��*����d�L��4H�
�51���H�54H�=*��D��L��4H�
51��KH�5�3H�=��D��L�{4H�
51���H�5�3H�=ڜ�mD��L�>�H�
�41��H�5��H�=���ED��H�=�51��w������L�:H�
$<1��CH�5�9H�=w��
D��L���H�
�;1��=H�5�9H�=O���C��H�=�51������t�L��9H�
;1��H�5�9H�=��C��L��5H�
�:1��+H�5n9H�=��C��H�=�91�豰����L��6H�
�;1��ZH�539H�=���DC��L��9H�
v;1��fH�59H�=���C��L��6H�
.;1��rH�5�8H�=a���B��L��9H�
;1��~H�5�8H�=9���B��L��6H�
^:1��H�5�8H�=��B��L��7H�
:1���H�5k8H�=��|B��L��6H�
.:1���H�5C8H�=���TB��L��:H�
�?1��2H�5�:H�=���,B��H�=��1��B��H�=��1��B��L��:H�
"?1���H�5{:H�=U���A��L�4;H�
�>1���H�5S:H�=-��A��L�1>H�
�>1��YH�5+:H�=��A��1�H�='?�ʮ�����n���H�=9?1�貮��ǃ���H�=D?1�蕮����H�=��1��BA��L��BH�
4G1���H�5�BH�=���A��I�EL��t1��H����H�=\�1��@��H�T$ H��H�=01��_��L� ?H�
!I1���H�5=BH�=$��@��H�=�1��@��L�z�H�
�H1��H�5ӞH�=��@��H�=��1��s@��L�?H�
eH1��H�5�AH�=���K@��L�
CH�
�G1��0H�5�AH�=���#@��H�t$0H�=�C1��P^��L��H�
bH1���H�5nAH�=U���?��H�=A�1���?��L��H�=?1��	^��H�t$0H�=�>1�����H�=lC1���]��H�=~C1���]��H�=~>1���]��L�(?H�
	G1��HH�5�@H�=̗�_?��L��CH�
�F1��KH�5�@H�=���7?��H�=�CZ1�[]�f���L��CH�
�F1���H�5�@H�=k��>��H�=nC��L��>H�
'F1���H�5S@H�=:���>��L��CH�
�F1���H�5+@H�=��>��H�=��1��>��H�=�>1���\��L�"=H�
;E1��H�5�?H�=�a>��L��>H�
E1��H�5�?H�=���9>��L��>H�
�D1��H�5�?H�=~��>��L�Z>H�
�D1��H�5o?H�=V���=��L��>H�
D1���H�5G?H�=.��=��L��>H�
�C1���H�5?H�=��=��H�=�>1��˪���5L�pBH�
xD1���H�5�>H�=˕�^=��L�'=H�
�C1��H�5�>H�=���6=��L��>H�
xC1��H�5�>H�={��=��E�.H�=B1��=���H���u����H�=I�1���<��H�=;�1���<��L��MH�
vN1���H�5�MH�=��<��L�NH�
NN1��LH�5�MH�=��<��H�T$L��1���H�=�H諩���ZL��EH�
N1��gH�5]MH�=���><��H��H�=�L1��m����%PXL���H�
@S�H�5R�H�=m�P1��;������H�T$H�t$H�=�Q1�� Z�����H�=4�1���;�����H�=!�1��;��H�t$ 1�H�=S�������@L�hSH�
�U1���H�53SH�=��w;��L��RH�
�U1���H�5SH�=���O;��L�@SH�
!U1��pH�5�RH�=���';��H�=��1��;��L��SH�
�T1��VH�5�RH�=^���:��L�TH�
�T1��_H�5�RH�=6���:��L��RH�
�T1��qH�5]RH�=��:��L��TH�
�U1��H�5�TH�=��y:��L�2UH�
�U1��:H�5�TH�=���Q:��H�t$H�=EU1��~���H��覲����JL��UH�
CX1���H�5�UH�=v��	:��L��XH�
�Y1���H�5�XH�=N���9��L�"XH�
cY1���H�5�XH�=&��9��L�u"H�
Y1��5H�5gXH�=���9��L��XH�
3Y1���H�5?XH�=֑�i9��L�LZH�
�[1���H�5LLH�=���A9��L�ZH�
�[1��qH�5$LH�=���9��L�2`H�
�e1��-H�5\H�=^���8��PXL���H�
ie�H�5�H�=6�P1���8������L��[H�
Ke1��H�5�[H�=��8��L��[H�
#e1��H�5�[H�=ސ�q8��L��[H�
Cd1���H�5X[H�=���I8��H�==�1��;8��H�=/�1��-8��H�=!�1��8��L��[H�
Ad1��bH�5[H�=d��7��L��_H�
d1��kH�5�ZH�=<���7��L�
[H�
�c1��QH�5�ZH�=��7��L��ZH�
�c1��RH�5�ZH�=��7��L��^H�
�c1��[H�5fZH�=ď�W7��L��ZH�
Ie1���H�5>ZH�=���/7��L��ZH�
e1��H�5ZH�=t��7��H�=`�1��6��H�=R�1���6��L�^H�
�c1���H�5�YH�=0���6��L��ZH�
ub1��#H�5�YH�=��6��L��ZH�
Mb1��H�5�YH�=��s6��L�,^H�
]b1��pH�5ZYH�=���K6��L�$^H�
�a1��H�52YH�=���#6��H�=|�1��6��L��H�=�1��6������1�H�=�1���5��L��]H�
Qb1���H�5�XH�=4���5��1�H�=��1��5��1�H�=��1��5��1�H�=��1��5��1�H�=��1��5��L��]H�
�a1���H�5nXH�=̍�_5��L��]H�
�a1���H�5FXH�=���75��L��]H�
9a1���H�5XH�=|��5��L��]H�
a1���H�5�WH�=T���4��H�=ۙ1���4��L��]H�
�b1���H�5�WH�=��4��L�9YH�
�b1��zH�5�WH�=���4��H�=}�1��{4��H�=��1��m4��L��XH�
b1��mH�5TWH�=���E4��H�=9�1��74��L��*H�
ib1���H�5WH�=|��4��H�=�1��4��H�=��1���3��H�=�1���3��L��\H�
Wa1��5H�5�VH�=*��3��L��XH�
Wa1���H�5�VH�=��3����H�=�V�G��L��XH�
a1���H�5kVH�=ɋ�\3��L�XH�
a1��TH�5CVH�=���43��L��XH�
�`1��H�5VH�=y��3��L��WH�
>`1��xH�5�UH�=Q���2��L��WH�
`1��sH�5�UH�=)��2��L�}WH�
�_1���H�5�UH�=��2��H�=��1��2��H�=��1��x2��H�=]X1��P��1�H�=蜟��H��A�k1�L�MUH�
c_H�X�'a��H�{1���A�lL�%UH�
;_H��W�`���e�H�=�W1����9����O�H�=�W1����#����9�L��H�=�W1����
���� �H�=�1��1��H�=h`1��1��H��H�=��1��1���tH�=�`�E����H�=�`�E��L��`H�
�`1���H�5�`H�=���N1��H�uH�=�`1��|����E�#�L��H�
�a1��;H�5�`H�=x��1��L��`H�
}a1��SH�5�`H�=P���0��H�sH�=�-1������k�H�sH�=�'1�����D�L��bH�
Wd1���H�5�bH�=���0��L��bH�
Od1���H�5�bH�=҈�e0��H�=Y�1��W0���H�=�e�VD��L�)�H�
�f1���H�5�H�=���0��L�O�H�
�f1��gH�5ReH�=c��/��L��fH�
�j1��oH�5�fH�=;���/��L�gH�
k1��~H�5�fH�=��/��L��fH�
Xj1���H�5�fH�=��~/��L��gH�
0j1���H�5ofH�=�V/��L�gH�
j1���H�5GfH�=���./��L��H�
�j1���H�5fH�=s��/��L�gH�
�j1���H�5�eH�=K���.��L�%fH�
pj1���H�5�eH�=#��.��L�/gH�
Hj1���H�5�eH�=���.��L�q�H�
�i1���H�5f�H�=ӆ�f.���=H�=ge�eB��L�;jH�
�j1��*H�5jH�=���-.��L��iH�
�j1��&H�5�iH�=r��.��L��iH�
�j1��(H�5�iH�=J���-��L��iH�
/j1���H�5�iH�="��-��L��iH�
j1���H�5ziH�=���-��L�.jH�
�m1���H�5#jH�=҅�e-��L�nkH�
�m1���H�5�iH�=���=-��L��iH�
n1��,H�5�iH�=���-��L���H�
�m1���H�5�H�=Z���,��L���H�
m1��H�5�H�=2���,��L��iH�
gm1���H�5[iH�=
��,��PX�bH�=�mP�@���������#H�=m�~@��L��mH�
p1���H�5F�H�=���F,��L�pH�
�q1��vH�5pH�=���,����H�=�o�@��L�TmH�
q1���H�5�H�=R���+��L��qH�
ǀ1��sH�5LwH�=*��+��L��qH�
�~1��UH�5$wH�=��+��L�fqH�
�~1��JH�5�vH�=ڃ�m+��L�nqH�
_~1��SH�5�vH�=���E+��L�wH�
G�1��
H�5�vH�=���+��L�frH�
��1���H�5�vH�=b��*��L��vH�
g�1���H�5\vH�=:���*��L��qH�
?�1���H�54vH�=��*��L�vpH�
�~1��H�5vH�=��}*��L�ίH�
�~1��H�5�uH�=‚�U*��L�6tH�
�~1��"H�5�uH�=���-*��L�JhH�
��1���H�5�uH�=r��*��L��vH�
G�1��H�5luH�=J���)��L��vH�
��1��3H�5DuH�="��)��L�gvH�
ׁ1��$H�5uH�=���)��L�6oH�
o�1��zH�5�tH�=ҁ�e)��L�oH�
'�1���H�5�tH�=���=)��L��nH�
߀1���H�5�tH�=���)��L��nH�
'�1��H�5|tH�=Z���(��L��uH�
�1��#H�5TtH�=2���(��L�nnH�
�1��"H�5,tH�=
��(��L��pH�
�1��0H�5tH�=��u(��H��H�=f�1��d(��L�upH�
1��VH�5�sH�=���<(��L�MpH�
�~1��_H�5�sH�=���(��L�%pH�
f~1��iH�5{sH�=Y���'��L��oH�
�}1��rH�5SsH�=1���'��L��oH�
�}1���H�5+sH�=	��'��L��oH�
.}1���H�5sH�=��t'��L��tH�
�|1���H�5�rH�=��L'��L��oH�
n|1��
H�5�rH�=��$'��L�=pH�
F|1��H�5�rH�=i�&��L�eoH�
|1��H�5crH�=A��&��L��oH�
�{1��H�5;rH�=�&��L��sH�
�{1���H�5rH�=�~�&��L��sH�
Fy1���H�5�qH�=�~�\&��L�ytH�
y1���H�5�qH�=�~�4&��L�XsH�
�x1���H�5�qH�=y~�&��L�)tH�
�x1���H�5sqH�=Q~��%��L��rH�
�x1���H�5KqH�=)~�%��L��sH�
x1��H�5#qH�=~�%��L��rH�
�x1��H�5�pH�=�}�l%��L��nH�
�x1��+H�5�pH�=�}�D%��L�MrH�
�y1��>H�5�pH�=�}�%��L��nH�
�y1��=H�5�pH�=a}��$��L�rH�
fy1��;H�5[pH�=9}��$��L��sH�
~y1���H�53pH�=}�$��L��H�
Vy1���H�5pH�=�|�|$��L��}H�
nx1���H�5�oH�=�|�T$��L��nH�
vw1��AH�5�oH�=�|�,$��L�=nH�
Nw1��@H�5�oH�=q|�$��L�4sH�
�w1��H�5koH�=I|��#��L�=nH�
�w1���H�5CoH�=!|�#���-H�=+o�7��L��rH�
ew1���H�5
oH�=�{�{#��L�trH�
=w1���H�5�nH�=�{�S#��L�$iH�
�v1���H�5�nH�=�{�+#��L��rH�
�v1��9H�5�nH�=p{�#��L�srH�
�v1��:H�5jnH�=H{��"��H�=4�1���"��L��mH�
ov1��yH�54nH�={�"��L��pH�
'u1���H�5nH�=�z�}"��L��mH�
�t1���H�5�mH�=�z�U"��L�yoH�
�t1���H�5�mH�=�z�-"��L�fjH�
_t1��PH�5�mH�=rz�"��L��zH�
׆1���H�5�zH�=Jz��!��L�ezH�
��1��zH�5nzH�="z�!��L�aH�
�1���H�5FzH�=�y�!��L��zH�
߇1���H�5zH�=�y�e!��L�zH�
��1���H�5�yH�=�y�=!��L�ozH�
��1���H�5�yH�=�y�!��PXL��H�
5��H�5?H�=ZyP1��� ��PXL�uzH�
��5H�5{yH�=/yP1�� ��PXL��mH�
��*H�5PyH�=yP1�� ��L�3zH�
ƃ1���H�5%yH�=�x�l ���}���L�)zH�
9�1��H�5�xH�=�x�? ��L��yH�
�1��	H�5�xH�=�x� ��L�zH�
��1��7H�5�xH�=\x����L��|H�
A�1��UH�5�xH�=4x����L��|H�
�1��VH�5XxH�=x������L�~�H�
�1��H�5+xH�=�w�r��L���H�
Ԃ1��bH�5xH�=�w�J��L��yH�
��1��cH�5�wH�=�w�"��L�&xH�
��1��dH�5�wH�=gw���L�tyH�
\�1��eH�5�wH�=?w����L�yH�
4�1��`H�5cwH�=w���L�lxH�
�1��aH�5;wH�=�v���L�f�H�
�1��TH�5wH�=�v�Z���k������L��vH�
�1��nH�5�vH�=�v�(��L��{H�
��1��mH�5�vH�=mv���L��xH�
��1��lH�5�vH�=Ev����L�Y{H�
j�1���H�5ivH�=v���L�DxH�
B�1���H�5AvH�=�u���L�=xH�
z�1��oH�5vH�=�u�`���q����A����g���L��H�
�1���H�5�uH�=�u�)��L�İH�
;�1���H�5�uH�=nu���H���H�=#�1��,����wL�kxH�
��1���H�5xuH�=,u���H���H�=�1������v���L�?vH�
�1���H�51uH�=�t�x��L�!{H�
J�1��hH�5	uH�=�t�P��L��bH�
R�1��$H�5�tH�=�t�(��L�{H�
*�1��H�5�tH�=mt���L��wH�
�1��H�5�tH�=Et����L��wH�
ڃ1��H�5itH�=t������L���H�
��1��H�5<tH�=�s���L�uH�
�1��EH�5tH�=�s�[�����L��zH�
h�1���H�5�sH�=�s�.��L�^jH�
@�1���H�5�sH�=ss���L��uH�
�1���H�5�sH�=Ks����L�zH�
�1���H�5osH�=#s���L��zH�
�~1��/H�5GsH�=�r���L��vH�
�~1��aH�5sH�=�r�f���w���L��fH�
C�1���H�5�rH�=�r�9��L��sH�
�1��H�5�rH�=~r���L��qH�
�1���H�5�rH�=Vr����L�rzH�
ˁ1��IH�5zrH�=.r���L��_H�
��1��JH�5RrH�=r���L�[sH�
{�1��&H�5*rH�=�q�q��L��vH�
S�1���H�5rH�=�q�I��L��{H�
�|1���H�5�qH�=�q�!��PXL��H�
��TH�5KwH�=fqP1��������L�J�H�
3�1���H�5|�H�=6q����L���H�
K�1��YH�5T�H�=q���L���H�
#�1��_H�5,�H�=�p�y��H�=�w1��k��L�m�H�

�1���H�5��H�=�p�C��L��H�
�1���H�5ΈH�=�p���L���H�
��1���H�5��H�=`p����L���H�
ŋ1���H�5~�H�=8p����L���H�
��1���H�5V�H�=p���L��H�
u�1���H�5.�H�=�o�{���U���L���H�
؊1���H�5�H�=�o�N��L�7�H�
��1���H�5هH�=�o�&��L�/�H�
H�1��+H�5��H�=ko���L��H�
 �1��/H�5��H�=Co����L��H�
h�1���H�5a�H�=o������L�
�H�
�1��_H�54�H�=�n���L���H�
S�1��H�5�H�=�n�Y��H�=��1��K���%���L���H�
ؑ1���H�5f�H�=�n���L�G�H�
��1���H�5>�H�=cn���L��H�
��1���H�5�H�=;n����L��H�
��1��H�5�H�=n���L�RH�
�1���H�5ƎH�=�m�~��L�*H�
�1���H�5��H�=�m�V��PXL�5�H�
��TH�5�sH�=�mP1��+��L�$�H�
�1���H�5K�H�=pm���L��H�
��1���H�5#�H�=Hm����L��H�
}�1���H�5��H�= m����X���L�f�H�
 �1���H�5΍H�=�l���L��H�
H�1���H�5�mH�=�l�^��L�?�H�
А1��GH�5~�H�=�l�6��L���H�
��1��}H�5V�H�={l����VH�=>��
(�����L��H�
*�1��H�5�H�==l����L��H�
"�1���H�5�H�=l���L���H�
��1���H�5ȌH�=�k���L���H�
��1��H�5��H�=�k�X��L�ыH�
:�1���H�5x�H�=�k�0��L�%�H�
‘1��cH�5�H�=uk���L��H�
��1��nH�5ǏH�=Mk����L���H�
‘1��TH�5
qH�=%k���H�=/r1����L��H�
l�1���H�5i�H�=�j���L�`�H�
D�1���H�5A�H�=�j�Z��L�"�H�
�1���H�5�H�=�j�2��L��H�
ē1��GH�5�H�=wj�
��L��H�
�1���H�5�H�=Oj����L�+�H�
��1���H�5��H�='j���L��H�
��1��H�5��H�=�i���L���H�
t�1��%H�5q�H�=�i�j��L�ސH�
̒1��H�5I�H�=�i�B��L�[�H�
��1��RH�5!�H�=�i���L�͐H�
��1���H�5��H�=_i����L���H�
��1���H�5яH�=7i����L�̒H�
�1��DH�5��H�=i���L��H�
�1��EH�5n�H�=�h�z��L�|�H�
��1���H�5F�H�=�h�R��L�T�H�
T�1���H�5�H�=�h�*��L�s�H�
��1��PH�5��H�=oh���L��H�
Ԕ1��OH�5ΑH�=Gh����L�ёH�
��1���H�5��H�=h���L���H�
T�1���H�5~�H�=�g���L���H�
,�1���H�5V�H�=�g�b��L�Y�H�
Ԕ1��H�5.�H�=�g�:��L�1�H�
l�1��pH�5�H�=g���L�	�H�
��1�� H�5ސH�=Wg����L��H�
��1��*H�5��H�=/g����L�ĐH�
T�1��8H�5��H�=g���L��H�
,�1��9H�5f�H�=�f�r��L�{�H�
Ԕ1���H�5>�H�=�f�J��L���H�
��1���H�5�H�=�f�"��L�1�H�
d�1��H�5�H�=gf�
��L��H�
̑1��2H�5ƏH�=?f��
��L���H�
t�1��H�5��H�=f�
��L���H�
��1��PH�5d�H�=�e�
��L�;�H�
t�1���H�5<�H�=�e�Z
��L�ەH�
L�1���H�5�H�=�e�2
��L��H�
$�1���H�5�H�=we�

��L��H�
L�1��%H�5ēH�=Oe����L���H�
��1���H�5��H�='e���L�x�H�
<�1���H�5t�H�=�d���L���H�
�1���H�5L�H�=�d�j��L�m�H�
��1���H�5$�H�=�d�B��L��H�
��1���H�5��H�=�d���L�K�H�
l�1���H�5ԒH�=_d����L���H�
�1���H�5��H�=7d����L�ٍH�
ܙ1���H�5��H�=d���L���H�
��1���H�5\�H�=�c�z��H��H�=kp1��i��L���H�
;�1���H�5#�H�=�c�A��L�P�H�
�1���H�5��H�=�c���L��H�
�1���H�5ӑH�=^c��
��L���H�
Ø1���H�5��H�=6c��
��L��H�
��1���H�5��H�=c�
��L���H�
ӗ1���H�5[�H�=�b�y
��L��cH�
�1���H�53�H�=�b�Q
��L�ȵH�
×1���H�5�H�=�b�)
��L�+�H�
��1���H�5�H�=nb�
��L�qcH�
�1���H�5��H�=Fb��	���BH�=������L�-�H�
��1��H�5��H�=
b�	��L�"�H�
r�1��H�5Z�H�=�a�x	��L�)�H�
*�1��VH�52�H�=�a�P	��H�=��1��B	��L�'�H�
�1��PH�5��H�=�a�	��L�S�H�
̕1���H�5ԏH�=_a����L�k�H�
��1���H�5��H�=7a����L�̊H�
\�1��H�5��H�=a���L���H�
�1��H�5\�H�=�`�z��L��H�
�1���H�5�H�=�`�R��L�7�H�
D�1���H�5�H�=�`�*��L��bH�
�1���H�5ʙH�=o`���L��H�
�1��WH�5��H�=G`����L��TH�
��1��UH�5z�H�=`���L�dTH�
��1��^H�5R�H�=�_���L���H�
L�1���H�5*�H�=�_�b��L�[�H�
4�1��zH�5�H�=�_�:��L���H�
̝1���H�5ژH�=_���L��H�
d�1��H�5��H�=W_����L�˖H�
��1��!H�5��H�=/_����L��H�
d�1���H�5b�H�=_���L��SH�
̛1���H�5:�H�=�^�r��L�W�H�
�1���H�5�H�=�^�J��L��H�
�1��|H�5�H�=�^�"��L�3�H�
D�1��7H�5—H�=g^���L��H�
̙1���H�5��H�=?^����L���H�
$�1��]H�5r�H�=^���L���H�
�1���H�5֜H�=�]�����H�=�����L�JaH�
��1���H�5��H�=�]�I��L���H�
��1���H�5u�H�=�]�!��L���H�
C�1���H�5M�H�=f]���L�ݚH�
��1���H�5%�H�=>]����L���H�
��1��5H�5��H�=]���H�=�1����L�t�H�
m�1��H�5ǛH�=�\�s��L�u�H�
u�1��gH�5��H�=�\�K��L��^H�
��1��H�5w�H�=�\�#��L�T�H�
š1��H�5O�H�=h\���L��H�
��1��H�5'�H�=@\����H�=,�1�����L�&aH�
7�1��H�5�H�=
\�����H�=ٚ���L���H�
��1��TH�5��H�=�[�d��PXL�3bH�
���H�5�aH�=�[P1��9��L���H�
��1���H�5d�H�=~[������L���H�
^�1���H�57�H�=Q[����L�~�H�
��1���H�5�H�=)[����S���L�w�H�
��1��H�5�H�=�Z���L�p�H�
��1��NH�5-�H�=�Z�g��L�ϤH�
��1���H�5n�H�=�Z�?��L�l�H�
��1���H�5F�H�=�Z���L�p�H�
)�1��{H�5�H�=\Z����H�=H�1�����L�b�H�
Ӫ1���H�5`H�=&Z���L���H�
��1���H�5��H�=�Y���L���H�
s�1���H�5��H�=�Y�i��H�=™1��[��H�=��1��M��L��H�
��1��H�5T�H�=�Y�%��L��H�
w�1��H�5,�H�=jY���L�͡H�
��1��oH�5�H�=BY����H�=.�1�����L��H�
ɨ1��cH�5ΠH�=Y���L��H�
��1��rH�5��H�=�X�w��L�O�H�
I�1���H�5~�H�=�X�O��L��YH�
!�1���H�5V�H�=�X�'��L�,�H�
��1���H�5.�H�=lX���L��H�
ѧ1���H�5�H�=DX����L��H�
A�1���H�5ޟH�=X���L�̠H�
�1���H�5��H�=�W���H�=�1��y���H�=җ1��k���L�'�H�
U�1��LH�5r�H�=�W�C���L�6�H�
-�1��sH�5J�H�=�W����L��H�
�1��]H�5"�H�=`W��H�=L�1����L�՟H�
'�1��ZH�5�H�=*W���H�=�1����L��H�
�1��SH�5��H�=�V���L���H�
ɦ1��RH�5��H�=�V�_���L���H�
��1��[H�5f�H�=�V�7���L���H�
a�1��\H�5>�H�=|V����L�v�H�
9�1��pH�5�H�=TV���H�=@�1�����L�B�H�
�1��-H�5�H�=V���H�=
�1����L�B�H�
U�1���H�5��H�=�U�{���L��H�
-�1���H�5��H�=�U�S���L��H�
��1���H�5Z�H�=�U�+���L��H�
ͤ1���H�52�H�=pU����H�=\�1����L��TH�
g�1���H�5�TH�=:U����L�4�H�
�1���H�5ԜH�=U���H�=��1����H�=�1����H�=�1��{���H�=Ԕ1��m���H�=Ɣ1��_���H�=��1��Q���L�n�H�
ˣ1���H�5X�H�=�T�)���H�=��1�����L�@�H�
��1���H�5"�H�=`T��L�ԡH�
E�1���H�5��H�=8T����H�=$�1����H�=�1����L��H�
�1��;H�5��H�=�S���H�=�1��y���H�=�1��k���L��2H�
��1���H�5r�H�=�S�C���L�H�H�
e�1��~H�5J�H�=�S����H�=t�1��
���H�=f�1����H�=X�1���H�=J�1����L��H�
m�1���H�5�H�=(S���H�=�1����L���H�
ϡ1��GH�5��H�=�R���L�H�
G�1���H�5��H�=�R�]���H�=��1��O���L�l�H�
��1��,H�5V�H�=�R�'���H�=��1�����L�W�H�
��1��QH�5 �H�=^R��L���H�
ä1��wH�5��H�=6R����L�d�H�
��1��vH�5k�H�=R���L��H�
��1���H�5C�H�=�Q�y���L�ߣH�
k�1���H�5�H�=�Q�Q���L�Z�H�
��1���H�5U�H�=�Q�)���L�Y�H�
��1���H�5-�H�=nQ����L�H�H�
ӥ1���H�5�H�=FQ����L���H�
�1���H�5ݤH�=Q���L�&�H�
�1��|H�5��H�=�P���L��H�
��1���H�5��H�=�P�a���L���H�
��1��yH�5e�H�=�P�9���L�ȤH�
+�1��3H�5=�H�=~P����L�w�H�
#�1��BH�5�H�=VP���H�=B�1�������PX��H�=E�P����L���H�
u�1��oH�5�H�=P���L��H�
-�1��_H�5��H�=�O�s���L�١H�
��1��{H�5T�H�=�O�K���H�=��1��=���H�=��1��/���L���H�
�1��H�5�H�=tO����L�R�H�
�1��(H�5�H�=LO����L�E�H�
Ѩ1��H�5��H�=$O���L�T�H�
��1���H�5��H�=�N���L�,�H�
I�1��^H�5p�H�=�N�g���L�X�H�
	�1���H�5H�H�=�N�?���L���H�
�1���H�5 �H�=�N����L�&�H�
y�1���H�5%�H�=\N���L�U�H�
��1���H�5��H�=4N����L��H�
I�1���H�5էH�=N���L��H�
y�1���H�5��H�=�M�w���L�˧H�
9�1���H�5��H�=�M�O���H�t$H�=7�1��|��H�=��1��.���H�=��1�� ���H�=y�1�����L�x�H�
�1��H�5S�H�=WM���H�=C�1����H�=5�1����H�='�1���L�&�H�
b�1���H�5�H�=M��L���H�
j�1��KH�5F�H�=�L�p���P�dH�=)��j��L�K�H�
��1��~H�5	�H�=�L�2�L�ӪH�
$�1��4H�5�H�=wL�
�L��H�
�1��GH�5��H�=OL���L�2�H�
�1���H�5��H�='L��PXL��H�
2���H�5_�H�=�KP1���L���H�
a�1���H�54�H�=�K�g�H��H�=��1����L�īH�
��1��xH�5��H�=�K�.�L��H�
`�1���H�5ӜH�=sK��L�īH�
8�1���H�5��H�=KK���L��H�
�1���H�5��H�=#K��L�A�H�
�1���H�5[�H�=�J��L�G�H�
��1��@H�53�H�=�J�f����L��H�
�1��OH�5�H�=�J�9�L�P�H�
{�1���H�5ޛH�=~J��L�e�H�
�1��H�5��H�=VJ���L�"�H�
�1��H�5��H�=.J��L��H�
ï1��H�5f�H�=J��L�ҭH�
{�1��7H�5>�H�=�I�q�������L���H�
	�1��SH�5�H�=�I�?�L���H�
��1���H�5�H�=�I��H�=p�1��	�L�j�H�
k�1���H�5��H�=NI���H�=:�1����H�=,�1����L�&�H�
�1���H�5j�H�=
I��L�6�H�
��1��oH�5B�H�=�H�u�L�U�H�
׮1��nH�5�H�=�H�M�L�F�H�
�1��'H�5�H�=�H�%�L���H�
G�1���H�5ʙH�=jH��L�6�H�
�1��uH�5��H�=BH���L�B�H�
�1���H�5��H�=H��L�+�H�
ϵ1���H�5~�H�=�G��L��hH�
��1���H�5V�H�=�G�]�L��nH�
�1��H�5.�H�=�G�5�L�ƲH�
�1���H�5�H�=zG�
�L�N�H�
o�1��H�5ޱH�=RG���L�N�H�
7�1��/H�5��H�=*G��L�&�H�
�1��:H�5��H�=G��L�E�H�
�1��H�5f�H�=�F�m�L�2�H�
�1��H�5>�H�=�F�E�L��gH�
7�1���H�5�H�=�F��L���H�
��1���H�5GLH�=bF��L��LH�
w�1��H�5LH�=:F���L���H�
��1��GH�5��H�=F��L��H�
��1��
H�5v�H�=�E�}�L�ݱH�
�1��RH�5N�H�=�E�U�L���H�
�1��mH�5&�H�=�E�-�L��H�
_�1��H�5��H�=rE��L�{�H�
7�1��H�5֯H�=JE����kH�=�����H�=CL1���L��H�
P�1��,H�5��H�=E��L���H�
�1��H�5��H�=�D�n���H�=z��m��L�ƬH�
�1���H�5��H�=�D�5�L���H�
�1��H�5��H�=zD�
�L���H�
�1���H�5l�H�=RD���L���H�
W�1���H�5D�H�=*D��L���H�
O�1��%H�5�H�=D��L�_�H�
g�1��:H�5�H�=�C�m�L�f�H�
?�1��GH�5̸H�=�C�E�L�f�H�
�1��HH�5��H�=�C��H�4$H�=ʯ1��KX���ɋ��H�=u������H�=d���H�==�1����L���H�
ȹ1��jH�55�H�=C��L�гH�
��1���H�52�H�=�B��L�,�H�
x�1���H�5
�H�=�B�^��nH�=��]�����H�=��L���L�f�H�
��1��VH�5��H�=�B��L�׺H�
��1���H�5��H�=YB���L���H�
N�1���H�5p�H�=1B���L��H�
&�1���H�5H�H�=	B��L���H�
��1��)H�5 �H�=�A�t�L��H�
F�1���H�5��H�=�A�L�L���H�
�1��H�5иH�=�A�$�L��H�
V�1��fH�5��H�=iA��L���H�
��1��<H�5C�H�=AA���L�]�H�
��1���H�5�H�=A��L�m�H�
��1��oH�5�H�=�@��L�žH�
�1��DH�5;H�=�@�\�L�ݾH�
�1��WH�5�H�=�@�4��bH�=־�3����kH�=ž�"����tH�=�������~H�=�������H�=־����TH�=ž�����WH�=������L���H�
��1��+H�5��H�=@��L�Q�H�
��1��*H�5k�H�=�?�m�L�u�H�
_�1��eH�5C�H�=�?�E�1�H�=7L1��5�L�^�H�
��1���H�5�H�=z?�
�L�ݿH�
��1���H�5�H�=R?���L���H�
��1���H�5��H�=*?��L�!�H�
��1���H�5��H�=?��L���H�
��1��{H�5k�H�=�>�m�L�ҿH�
��1���H�5C�H�=�>�E�L���H�
��1��qH�5�H�=�>��L���H�
��1��}H�5�H�=b>��L�Z�H�
��1��jH�5˼H�=:>���L���H�
?�1���H�5��H�=>��H�=�}1���L���H�
��1���H�5m�H�=�=�o�H�=�1��R��H�Z�71��0H���H��f��H�=9J1��7�L�0�H�
Y�1���H�5��H�=|=��1�H�=J1���L��CH�
�1��H�5)CH�=D=���H�=0}1����H�="}1���L���H�
-�1��XH�5 �H�==��H�=�I1���PXL�TCH�
}��H�5�BH�=�<P1��Z��(H�=���Y���L���H�
+�1��H�5��H�=�<�!�L�z�H�
��1���H�5��H�=f<��L���H�
K�1��[H�5^�H�=><���L�y�H�
�1��fH�56�H�=<����H�=��������L�@�H�
U�1��H�5��H�=�;�k�L�d�H�
}�1���H�5��H�=�;�C�L���H�
U�1���H�5��H�=�;��L���H�
m�1���H�5��H�=`;���L�
�H�
E�1���H�5X�H�=8;���L���H�
�1��}H�50�H�=;��L���H�
��1��|H�5�H�=�:�{�L���H�
}�1��H�5��H�=�:�S�L���H�
5�1��H�5��H�=�:�+�H�=�z1���L���H�
��1���H�5}�H�=b:��L�
H�
��1��uH�5��H�=::���L���H�
��1���H�5d�H�=:��L�&�H�
�1���H�5<�H�=�9�}�L�|�H�
��1���H�5z�H�=�9�U�L�s�H�
��1��cH�5R�H�=�9�-��fH�=:��,���H�=uy1����oH�=^��
�����H�=M���L�u�H�
��1��uH�5��H�=19���PXL��8H�
T���H�5�8H�=	9P1�����H�=]���H�=q�1�A��M���{_���L�g�H�
<�1��nH�5�H�=�8�B�L���H�
�1���H�5��H�=�8��L�a!H�
��1���H�5�7H�=_8����H�=��1�L�t$H�l$L�d$H�\$A�L�$$�M���^H�=x1����L���H�
�1��H�5��H�=�7���L���H�
��1��H�5?�H�=�7�c��L�<�H�
U�1���H�5�H�=�7�;��L���H�
-�1���H�5��H�=�7���L���H�
�1���H�5��H�=X7����L�u�H�
��1���H�5��H�=07����L���H�
��1��.H�5��H�=7���L���H�
��1��jH�5��H�=�6�s��L�
�H�
��1���H�5��H�=�6�K��L���H�
}�1���H�5r�H�=�6�#��PXL�y�H�
���gH�5y�H�=h6P1��������L�:H�
��1��/H�5I�H�=86����L���H�
��1���H�5!�H�=6���L��5H�
e�1��"H�5��H�=�5�{����PXH�=v�P1��f��L�\�H�
�1���H�5P�H�=�5�>��L�o�H�
p�1���H�5(�H�=�5���L�-�H�
�1���H�5�H�=[5����L��H�
�1���H�5��H�=35����L�@�H�
��1���H�5��H�=5���L�"�H�
x�1���H�5��H�=�4�v��L���H�
P�1���H�5`�H�=�4�N��L���H�
(�1���H�58�H�=�4�&��L��H�
��1��_H�5�H�=k4���L���H�
��1��H�5��H�=C4����L�4�H�
��1��iH�5��H�=4���L�g�H�
�1���H�5��H�=�3���L��H�
��1���H�5p�H�=�3�^��L���H�
@�1��,H�5��H�=�3�6��L���H�
��1��H�5��H�={3���L�7�H�
��1��2H�5��H�=S3����L���H�
��1��PH�5z�H�=+3���L���H�
��1��*H�5R�H�=3���L�l�H�
x�1��ZH�5*�H�=�2�n��L���H�
��1��.H�5[�H�=�2�F��L�G�H�
X�1��'H�53�H�=�2���L���H�
�1��7H�5��H�=c2���L���H�
0�1��#H�5
�H�=;2����H�='r1����L�!�H�
��1��mH�5f�H�=2���L�e�H�
��1���H�5>�H�=�1�p��PXL���H�
`��H�5��H�=�1P1��E��L���H�
W�1���H�5��H�=�1���������H�=lq1����H�=^q1����L���H�
��1��CH�5��H�=<1����L��H�
��1��H�5u�H�=1���L�
�H�
y�1��?H�5M�H�=�0���L���H�
Q�1��NH�5%�H�=�0�W��H�=�p1��I��L�}�H�
��1��H�5~�H�=�0�!��PXL�S�H�
���H�5V�H�=f0P1��������H�=Jp1�����L�$�H�
��1��PH�5��H�=(0������L���H�
H�1���H�5��H�=�/���L���H�
 �1���H�5i�H�=�/�f��L�T�H�
��1��!H�5M�H�=�/�>��L�R�H�
��1���H�5%�H�=�/���L�u�H�
�1��H�5j�H�=[/����L�o�H�
@�1��|H�5B�H�=3/����L�f�H�
�1���H�5�H�=/���L�M�H�
��1���H�5��H�=�.�v���'H�=���u���H�=���d�L��H�
��1��H�5��H�=�.�,��L���H�
^�1��H�5��H�=q.�����H�=h���L���H�
%�1���H�5G�H�=8.�����H�=/����L���H�
��1���H�5�H�=�-���L��H�
T�1��H�5)�H�=�-�j��L��H�
��1���H�5B-H�=�-�B��L���H�
��1���H�5�H�=�-���L��.H�
�1���H�5��H�=_-����H�=�91�����L��H�
F�1��H�5�H�=)-���L���H�
��1���H�5WH�=-���L�E�H�
��1���H�5/H�=�,�l��L���H�
~�1���H�5H�=�,�D��L��vH�
V�1���H�5�H�=�,���L���H�
.�1���H�5�H�=a,����L���H�
��1��;H�5�H�=9,����L�j�H�
^�1���H�5gH�=,���L�u2H�
�1��H�5�1H�=�+�|��L�6�H�
��1���H�5H�=�+�T��PXL���H�
t��H�5��H�=�+P1��)��L���H�
k�1���H�5�H�=n+���L���H�
��1��jH�5�H�=F+����L���H�
k�1��pH�5tH�=+���L��H�
#�1���H�5�*H�=�*���L���H�
��1���H�5$H�=�*�a��L���H�
��1���H�5�H�=�*�9�����L���H�
f�1���H�5�H�=y*���L�:�H�
>�1���H�5�H�=Q*����H�==j1�����L�/�H�
(�1���H�5qH�=*���L�5�H�
`�1��rH�5IH�=�)���L���H�
8�1��_H�5!H�=�)�^��L���H�
�1��eH�5�
H�=�)�6��L���H�
��1��xH�5�
H�={)���L���H�
��1��H�5�
H�=S)����L���H�
��1��{H�5�
H�=+)���L���H�
��1���H�5Y
H�=)���L�j�H�
h�1���H�51
H�=�(�n��L���H�
@�1��IH�5	
H�=�(�F��L�@�H�
�1��CH�5�H�=�(���H�4$H�=��1����L�?�H�
�1��&H�5�H�=Q(����L���H�
��1��XH�5H�=)(���L��H�
n�1��\H�5WH�=(���L���H�
F�1��gH�5/H�=�'�l��L��(H�
��1���H�5H�=�'�D��L���H�
��1���H�5�H�=�'���L��(H�
��1���H�5�H�=a'����L���H�
��1��cH�5�H�=9'����L�(�H�
~�1��>H�5��H�='���L�}�H�
v�1��NH�5��H�=�&�|��L���H�
N�1��LH�5��H�=�&�T��L�B�H�
V�1��fH�5d�H�=�&�,���%H�=O��+�L�R�H�
m�1��:H�5.�H�=`&����PXL�%�H�
C��H�5(�H�=8&P1�����L�5�H�
:�1��H�58�H�=
&���1�H�=�21����L�)�H�
B�1��H�5�H�=�%�h��L��xH�
�1��H�5��H�=�%�@��L��xH�
��1��NH�5��H�=�%���� ���L��+H�
U�1��H�5=+H�=X%����H�=De1�����L�TxH�
��1��H�5M�H�="%���L�,xH�
��1��2H�5%�H�=�$���L�xH�
o�1��DH�5��H�=�$�e��L�ʥH�
_�1��ZH�5)�H�=�$�=��L�M�H�
��1��H�5U�H�=�$���H�=nd1����L�;�H�
��1��H�5<�H�=L$����H�=8d1�����L�A%H�
C�1���H�5��H�=$���PXL��#H�
���H�5�#H�=�#P1��~��L�K�H�
0�1��9H�5K�H�=�#�V��L���H�
��1��PH�5#�H�=�#�.��L���H�
��1��nH�5��H�=s#����X���L�k�H�
S�1���H�5��H�=F#����L���H�
+�1���H�5��H�=#�������L�$H�
��1���H�5��H�=�"���L���H�
��1��LH�5��H�=�"�\��L���H�
��1��+H�5��H�=�"�4��L���H�
v�1��.H�5��H�=y"���L���H�
.�1��UH�5b�H�=Q"������H�=J�����L�i�H�
��1���H�5)�H�="���L�A�H�
��1���H�5�H�=�!���L�,�H�
��1���H�5��H�=�!�[��L��H�
}�1���H�5��H�=�!�3��L�XH�
U�1���H�5��H�=x!���L���H�
-�1��bH�5a�H�=P!����L�s�H�
u�1��H�5�H�=(!����|H�=g����L���H�
\�1��MH�5F�H�=� ���L���H�
T�1���H�5�H�=� �Z��L�3�H�
,�1��H�5��H�=� �2����H�=��1��H�=R�1����L���H�
��1��H�5�H�=X ����L���H�
M�1��cH�5�H�=0 ����PXL��&H�
S��H�5�%H�= P1��������L�8�H�
%�1��FH�55�H�=��k��L�2�H�
��1���H�5
�H�=��C��L�2�H�
��1���H�5��H�=����L���H�
m�1���H�5��H�=`����L���H�
�1��mH�5��H�=8����L���H�
��1���H�5m�H�=���L�}�H�
��1���H�5E�H�=��{��L���H�
��1���H�5��H�=��S��H�3H�=��1��B��H�=6+1��4��L���H�
&�1��rH�5��H�=y���L���H�
��1��H�5��H�=Q����L�h�H�
��1���H�5p�H�=)���L���H�
N�1��WH�5��H�=���L���H�
�1��lH�5��H�=��l��H�=�]1��^��L���H�
��1��$H�5�H�=��6���^H�=���5��H�=�$1����L��eH�
I�1���H�5��H�=\����L���H�
��1���H�5p�H�=4����L�a�H�
��1���H�5H�H�=���L�a�H�
Q�1��H�5 �H�=��w��L���H�
)�1��H�5��H�=��O��L��H�
��1��&H�5��H�=��'��H�=�#1����L��dH�
+�1��iH�5^�H�=^����L���H�
��1��CH�56�H�=6����L���H�
�1��xH�5�H�=���L�[�H�
�1���H�5��H�=��y��L��H�
�1���H�5��H�=��Q��L�b�H�
C�1��!H�5��H�=��)��1�H�=(1����L��!H�
��1��H�5C!H�=^����H�=+�1��#0��醤	H�=��1��0���s�	H�=$[1����L�&�H�
�1��SH�5��H�=���L���H�
W�1��LH�5��H�=��m��L���H�
O�1��qH�5��H�=��E��L���H�
'�1���H�5l�H�=����L���H�
/�1��;H�5�H�=b����.H�=������L�9H�
1��)H�57H�=)���L�H�
�1��KH�5H�=���L��H�
v1��QH�5�H�=��l���L��H�
.1��XH�5�H�=��D���L��H�
�1��_H�5�H�=�����L�qH�
�1��eH�5oH�=a��L�IH�
61��kH�5GH�=9����L�!H�
�1��pH�5H�=���L��H�
�1��vH�5�H�=��|���L��H�
^1��|H�5�H�=��T���L��H�
1���H�5�H�=��,���L��H�
�1���H�5H�=q����L�YH�
�1���H�5WH�=I�ܿ��L�1H�
>1���H�5/H�=!贿��L�	H�
�1���H�5H�=�茿��L��H�
�1���H�5�H�=��d���L��H�
f1���H�5�H�=��<���L��H�
1���H�5�H�=�����L�iH�
�1���H�5gH�=Y���L�AH�
�1���H�5?H�=1�ľ��L�H�
F1���H�5H�=	蜾��L��
H�
�1���H�5�
H�=��t���L��
H�
�1���H�5�
H�=��L���L��
H�
n1���H�5�
H�=��$���L�y
H�
1���H�5w
H�=i���L�Q
H�
�1���H�5O
H�=A�Խ��L�)
H�
�1���H�5'
H�=謽��L�
H�
>1���H�5�H�=�脽��L��H�
�1���H�5�H�=��\���L��H�
�1��H�5�H�=��4���L��H�
f1��H�5�H�=y����L�aH�
&1��H�5_H�=Q���L�9H�
�1��%H�57H�=)輼��L�H�
�1��/H�5H�=蔼��L��H�
V1��7H�5�H�=��l���L��H�
1��BH�5�H�=��D���L��H�
�1��KH�5�H�=�����L�qH�
n1��RH�5oH�=a��L�IH�
1��^H�5GH�=9�̻��L�!H�
�1��gH�5H�=褻��L��
H�
�1��mH�5�
H�=��|���L��
H�
>1��tH�5�
H�=��T���L��
H�
�
1��{H�5�
H�=��,���L��
H�
�
1���H�5
H�=q����L�Y
H�
f
1���H�5W
H�=I�ܺ��L�1
H�

1���H�5/
H�=!贺��L�	
H�
�1���H�5
H�=�茺��L��	H�
�1���H�5�	H�=��d���L��	H�
F1���H�5�	H�=��<���L��	H�
�1���H�5�	H�=�����L�i	H�
�1���H�5g	H�=Y���L�A	H�
n1���H�5?	H�=1���L�	H�
61���H�5	H�=	蜹��L��H�
�
1���H�5�H�=��t���L��H�
�
1���H�5�H�=��L���L��H�
n
1���H�5�H�=��$���L�yH�
&
1���H�5wH�=i���L�QH�
�	1���H�5OH�=A�Ը��L�)H�
�	1��
H�5'H�=謸��L�H�
N	1��H�5�H�=�脸��L��H�
	1��H�5�H�=��\���L��H�
�1��$H�5�H�=��4���L��H�
v1��,H�5�H�=y����L�aH�
.1��4H�5_H�=Q���L�9H�
�1��<H�57H�=)輷��L�H�
�1��EH�5H�=蔷��L��H�
V1��NH�5�H�=��l���L��H�
1��YH�5�H�=��D���L��H�
�1��kH�5�H�=�����L��wH�
�1���H�5oH�=a��L�5H�
�1��1H�5�H�=9�̶��L�5H�
�1���H�5�H�=褶��L�]H�
F1��H�5�H�=��|���L�
H�
1��H�5qH�=��T�����H�=Y�S��L��JH�
�1��tH�58H�=�����L�4H�
�1��xH�5�H�=`��L��tH�
�1��YH�5oH�=8�˵��L��H�
�1��lH�5GH�=裵��H�=�M1�蕵��L�_H�
1���H�5H�=�
�m���L�aH�
�1��RH�5�H�=�
�E���H�=�M1��7���L��H�
)1��HH�5�H�=|
����H�=�1��A��H�=�1��3��L�#H�
�1��IH�5$H�=8
�˴��L��H�
=1��/H�5�H�=
裴��H�=�L1�蕴��H�=�L1�致��L�aH�
�1��MH�5`H�=��_���L�9H�
)1��H�58H�=��7���H�=�L1��)���L�xH�
;1��%H�5H�=n����L��H�
�1���H�5�H�=F�ٳ���5Ӵ7H�=�1����7� �����7�
L�zH�
D1���H�5�H�=�芳��L�RH�
�1���H�5cH�=��b���L�?H�
�1��H�5;H�=��:���H�=�K1��,���H�=�K1�����L�%H�
P1��H�5H�=c���L��H�
(1��H�5�H�=;��L� H�
`1��}H�5�H�=覲��L�_H�
X1��]H�5nH�=�
�~���L�mH�
�1���H�5FH�=�
�V���H�=o1����L��H�
�1���H�5H�=�
� ���L�_H�
b1���H�5�H�=e
���Hc�H�=n1��'��L��H�
�1��FH�5�H�=,
迱��H�=h1�����L��H�
s1��
H�5��H�=�	艱��L��H�
+1��JH�5��H�=�	�a���L��H�
�1��fH�5u�H�=�	�9���PXL�LH�
A�TH�5��H�=~	P1�����L��H�
81��H�5�H�=S	���L��H�
1��1H�5�H�=+	辰��L��H�
�1��H�5aH�=	薰��L��H�
�1��%H�59H�=��n���L��H�
h1��\H�5H�=��F���L�.H�
@1��`H�5�H�=�����L�H�
1��hH�5�H�=c���L��H�
�1��EH�5�H�=;���H�=1������H�=M���L� H�
1#1��<H�5� H�=�臯��L�!H�
I#1��!H�5� H�=��_���L�� H�
!#1��)H�5� H�=��7���L�� H�
�"1��H�5� H�=|����L�� H�
�"1��H�5^ H�=T���L�pH�
I"1���H�56 H�=,迮��L� H�
!"1���H�5 H�=藮��L�hH�
�!1���H�5�H�=��o���L�� H�
�!1���H�5�H�=��G���L�^ H�
�!1���H�5�H�=�����L�  H�
a!1���H�5nH�=d���L��H�
!1��0H�5FH�=<�ϭ��L�0H�
� 1��hH�5H�=觭��L��H�
� 1��fH�5�H�=�����L��H�
� 1���H�5�H�=��W���L�DH�
� 1���H�5�H�=��/���L�H�
Q 1��tH�5~H�=t����L��H�
) 1��H�5VH�=L�߬��L��H�
! 1���H�5.H�=$跬��L�>H�
�1���H�5H�=�菬��L�n�H�
�1���H�5�H�=��g���L�#H�
�1���H�5�H�=��?���L��H�
a1���H�5�H�=�����L��H�
Y1���H�5fH�=\���L��H�
11���H�5>H�=4�ǫ��L��H�
�1���H�5H�=蟫��L�H�
�1���H�5�H�=��w���L��H�
y1���H�5�H�=��O���L��H�
Q1���H�5�H�=��'���L�	H�
)1��9H�5vH�=l���L�8H�
1���H�5NH�=D�ת��L��H�
�1���H�5&H�=诪��L�H�
�1��H�5�H�=�自��L�	H�
i1���H�5�H�=��_���L��H�
A1���H�5�H�=��7���L��H�
1���H�5�H�=|����L��H�
�1��jH�5^H�=T���L�MH�
�1��iH�56H�=,迩��L�%H�
�1��&H�5H�=藩��L�>H�
Y1��.H�5�H�=��o���L�XH�
�1��H�5wH�=��G���L�~H�
�1��H�5yH�=�����PXL��H�
��jH�5�H�=dP1���L�MH�
�1��H�5sH�=9�̨��H��H��H�=G1�踨��H��H�=�
1�觨��L�DH�
q1��#H�5&H�=������[���H�?�U
L�:H�
 1��kH�5�H�=��F���H��H�=�1��5�������H���V
H��L��H�=�1�����L��H�
�1��kH�5�H�=U����H��H�=�1��ҧ��H���|W
L��H�
x1��kH�5EH�=螧���z����u���H�Y�^X
L�TH�
:1��kH�5H�=��`���H�=	1��R����.���H��Y
L�
H�
�1��kH�5�H�=������H��1�H��H�=�����H��H�=�1���H���FZ
L��H�
�1��iH�5gH�=-�������L��H�
m1��kH�5:H�=�蓦��L�uH�
51��bH�5H�=��k����G���H�+�[
L�&H�
1��kH�5�H�=���2���H�=�1��$���L�H�
�1���H�5�H�=i����L�	H�
^1���H�5{H�=A��ԥ��L��H�
1���H�5SH�=�謥��L��L��H�='1�蘥��L��H�
�1���H�5H�=��p���L�wH�
�1��H�5jH�=���H���L�+�H�
�1���H�5.�H�=��� ���L�AH�
b1��/H�5H�=e����H�=o1����H�=a1��ܤ��L��H�
�1��}H�5�H�=!�贤��L�#H�
�$1���H�5�rH�=��茤��L�gH�
�$1���H�5�rH�=��d���L��H�
�#1���H�5�rH�=���<���L���H�
�#1���H�5XrH�=������L�AH�
f#1���H�50rH�=Y����L�H�
>#1���H�5rH�=1���L��H�
#1���H�5�qH�=	�蜣��L�-H�
�"1���H�5�qH�=��t���L��H�
�#1��xH�5�qH�=���L���L��H�
.#1���H�5hqH�=���$���L��H�
�"1��H�5@qH�=i����L��H�
"1���H�5qH�=A��Ԣ��L��H�
f!1���H�5�pH�=�謢��L��H�
>!1���H�5�pH�=�脢��H�=�:1��v����GH�=�p�u����]H�=�p�d���L��H�
� 1��H�5ppH�=���,���L��H�
~ 1��yH�5HpH�=q�����L��H�
�!1��#H�5 pH�=I��ܡ��L��H�
� 1��uH�5�oH�=!�贡��L��H�
� 1���H�5�oH�=��茡��L��H�
� 1��8H�5�oH�=��d���L�^H�
� 1��ZH�5�oH�=���<���L�tH�
�1���H�5XoH�=������L�AH�
�1���H�50oH�=Y����L�H�
�1���H�5oH�=1��Ġ��L�~�H�
v1���H�5�nH�=	�蜠��L��H�
N1���H�5�nH�=��t���L�|H�
&1���H�5�nH�=���L���L�}H�
~1���H�5hnH�=���$���L��H�
V1���H�5@nH�=i����L�FH�
1���H�5nH�=A��ԟ��PXL�5 H�
!�OH�59 H�=�P1�詟������L�* H�
� 1��4H�5% H�=��|���H�= 1�讽��H�=' 1�蠽�����H�=�1�荽��L�0 H�
w 1���H�5�H�=���%���H�=�1��W���L��H�
A 1���H�5�H�=\����H�=�1��!���L��H�
�1���H�5bH�=&�蹞��L��H�=?%1����7衞��H��I��v1�H�5
$H�=�聞��謢��H�==%1��n���H�=b1��`���L�A%H�
b&1��lH�5�#H�=���8���L�X$H�
&1���H�5�#H�=}�����L�%H�
�%1���H�5t#H�=U����L�n#H�
�%1���H�5L#H�=-����L�F#H�
R%1���H�5$#H�=�蘝��H��1�H�=�臝��H�=�51��y���L��#H�
k%1���H�5�"H�=���Q���L��#H�
C%1���H�5�"H�=���)���L�W#H�
%1���H�5�"H�=n�����L�d#H�
%1���H�5e"H�=F��ٜ��H�=K#1��˜��H�t$p1�H�=d%�	��H�5r%L��1������
L�7'H�
(1��H�5<'H�=���z���H��H��H�=.'1�覺��H�=�41��X���L�5tH�
�'1��H�5�&H�=���0���H��H�='1��_���H�='1��Q���H�=j41�����1�H�=�1���L�
'H�
5'1��hH�5�&H�=8��˛��L�<'H�
�)1���H�5�'H�=�裛���EH�=�'袯���GH�=�'葯��PXL�('H�
�)�}H�5�'H�=��P1��V����8H�=l'�U����EH�=['�D���PXL�'H�
)��H�5:'H�=y�P1��	���H�=b31����L�K'H�
})1��GH�5'H�=@��Ӛ��L�#'H�
5)1��QH�5�&H�=�諚��L�$'H�
�(1���H�5�&H�=��胚��L��&H�
�(1���H�5�&H�=���[�����H�=q&�Z����dH�=`&�I�����H�=O&�8�����H�=>&�'����pH�=-&����L��&H�
�'1���H�5&H�=K��ޙ�����L��&H�
�'1���H�5�%H�=�豙���x���H�5M(H�=Q*1��׷��H�5`(H�=<*1��·��H��H�5D*�S1��L�H�5](H�=*1�藷��H��H�5u(�S1��!�H�5�(H�=�)1��l���H�5�(H�=�)1��W���H�5�(H�=�)1��B���H�5�)H�=�)1��-���H�56)H�=�)1�����H�5Q)H�=})1�����L��)H�
E*1���H�5�)H�=�蛘��H�5|(H�=@)1��ƶ��H�5�(H�=+)1�豶��蜜��L�M1H�
�11��CH�5i1H�=���D���H�=�01��6���H�=�01��(���H�=�01�����H�=s01�����H�=e01�����)����$�����PXH��H���7�|$H��t�=;�7u�2�7H�|$�Ћ|$�����PX�RP������PX�RP������SH��H��H�t$XH�T$`H�L$hL�D$pL�L$x��t@)�$�)�$�)�$�)�$�)�$�)�$�)�$�)�$�dH�%(H�D$H1���2��I��1��	I�P�$H��H���D$0H�T$0�H��$�D$40L��H�D$8H�D$PH�D$@���7L��1H�
�21��aH�5�0H�=�蘖��H�=�.1�芖����SH��H��H�t$XH�T$`H�L$hL�D$pL�L$x��t@)�$�)�$�)�$�)�$�)�$�)�$�)�$�)�$�dH�%(H�D$H1���$��I��1��I�P�D$0H��H���D$40H�T$0�L��H�YH�$H��$H�D$8H�D$PH�D$@���7��U��SH��H��H�T$`H�L$hL�D$pL�L$x��t@)�$�)�$�)�$�)�$�)�$�)�$�)�$�)�$�dH�%(H�D$H1���G��I��1��I�P�l$H��H���$H�T$0�H��$ L���D$0H�D$8H�D$P�D$40H�D$@���7��PXP���t
��H���t	�H�'�H�5�.�Q1��}��Q����H��H�5AY�P1��]��P�����ATI��USH���H�t$(H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�舘���$H��L��(H��H��$��D$0H�D$H�D$ H�=�7H�D$���7�+H�D$dH3%(t胰��H���[]A\�H�4$H�=�-1�������
諗��������5n�7H�=�-1������
�5Y�7H�=�-1�����o�
��PXP��1�H��H�=
.�(�����H�=-�'�����H�=
/1��G�����H�=/1��7����D$rH�T$��H�=/1�A�����
H�=#/1�����L�#/H�
�01��fH�5/H�=	�蜒����H�=)/1��̰����H�=�.1�輰���H�
'/M��tLPM��1�H�=�/AQH�t$(M�����XZ�'�
H�
�.H��t)AVM��H�=s/1�AQH�t$(M���"���L�%��L���L�%��L����H�=�/1��<���L�0H�
601��pH�50H�=A��ԑ��L��/H�
01���H�5�/H�=�謑��H�sH�=�/1������sI�t$1�H��H�="0�����I�D$I�D$ ��L��/H�
�01��?H�5�/H�=���>���L��/H�
�01��EH�5�/H�=������I�t$1�H��H�=0�@������L�0H�
{01���H�5V/H�=>��ѐ��L�5/H�
S01��oH�5./H�=�詐��L�^/H�
+01���H�5/H�=��聐��I�uH�=(@1����H���PL�%/H�
�/1���H�5�.H�=���>���L��.H�
�/1��!H�5�.H�=������L��.H�
X/1��/H�5s.H�=[����L�R.H�
P/1���H�5K.H�=3��Ə��L��.H�
(/1���H�5#.H�=�螏��L��H�=F?1�����H�|$1�A�5L��/H�
B0H��/�V����WL��H�=�1�����AH�=�'1��=���H�=�1�L���l���D���ĺ�����H��H�=ދ1��K�����OH�=]/����H��H�=�/1��$����#H��H��H�=
?1������H��H�=4/1����H�|$1�A�>L�/H�
j/H�/�~����H�sHH�=J�1�����H�s1�H�=U/������1�L��H�=Q/�������H��$�H�=jB1����f����L�8/H�
�11��IH�5�.H�=f����L�W/H�
�11��:H�5�.H�=>��э��H�t$PH�=w=1�������@H��$�H�=�.1����H��$��xH��$�H�=6=1�������7H��$�H��$�1���H�=c=����H�t$PH�=�1��|�����H�t$H�=��1��d���H�|$躔����t@���虑��H�t$H�=7A�8u�H�=/���z���H�t$H�=6/��H�=/%1��Ȍ��H�=!%1�躌��1�H��H�=�-���H�|$����"H�=�$1�艌��H��H�=�-1�������%1�H��H�=T-���1��4&1�H��H�=�;���1��&H�$H��H�=j<H�PH1��g���貐���8uH�<$�� H�������&1�H��H�=�/�.���H��������H�Յ7��'L��/H�
�31���H�5�1H�=�谋��H�=	$1�袋��L�Q2H�
T31���H�5�1H�=���z���L�E2H�
31���H�5|1H�=���R���L�vRH�
d31���H�5T1H�=���*���� H�=<1�)���H�sH�=d21��G�����3H�sH�=�01��0����[4H�sH�T$H�=k01������?4H�sH�=�01�����(4L�.2H�
�21��xH�5�0H�=��萊��1�H�=�2�������7L��2H�
31�� H�5�2H�=���R���1�H�=�2������q7H�=�21��n���H�=�21��`���H�=y"1�����L�H3H�
�31��9H�53RH�=W����L� 3H�
�31���H�5RH�=/��‰��L�;3H�
�31��
H�5�QH�=�蚉��L�*H�
|31���H�5�QH�=���r���L��2H�
T31���H�5�QH�=���J���L��2H�
,31���H�5kQH�=���"���L��2H�
31���H�5CQH�=g����L�02H�
31���H�5QH�=?��҈��L�2H�
�21���H�5�PH�=�誈��L�2H�
<21���H�5�PH�=��肈��H�=� 1��t���1�H�=f�1��d���1�H�=V�1��T���L�	3H�
�31���H�53H�=���,���L�8H�
^31���H�5�2H�=q�����L��2H�
31���H�5�2H�=I��܇��L�'3H�
n31��7H�53H�=!�贇��L��2H�
631��CH�5�2H�=��茇��PXL�[�H�
�3�H�5ڬH�=��P1��a���������������H�=>31��D���H�=�21��6���L��2H�
�41��GH�5�3H�={�����L��3H�
�41��iH�5�3H�=S����L��3H�
`41��hH�5�3H�=+�辆��L��H�=f41�����HfH�=��1�蚆��L��4H�
�41��-H�5H4H�=���r���L�U4H�
�41��@H�5 4H�=���J���L�F4H�
|41��KH�5�3H�=���"���H�=�41��T���H��H�=�41��C���H�=��1����H�=v�1����L��4H�
�41��'H�5�4H�=,�迅��H�=1�豅��H�=��1�装��L��4H�
�41��AH�5s4H�=���{���L��4H�
�41��!H�5�4H�=���S���L�v4H�
�41��(H�5v4H�=���+����dH�=^4�*���L��4H�
|61��NH�5�4H�=_����RH�=|4��L�X4H�
C61��6H�5[4H�=&�蹄��L��4H�
[61��wH�534H�=��葄��L�4H�
61���H�54H�=���i���L�4H�
�51���H�5�3H�=���A���L�"4H�
�51���H�5�3H�=������L��3H�
[51���H�5�3H�=^���L��3H�
51���H�5k3H�=6��Ƀ��L��3H�
�41���H�5C3H�=�衃��L��3H�
s41���H�53H�=���y���L�F3H�
K41���H�5�2H�=���Q���L�23H�
�31���H�5�2H�=���)���L��2H�
�31���H�5�2H�=n�����L��2H�
�31���H�5{2H�=F��ق��L��2H�
k31���H�5S2H�=�豂��L��2H�
31���H�5+2H�=��艂���(H�=B4舖���(H�=14�w���L�p4H�
)61��BH�54H�=���?���L�4H�
�51��TH�5�3H�=������L��3H�
�51��UH�5�3H�=\����L��3H�
a51��_H�5�3H�=4��ǁ��L��3H�
	51��gH�5p3H�=�蟁��L�n3H�
�41��rH�5H3H�=���w���L��3H�
y41��}H�5 3H�=���O���L�D3H�
141���H�5�2H�=���'���L��2H�
�31���H�5�2H�=l����L��2H�
�31���H�5�2H�=D��׀��L��1�H�=�H��H�|$1�A��L��4H�
5H��4華����H�5�4H��������H��H�=9H1����L��H�=#H1����M���H�=�4�W���L��4H�
	71���H�5�4H�=������L��5H�
71��H�5�4H�=d����L��4H�
71��YH�5i4H�=<�����L��4H�
161���H�5A4H�=����L��4H�
I61���H�54H�=�����L��6H�
�:1��UH�5��H�=���W��L��6H�
�;1���H�5X�H�=���/��L�SFH�
�;1��gH�50�H�=t����L��6H�
y;1��hH�5�H�=L���~���EH�=��ޒ���>H�=��͒��L��6H�
�:1��jH�5��H�=��~��L�j6H�
�:1��XH�5��H�=���m~��L�7H�
�:1��UH�5n�H�=���E~��L��H�
w:1��iH�5F�H�=���~��L�6H�
O:1��fH�5�H�=b��}��L��6H�
':1��bH�5��H�=:���}��L�>H�
�91��aH�5��H�=��}��L��6H�
�91��kH�5��H�=���}}��L��dH�
�91���H�5~�H�=���U}��L��=H�
'81���H�5V�H�=���-}��L��H�
91��H�5.�H�=r��}��L��4H�
�81��H�5�H�=J���|��L���H�
�81���H�5��H�="��|��L��6H�
g81��6H�5��H�=���|��L��4H�
81��pH�5��H�=���e|��L��6H�
�71��~H�5f�H�=���=|��L�l4H�
�71��}H�5>�H�=���|��L��6H�
g71���H�5�H�=Z���{��L�,4H�
'71���H�5��H�=2���{��L�~6H�
�61���H�5��H�=
��{��L�V6H�
�61��H�5��H�=���u{��L��3H�
g61��H�5v�H�=���M{��L���H�
�81��!H�5�7H�=���%{��L�8H�
G81��GH�5�7H�=j��z��L��7H�
_81��sH�5r7H�=B���z��L��8H�
'91��|H�5F8H�=��z��L�L8H�
�81��RH�58H�=���z��L�_7H�
�81���H�5�7H�=���]z��L��7H�
o81��5H�5�7H�=���5z��L�|�H�
g81��H�5�7H�=z��
z��L��7H�
81���H�5~7H�=R���y��L��8H�
�81��+H�5�8H�=*��y��L��8H�
�81��:H�5q8H�=��y��L��8H�
�81��=H�5I8H�=���my��L��
H�
�81��JH�5!8H�=���Ey��L�39H�
':1���H�59H�=���y��L�v8H�
�91���H�5�8H�=b��x��L�i9H�
�91��H�5�8H�=:���x��L�9H�
�91���H�5�8H�=��x��L�29H�
�91��H�5n8H�=���}x��L�ϝH�
91���H�5F8H�=���Ux��L�8H�
91��pH�58H�=���-x��L�_8H�
�81��qH�5�7H�=r��x��L�8H�
91���H�5�7H�=J���w��L�^7H�
�81���H�5�7H�="��w��L�X8H�
�81��,H�5~7H�=���w��L��9H�
O;1��#H�5�8H�=���ew��L��8H�
';1��:H�5�8H�=���=w��L��6H�
�:1��zH�5}8H�=���w��L�7H�
�:1���H�5U8H�=Z���v��L�F9H�
O:1��\H�5-8H�=2���v��L�97H�
g:1���H�58H�=
��v��L��6H�
?:1���H�5�7H�=���uv��L�A8H�
�91��kH�5�7H�=���Mv���jH�=�7�L���L��8H�
�91��_H�5|7H�=���v��L��7H�
v91��KH�5T7H�=Y���u��L�m5H�
�91���H�5,7H�=1���u��L�]7H�
f91���H�57H�=	��u��L��7H�
>91���H�5�6H�=���tu��L��5H�
91���H�5�6H�=���Lu��L��5H�
�81���H�5�6H�=���$u������L��71���H�
�8H�5]6H�=b��t��L�7H�
�81��HH�556H�=:���t��L��6H�
�71��=H�5
6H�=��t��L��6H�
�71��-H�5�5H�=���}t��L��6H�
o71��H�5�5H�=���Ut��1�H�=G�1��Et��L�.6H�
G81��bH�5�5H�=���t��L��H�
91��H�5(8H�=b��s��L�<�H�
�81��H�58H�=:���s��L�8H�
�81���H�5�7H�=��s��L��7H�
�81���H�5�7H�=���}s��L�W�H�
�81���H�5�7H�=���Us��L��7H�
w81���H�5`7H�=���-s��L��7H�
81��hH�587H�=r��s��L�߆H�
�71��pH�57H�=J���r��L�P7H�
�71��kH�5�6H�="��r��L�
7H�
�71��HH�5�6H�=���r��L��7H�
81��4H�5�7H�=���er��H�=F81��Wr��L�A9H�
�91��~H�5�8H�=���/r��L��8H�
�91��_H�5�8H�=t��r��L��8H�
�91��oH�5�8H�=L���q��L�q)H�
q91��pH�5|8H�=$��q��L��vH�
I91��\H�5T8H�=���q��L��8H�
!91��H�5,8H�=���gq��L��
H�
�81���H�58H�=���?q��L�c8H�
�81���H�5�7H�=���q��L�:8H�
I81��H�5�7H�=\���p��L�	9H�
191�� H�59H�=4���p��L��8H�
	91��"H�5�8H�=��p��L��9H�
�91���H�5t9H�=���wp��L�9H�
�91���H�5.9H�=���Op��L��4H�
�91���H�5$9H�=���'p��L�V4H�
Y91���H�5�8H�=l��o��L��8H�
191���H�5�8H�=D���o��L���H�
	91���H�5�8H�=��o��L�WH�
91��GH�5�8H�=���o��L�9H�
:1��'H�5�8H�=���_o��L�09H�
�91���H�5�8H�=���7o��L�P9H�
�91���H�5�8H�=|��o��L�X9H�
�91��H�5�8H�=T���n��L�8VH�
�91��JH�5�9H�=,��n��L��9H�
�91��VH�5r9H�=��n��L�p9H�
�91��UH�5J9H�=���on��L�:H�
a<1���H�5;H�=���Gn��L��9H�
9<1���H�5W;H�=���n��L�W;H�
<1���H�5/;H�=d��m��L��sH�
�;1���H�5;H�=<���m��L�H:H�
!<1��)H�5�:H�=��m���H�=�:要��L��:H�
�;1��"H�5�:H�=���nm��L��:H�
�;1���H�5~:H�=���Fm��L��:H�
X;1���H�5V:H�=���m��L��8H�
P;1��aH�5.:H�=c��l���>H�=:���L���H�
;1��zH�5�9H�=*��l��L�-�H�
�:1��yH�5�9H�=��l��L��9H�
;1���H�5�9H�=���ml��L��bH�
�:1���H�5}9H�=���El��1�H�=7�1��5l��L��bH�
:1���H�5E9H�=z��
l��L�sbH�
�91��"H�59H�=R���k��L�^9H�
�91��!H�5�8H�=*��k��L�SH�
�:1���H�5�:H�=��k��L�;H�
�<1��)H�5S<H�=���mk��L��:H�
�<1��&H�5+<H�=���Ek��H�=�:1��7k��L�(;H�
I<1��cH�5�;H�=|��k��L��;H�
A<1���H�5�;H�=T���j��L�8;H�
<1���H�5�;H�=,��j��L��;H�
�;1���H�5};H�=��j��L�q~H�
�;1���H�5U;H�=���oj��L��:H�
�;1���H�5-;H�=���Gj��L��:H�
y;1���H�5;H�=���j��L��<H�
=1��$H�5<H�=d��i��L��<H�
�<1��#H�5W<H�=<���i��L��0H�
�<1��<H�5/<H�=��i��L��nH�
�<1��9H�5<H�=��i��L��0H�
�<1��JH�5�;H�=��Wi��L��<H�
�B1���H�5�<H�=���/i��L�]<H�
�B1���H�5Y<H�=t��i��L�p>H�
YB1���H�51<H�=L���h��L��>H�
QB1��H�5	<H�=$��h��L��>H�
QB1���H�5�;H�=���h��L��;H�
B1���H�5�;H�=��gh��H�=�1��Yh����H�=�;�X|���H�=�;�G|��L���H�
�@1��!H�5a;H�=|��h��L��;H�
�A1��4H�59;H�=T���g��L�M�H�
�A1��3H�5;H�=,��g��L��BH�
�A1��]H�5�:H�=��g��L�F;H�
@1��1H�5�:H�=ܿ�og��L���H�
�?1��,H�5�:H�=���Gg��L�;H�
A1���H�5q:H�=���g��L��=H�
�@1���H�5I:H�=d��f��L��=H�
�@1���H�5!:H�=<���f��H�=�=1��f��L��:H�
#?1���H�5�9H�=��f��L�y:H�
�>1���H�5�9H�=޾�qf��H�=�1��cf��H�=��1��Uf��L�o:H�
�>1���H�59H�=���-f��L�|0H�
?>1���H�5W9H�=r��f��I�t$(H�=�<1���e��L���H�
$?1���H�59H�=7���e��L��H�
�>1���H�5�8H�=��e��L���H�
�>1���H�5�8H�=��ze��H�=�1��le��L��9H�
�>1���H�5�8H�=���De��L�G�H�
f>1���H�5n8H�=���e��H�sH�=9<1��
e��L�S<H�
�=1��JH�548H�=O���d��L��H�
�=1��H�58H�='��d��L���H�
�=1��H�5�7H�=���d��L��7H�
d=1��KH�5�7H�=׼�jd��L�9H�
<=1��LH�5�7H�=���Bd��L��8H�
L=1���H�5l7H�=���d��L��;H�
�;1���H�5D7H�=_���c��L��8H�
�;1��H�57H�=7���c��L��>H�
|;1��'H�5�6H�=��c��H��H�=P(1��c��L��8H�
S<1��~H�5�6H�=ֻ�ic��H�=(1��[c��L�^�H�
<1��aH�5�6H�=���3c��H�=��1��%c��H��H�=�'1��c��H�=�'1��c���H�=�<�w���VLL�FH�=�<1�H�ID����b��H�=:>1�����9L�6=H�
(?1��>H�5:=H�=��b��H�=�<1��Ѐ��H��H�=>1�����Z:H�==1�����G:H�="=1�����A;1�H�=�<������<��f���8tH�=�>1��g���H�=(?1��Y���H�=�>1��K����=�KLH�5�>��H�=�>1���a���wf���KLH�5�>�8u܅�H�/?H�����HD�H�=C?1��a��L��H�=b&1������^?L��H�=L&1��a��H�=l>1����L�P�H�
A?1��H�5͆H�=Ĺ�Wa��L�߼H�
)?1���H�5>H�=���/a��L�>H�
?1���H�5�=H�=t��a��L��WH�
�F1���H�5�>H�=L���`��L�tfH�
�F1��SH�5�>H�=$��`��L�`@H�
�F1��LH�5�>H�=���`��L�@H�
aF1��7H�5p>H�=Ը�g`��L��>H�
�E1���H�5H>H�=���?`��L�9?H�
QF1��-H�5 >H�=���`��L��>H�
IF1���H�5�=H�=\���_��L��>H�
�E1���H�5�=H�=4���_��L�-?H�
yE1���H�5�=H�=��_��L�A>H�
AE1���H�5�=H�=��w_��L��>H�
E1���H�5X=H�=���O_��L��=H�
�D1���H�50=H�=���'_��L��>H�
�D1���H�5=H�=l��^��L��EH�
�E1���H�5=EH�=D���^��L��EH�
iE1���H�5EH�=��^��1�D��H��H��H�=F��������YH��D��H��1�H�=�E������ZL�
FH�
�F1��ZH�5FH�=���I^��L�FH�
{F1���H�5�EH�=���!^��H�=F1��S|��H�=�E1��E|��L��EH�
'F1���H�5�EH�=J���]��H�=6�1���]��H�=q�1��|��L�:HH�
cM1��|H�5FH�=��]��PXL�8HH�
�K�ZH�5�EH�=޵P1��n]������M�H �p L��H��PL��H�=�H1��J]��H�=��1��<]��L��EH�
�L1���H�5�EH�=���]��H�=�H1��]��L��EH�
�L1���H�5^EH�=K���\��L��EH�
XL1���H�56EH�=#��\��L�'H�
L1���H�5EH�=���\��L��&H�
�K1���H�5�DH�=Ӵ�f\��L�gHH�
�K1���H�5�DH�=���>\��L�EH�
�K1���H�5�DH�=���\��L��DH�
8K1��,H�5nDH�=[���[��L��DH�
�J1��HH�5FDH�=3���[��L��L��L��1�H�=TH�[��L��H�=
H1��[��L��H�=�G1��[��L��DH�
�J1��IH�5�CH�=ҳ�e[����������L�,HH�
-J1���H�5�CH�=���3[��L�,HH�
J1���H�5�CH�=x��[���m����h����c����^����Y����T����O����J���L�	DH�
�I1��IH�5;CH�=(��Z�������������������	�������L�)�H�
I1���H�5�BH�=��uZ���'H�=�B�tn���<H�=�B�cn��L�JH�
�N1���H�5JH�=���+Z��D��H�=J1��Zx��H�=�I1��Lx��H�=�I1��>x����H�=�I1��.x��L��IH�
PN1���H�5�IH�=3���Y��L��IH�
xM1���H�5�IH�=��Y��L��IH�
�M1��H�5_IH�=��vY��L�6JH�
�M1��2H�57IH�=���NY��H�=�I1��w��H�=�I1��rw��H�=�I1��dw��L�VIH�
VM1��H�5�HH�=i��X��L�BIH�
FM1��iH�5�HH�=A���X��H�=aI1��w��H�=�~1��v�����?H�=zJ1��X��L��IH�
�L1���H�5dHH�=��{X�����?H�=mJ1��fX��L��JH�
HL1��)H�5'HH�=���>X��H��1�H��H�=}J�(X����1�H�=�J�X��H��1�H��H�='K�X��L��JH�
�K1��xH�5�GH�=G���W��L��JH�
lK1��wH�5�GH�=��W��H�=(I1�������H�=I1�������L��HH�
�J1���H�5MGH�=ѯ�dW��L��HH�
�J1���H�5%GH�=���<W��L�
LH�
>L1��H�5 LH�=���W��L��KH�
L1��H�5�KH�=Y���V��L�R�H�
�L1��H�5�KH�=1���V��L��KH�
�L1��(H�5�KH�=	��V��L��KH�
~L1��/H�5�KH�=��tV��L��KH�
FL1��<H�5~KH�=���LV��L��KH�
L1��8H�5VKH�=���$V��L�hKH�
�K1��LH�5.KH�=i��U��L�mKH�
�K1��FH�5KH�=A���U��L�LH�
&L1��H�5�KH�=��U��L��KH�
�K1��H�5�KH�=��U��L��LH�
�M1���H�5�KH�=ɭ�\U��L��KH�
�M1���H�5�KH�=���4U��L��KH�
vM1���H�5�KH�=y��U��L��KH�
NM1���H�5hKH�=Q���T��L�]LH�
&M1���H�5@KH�=)��T��PXL�HZH�
�L��H�5KH�=�P1��T��L��H�5DK�S1��[������L�@KH�
XL1���H�5�JH�=���NT��L��KH�
�L1��5H�5�JH�=���&T��L��JH�
(L1���H�5�JH�=k��S��L��H�5���S1��Ȫ���'����8H�5���S1�諪��L�SLH�
eM1��hH�5VLH�=��S��H��H�5iL�S1��m���L�ALH�
'M1��iH�5LH�=ҫ�eS��L�NLH�
M1��H�5�KH�=���=S��L�FLH�
�L1��H�5�KH�=���S��L�LH�
GL1��H�5�KH�=Z���R��H�=�L1���R��H�=M1���R��H�=*M1���R��H�=LM1��R��L��LH�
�M1���H�5�LH�=���R��H�=FM1��R����PXH�=�MP1��jR��H��H�5�M�S1��4���L��MH�
6N1���H�5EMH�=���,R��H��H�5�M�S1����H��H�=�1��E����-�L�QH�
RN1��.H�5�MH�=E���Q��H��H�=Z�1���������;uDD�#H��H�=�M1�A�����H�|$1�A�]L��MH�
�MH��H�n�����H��H�==1�訾���H�=��1��XQ��L��MH�
�M1��H�5�MH�=���0Q��H�3H�=�M1��_����c�H�uH��1�L��H�=OO�B�����H�=V�1���P��H�=H�1���P��H�T$L�L��1�H�L$PH�=XOI���o��H�=�N1�����H�=�1��P��H�t$H�=K1�H��u
�ǽ�����n��H�5�PH�=�P1�訽���C0�k�1�L��H�=�莽�����Z�H�=�P1��x����	�H�=�P1�Z�d���H��H�=�P1��S����Y�H�=JP1��@����O�H�=�P1��-����v�H��H�=mP1������`�L��*H�
�Q1��NH�5
PH�=��O��L�ZPH�
�Q1��jH�5�OH�=��O��L�w*H�
dQ1��iH�5�OH�=ǧ�ZO��L�O*H�
,Q1���H�5�OH�=���2O��L�'*H�
�P1���H�5mOH�=w��
O��1�H�=	P�<������j�H�=0O1��&����6�H�=}O1��������H�����H�=�1��N��L��OH�
VP1��2H�5�NH�=���N��L��OH�
P1���H�5�NH�=Ѧ�dN���T$H��H�=�Q1���艻����H��H�=RQ1��s����H�=��1�� N��L��QH�
"R1��TH�5�QH�=e��M��L��H�=fQ1��'����N
L��QH�
DU1��H�5��H�='��M��L�nRH�
U1��!H�5��H�=���M��L��H�
�T1��$H�5j�H�=ץ�jM��L�RH�
�T1���H�5B�H�=���BM��L��QH�
�T1���H�5�H�=���M��L��RH�
�T1��;H�5��H�=_���L��L��QH�
4T1���H�5��H�=7���L��L�QH�
T1���H�5��H�=��L��L�{RH�
�S1���H�5z�H�=��zL��L�QH�
�S1���H�5R�H�=���RL��L��PH�
�S1���H�5*�H�=���*L��L��QH�
lS1���H�5�H�=o��L��L�nPH�
DS1���H�5��H�=G���K��L�*PH�
S1���H�5��H�=��K��L��PH�
�R1���H�5��H�=���K��L�PH�
�R1���H�5b�H�=ϣ�bK����H�=J��a_��L��QH�
cR1���H�5)�H�=���)K��L��OH�
;R1���H�5�H�=n��K��L��H�
�Q1���H�5�H�=F���J��L��OH�
�Q1��>H�5��H�=��J��L��OH�
cQ1��[H�5��H�=���J��1�H�={�1��yJ��L�ܭH�
+U1���H�5�RH�=���QJ��L�!SH�
�T1��H�5�RH�=���)J��L�RH�
�T1��H�5�RH�=n��J��L��RH�
�T1��_H�5}RH�=F���I��L��RH�
[T1��fH�5URH�=��I��L��RH�
sS1���H�5-RH�=���I��L��RH�
+S1���H�5RH�=�aI��L�~aH�
�S1��uH�5�QH�=���9I��L�zQH�
�S1���H�5�QH�=~��I��L�5RH�
�S1���H�5�QH�=V���H��L�YRH�
�R1��XH�5eQH�=.��H��L�RH�
�R1���H�5=QH�=��H���{H�=%Q�\��L��QH�
�R1��CH�5QH�=͠�`H��L��H�
�R1���H�5�PH�=���8H��L��PH�
:R1���H�5�PH�=}��H��L�W�H�
�Q1���H�5��H�=U���G��L�tQH�
�Q1��sH�5dPH�=-��G��L��RH�
BS1��H�5�RH�=��G��L��RH�
�R1��nH�5�RH�=ݟ�pG��L��H�
S1��+H�5�RH�=���HG��L�5H�
*S1��>H�5D�H�=��� G��L��H�
S1��=H�5�H�=e��F��L��RH�
jS1��)H�5�RH�==���F��L��
H�
bS1��GH�5�RH�=��F��L��!H�
�R1��YH�5�RH�=��F��PXL�/SH�
 Y�~H�5�UH�=ŞP1��UF��L��UH�
gX1��IH�5aUH�=���-F��L��RH�
?X1��JH�59UH�=r��F�����L�eUH�
�X1��zH�5UH�=E���E��L�$UH�
�X1��yH�5�TH�=��E��L�U�H�
rX1���H�5�TH�=���E��L��RH�
Y1���H�5�TH�=͝�`E��L��RH�
�W1���H�5lTH�=���8E�����L��TH�
�W1��H�5?TH�=x��E��L��TH�
�W1��H�5TH�=P���D��L�TRH�
eW1��H�5�SH�=(��D��L�TTH�
=W1��H�5�SH�=��D��L�$RH�
W1��0H�5�SH�=؜�kD��L�EMH�
MW1���H�5wSH�=���CD��L��SH�
%W1���H�5OSH�=���D��L�gSH�
�V1���H�5'SH�=`���C��L��SH�
�V1���H�5�RH�=8���C��L��SH�
�V1���H�5�RH�=��C��L��SH�
�V1���H�5�RH�=��{C��L��SH�
}V1���H�5�RH�=���SC��L��QH�
�V1���H�5_RH�=���+C��L�<QH�
mV1��1H�57RH�=p��C���~���L�GH�
@V1��'H�5
RH�=C���B��L�OQH�
8V1���H�5�QH�=��B��L��FH�
V1���H�5�QH�=��B��L��PH�
�U1���H�5�QH�=˚�^B��L�7PH�
�U1��^H�5jQH�=���6B��L��PH�
�U1���H�5BQH�={��B��L�NRH�
�S1��H�5QH�=S���A��L�ARH�
�S1���H�5�PH�=+��A��L�XRH�
�S1���H�5�PH�=��A��L��PH�
xS1���H�5�PH�=ۙ�nA��L��QH�
PS1���H�5zPH�=���FA��L��QH�
S1��gH�5RPH�=���A��L��PH�
S1���H�5*PH�=c��@��L��QH�
xR1��xH�5PH�=;���@��L���H�
PR1��aH�5�OH�=��@��L�wOH�
�Q1���H�5�OH�=��~@��L��OH�
�Q1���H�5�OH�=�V@��L�QH�
hQ1���H�5bOH�=���.@��L��OH�
@Q1���H�5:OH�=s��@��L�OH�
�P1���H�5OH�=K���?��L��SH�
W1���H�5�SH�=#��?��L��UH�
�V1���H�5\SH�=���?��L�UH�
�V1���H�54SH�=ӗ�f?��L��SH�
�V1���H�5SH�=���>?��L�7UH�
xV1���H�5�RH�=���?��L��TH�
PV1���H�5�RH�=[���>��L��RH�
(V1���H�5�RH�=3���>��L�LSH�
V1���H�5lRH�=��>��L��RH�
�U1���H�5DRH�=��v>��L��SH�
�U1���H�5RH�=���N>��L�5RH�
�U1���H�5�QH�=���&>��L�
RH�
`U1���H�5�QH�=k��=��L��YH�
8U1��/H�5�QH�=C���=��L��QH�
U1��.H�5|QH�=��=��L��QH�
�T1��6H�5TQH�=��=��L��RH�
�T1��mH�5,QH�=˕�^=��L�EQH�
�T1��TH�5QH�=���6=��L�QH�
pT1��\H�5�PH�={��=��L�?SH�
HT1���H�5�PH�=S���<��L��PH�
 T1���H�5�PH�=+��<��L��PH�
�S1��eH�5dPH�=��<��L��QH�
�S1��gH�5<PH�=۔�n<��L�UPH�
�S1��lH�5PH�=���F<��L�&H�
�S1��-H�5�OH�=���<��L��H�
HS1��H�5�OH�=c��;��L��OH�
 S1��H�5�OH�=;���;��L�|PH�
�R1��H�5tOH�=��;��L��H�
�R1��H�5LOH�=��~;��L�EOH�
�R1��H�5$OH�=�V;��L�PH�
pR1��H�5�NH�=���.;��L��OH�
(R1��:H�5�NH�=s��;��L��H�
R1��9H�5�NH�=K���:��L�oVH�
�Q1��GH�5�NH�=#��:��L�qOH�
�Q1��FH�5\NH�=���:��L�VH�
�Q1��&H�54NH�=Ӓ�f:��L�/OH�
pQ1��%H�5NH�=���>:��L�H�
HQ1��$H�5�MH�=���:��L��UH�
�P1��RH�5�MH�=[���9���`H�=9Q��M��H�=�R1���9��L�SH�
!S1��H�5�RH�=��9��L��RH�
�R1��
H�5�RH�=��9��L��D����1�H�=FQ�i9��L��D��H�=�Q1��U9��H�=5R1��G9��L��D��H�=BQ1��39��L�zSH�

T1��eH�5~SH�=x��9��H�5>S�S1��؏��L�hSH�
�S1��+H�5CSH�==���8��L�PSH�
rS1���H�5SH�=��8��H�=�1��8��L��SH�
�S1��5H�5�SH�=ߐ�r8��L��SH�
�S1��6H�5`SH�=���J8��PXL��H�
zS�H�5�]H�=��P1��8��L�GSH�
�S1��KH�5
SH�=d��7��L�SH�
9S1��zH�5�RH�=<���7������{����P<���8tH�=US1���U��H�=�S1���U��PXP�=e47tH�=KS1���U��H�=TS1��U������H�=�S1��U��L�QSH�
FT1���H�5NSH�=���<7��L�ESH�
T1���H�5&SH�=���7��L�	TH�
T1��^H�5TH�=Y���6��H�=
T1��U��H�=�T1��U��H�t$H�=�T1����鄊
H�=�W1���T��H�=�1��6��H�s8H�=[T1���T��H�=�T1��T��H�=�S1��T��L��SH�
�X1��H�5�SH�=���F6��L��H�=�S1��uT��L��H�=�V1��dT���:���8u%H�sH��t*H�=�V1��CT��H�=<W1��5T��H�=�S1��'T��H�5�g��H��H�=�T1��
T��H��H�=U1��S��H��H�=�T1���S��H��H�=�T1���S��H��H�=�T1���S��H�=2W1�Z麢��H�=KW1�謢��邔
L��TH�
yW1���H�5�RH�=���?5��H�=8W1����n����̔
H�=�T1��[S��H��H�=�W1��JS��H��H�=PW1��9S��H��H�=�W1��(����ݕ
H��H�=�W1������'�
1�H�= X������q�
1�H�=�W�����黖
1�H�=�W�ӡ������
1�H�=�W轡�����O�
D��L��H�=�X1��R��L��H�=�X1��R��L��H�=X1��R��L��H�=]X1��nR��L��H�=2X1��]R��L��H�=X1��LR��L��H�=�W1��;R��L��H�=fW1��*R��L��H�=�W1��R��L��H�=^W1��R��L�t*H�
�X1��H�5�XH�=
��3��L�H�
b\1��H�5�XH�=��x3��L��XH�
\1���H�5�XH�=���P3��PXL��XH�
P[�H�5�XH�=��P1��%3��L��XH�
\1��MH�5/XH�=j��2��L��XH�
�[1��?H�5XH�=B���2��L��XH�
�[1��@H�5�WH�=��2��L�.�H�
[1���H�5�WH�=��2��L��H�
�Z1��*H�5�WH�=ʊ�]2������L��WH�
zZ1��lH�5bWH�=���02��L��XH�
RZ1��pH�5:WH�=u��2��L��XH�
�Y1���H�5WH�=M���1��L��XH�
�Y1���H�5�VH�=%��1��L��XH�
ZY1���H�5�VH�=���1��L��XH�
"Y1���H�5�VH�=Չ�h1������L�WH�
�X1��
H�5mVH�=���;1��L�tXH�
�X1���H�5EVH�=���1��L��VH�
�X1��H�5VH�=X���0��L�{VH�
]X1���H�5�UH�=0���0��L��VH�
X1��0H�5�UH�=��0��L��YH�

Z1��&H�5�YH�=��s0��L�T^H�
�^1���H�5�]H�=���K0��L��]H�
]^1���H�5�]H�=���#0��L�\]H�
5^1���H�5Z]H�=h��/��L�4]H�

^1���H�52]H�=@���/��L�:]H�
�]1���H�5
]H�=��/��L�T]H�
�]1���H�5�\H�=��/��H�=<_1��M��L�>_H�
W_1��H�5:_H�=���M/��L�f_H�
�_1��H�5.�H�=���%/��L�%H�
W_1���H�5�H�=j��.��L�'_H�
/_1���H�5�H�=B���.��L���H�
o_1��SH�5_H�=��.��L�_H�
G_1��TH�5�^H�=��.��L��^H�
_1���H�5�^H�=ʆ�].��L��^H�
�^1���H�5�^H�=���5.��L��^H�
�_1��3H�5�^H�=z��
.��L��^H�
O_1��hH�5�^H�=R���-��L��^H�
_1��H�5�^H�=*��-��L��^H�
�^1��*H�5j^H�=��-��L���H�
7_1��5H�5_H�=څ�m-��L�i�H�
�^1��FH�5�^H�=���E-���CH�=�^�DA��H�=��1��&-��L��^H�
x_1��QH�5�^H�=k��,��1�L��H�=z�1���,����H�=�^��@��L��"H�
�a1��'H�5P_H�=��,��L�)_H�
�a1�� H�5(_H�=���,��L��H�={�1��y,��L�3^H�
[`1���H�5�^H�=���Q,��L��^H�
S`1��H�5�^H�=���),��1�L��H�=��1��,��1�H��H�=��1��,��L��^H�
�_1���H�5y^H�=H���+��L��]H�
�_1���H�5Q^H�= ��+��H��H�=��1��+��L��^H�
t`1��OH�5^H�=��z+��H�=n�1��l+��L�E�H�
.`1��^H�5�]H�=���D+��H�=8�1��6+��L��]H�
�_1��_H�5�]H�={��+��L�!H�
�_1���H�5�]H�=S���*��L�^H�
�_1���H�5\]H�=+��*��1�H�=��1��*��L���H�
@_1���H�5$]H�=��*��L�[]H�
_1���H�5�\H�=˂�^*��L�J�H�
�^1���H�5�\H�=���6*��H�=*�1��(*��L�]H�
�^1��
H�5�\H�=m��*��L���H�
b^1��H�5v\H�=E���)��L���H�
*^1��1H�5N\H�=��)��L���H�
�]1���H�5&\H�=���)��L�a�H�
�]1���H�5�[H�=́�`)��L��H�=Q�1��O)��L��\H�
!]1���H�5�[H�=���')��L�\H�
�\1���H�5�[H�=l��(��L�ЇH�
�\1��H�5MNH�=D���(��L�^H�
�^1��yH�5^H�=��(��H�=^1���F��H�=P�1���F��L�
^H�
u^1��CH�5�]H�=؀�k(��L��]H�
-^1��mH�5�]H�=���C(��H�=��1��5(��1�H��H�=1^�d������#H��H�=��1��K�����$H�T$L��H�=�_1��0F��L��H�=��1�1������,H�=1�1���'��L��H�=�1�����*L��H�=��1��������+PXL��_H�
K`��H�5�_H�=�P1��p'��L�Y?H�
r`1��/H�5�_H�=��H'��L��_H�
J`1��LH�5�_H�=�� '��L�PdH�
�e1��1H�5RdH�=e�&��L�1cH�
�e1���H�5*dH�==��&��L��dH�
Re1��\H�5dH�=�&��L��XH�
*e1��mH�5�cH�=�~�&��L�~dH�
�d1��}H�5�cH�=�~�X&��L��dH�
�d1���H�5�cH�=�~�0&��L�HdH�
�d1���H�5bcH�=u~�&��L�RfH�
jh1��KH�5IfH�=M~��%��L�dfH�
"h1���H�5!fH�=%~�%��L�MfH�
�g1��H�5�eH�=�}�%��L�a�H�
bg1��H�5�JH�=�}�h%��L�fH�
Zg1��H�5�eH�=�}�@%��PXL��H�
Hi�H�5�JH�=�}P1��%��L��hH�
i1���H�5hH�=Z}��$�����L�hH�
�h1��9H�5�gH�=-}�$��L��gH�
�h1��H�5�gH�=}�$�����SH���Ӝ��H�t
7�9u��[�f�1�[�ff.����SH���A����=_)7H��tV�(��R��H�=)7�(H�1)7H�H�)7H�PH�RH�X H�PH�@�"H��H��	7��H�
[�f��`���=�(7u�����H��裔��H���f.�@H�=� 7H�� 7H9�tH�7H��t	�����H�=a 7H�5Z 7H)�H��H��H��?H�H�tH��7H��t��fD�����=5 7u+UH�=�7H��tH�=>�6�y����d����
 7]������w������ATI��USH��H��pH��dH�%(H�D$1�H���be��H�������1�H��@���G����I�$H�ChH��t
H�H�{h�PL�%�
7H�sXI�<$H��t
H��P I�<$H���H�CXH��t
H��P I�<$Hǃ�H�H��P ��H�T$dH3%(u+H��[]A\ÐH���d���H�<$�>���H��H����L�����>��f.���SH��H����\x��H��tH��	7H��[H�8H�H�@ ��[�ff.�AWL�=,yAVI��AUATU1�SH��H��L��H���5���I��H��teA�|$.M�l$uI��A�}.t�H����L��H��H��H)��[k��A�E</�������L��H���6k��I�\$��H��t!H���K<��H��H��H���
k��H���%1��H�ùH�=nxH����������H�=XxH��������6���H��H�SL��[H�=9x]A\A]A^A_����D�H�5xH���j���Q����H���;��H���@���H������H��H�C[]A\A]A^A_�ff.�f���AWAVAUATUH��SH��XL�/H�T$H�L$dH�%(H�D$H1�H�GXH�D$4�D$<�D$0L�pH�I�L9���H�D$(H�D$�\f�I����L���4��H�D$(H�sI��H��H�4$��:��H�4$L��H����z������H�|$賋��H��I9��}H�sH�}���I�ċ��t��t���u��Қ���I���1�L���3��H��H�D$(��z����y�H�|$(�S��L��H�=�vH��1��p���H�|$(H�D$8�1����D$0����H�EPH��t
H�H�}P�PH�D$H�|$0H�t$��H�D$HdH3%(u.H��X[]A\A]A^A_�fDH�|$(�&S��L��H�=2vH����b;��f���AVAUATUS���
�������R������!���H�p7I��I��I����H�8H��PL��L� H���[����k`��H�=�uH�CX�7��L��H�ChI�>�T���I��$�1�H���Bg��H�CpH��[]A\A]A^�f���AWH��H��M��AVM��AUATUH��SH��H��HH�8dH�%(H�T$81���H���1�H�l$0H��I����1��� H��H�D$�)\��H��H�D$ �L��H�|$ �"m��H��H�\$(H�p��`��I��H�|$ 1�H��H��輍��������K�����~-H�t$(H�T$0L���+g��H�t$0H�|$ �l(���f.�����9���H�|$ �G��ts�L$1�I��t �c��L��H�=�tH��1��/����L$I�H�|$ �L$���H�|$����L$H�\$8dH3%(��u$H��H[]A\A]A^A_�L���,���I���A9�����AVAUATUSH��0dH�%(H�D$(1�H���t&1�H�L$(dH3%(�SH��0[]A\A]A^�L�/H��H�pH��I���A��H�EH����H�{XH��1�1��N]��I��C`ueH�{hL�sxH��P0H�CH�Shf�H�;H�t$L�L$M��L��D$H�D$���������L�m�M�4$�E���f�H�CxH�E��&���f.�H�t$H�{p��]����x>H�sXH�������H�{�x���I���1�H���gd��L��H��H��H�Cp�������H�|$�&��H������f.�L��H��H���r�������7�����AT�I��H�=�rUS�3���hH��H�H��PH��L��H��H����?��H��[]A\�f.���AWI��AVM��AUI��ATUH���:SH��H��H��xdH�%(H�D$h1��B:��H�5�KH��tH��H��I���hx��I�t$H��I�f�H�T$M��H�L$H��)D$ )D$)D$0)D$@)D$PH�D$ �h������H��7��H�8H��P�o�oSP�o[ X �oc0`0�ok@h@�osPpP�o{`x`�oKpHp�o�����o�����o�����o����H���H���H�T$H���I�E1�H�L$hdH3%(uH��x[]A\A]A^A_�����������5��@����7�P��7��~	��H��H�=��6�08��H�=��6�$8��H�==�6�8��H�=i�6�8��H�=��6�8��H�=Y�6H����7�����j7���a7��~	��H��H�=M�6�Џ��H�=Q�6�ď��H�=�6踏��H�=��6謏��H�=E�6蠏��H�=�6H��鐏����AUI��ATI��USH��8H�wH�?dH�%(H�D$(1�H�l$ H�\$����H��H�D$��G���H�D$�
(��H�D$�H�T$ �t$H�|$�B�������H�|$H��H���u�����������H�|$L���^m��H�|$���2����u.H�D$I�EH�L$(dH3%(��uH��8[]A\A]��H�|$�&!������3��ff.�@��1�H��t-�?t H��H�5�H�d��H����H���D����SH��H��8��{��H�H��tH�H��[H�@��fD[�fD��AUATUSH��H��(dH�%(H�D$1�L�d$H�l$DH�{L��H���Q�������H�sh�D$H��tt��wH�;H��P H�ChH�{�
3���H�{XH��tgH�s`�fe��H�S`1�H��I���%>��H�ChI�EH�t$H�ChH�;�(h��I�E�o������u|H�t$H�;�h��H�Ch�N���fDH�;�@H����U��H�C`�H��H�CX�m����ufH�D$dH3%(��H��([]A\A]��H�{(�/O��H�t$H�{�1k��H��nH�D$H�{ ���H�t$H��SP��H�{(��N��H�{ ���H�{��tH�C H�8u�@��t-H�t$��j����uH�D$�H�|$u��q����H�t$�j��H�D$�s����s1��SH�GpH��H���a���H��H�sxH�Cp��H��[���D��H��8f�dH�%(H�D$(1�H��H�n)$)D$H�D$���H�D$(dH3%(uH��8���0��ff.�f���SH����QH��0�wdH�%(H�D$(1������������H�0H����H�{ �Y��H�;�H����S��H�C`H�{ H�CX�C��H�{ I��H�
�6H�CH����H�5�lH�CP�J��H��H�C(�W��H�D$(dH3%(u}H��0[Ðf�H�G)$)D$��'#v7H��H��H�D$�w����D1�H�=�D�B���H�C �<���f�H��H�=�a1��?~��H��H��H�D$�/����s����/��D��AW���Qf�AVAUATUSH��HdH�%(H�D$81�����)D$)D$ ���B����n���I��H��tDH�t$I�EXH�t$L��H�D$���H�D$8dH3%(�,H��H[]A\A]A^A_�fDH�GXA��L�|$H�L�pI�L9�u@��H�5�kH���Q����uH�kH�5�kH���:����uvH��I9�tJH�+H�5�kH�������u��D$H�{L���z����x_H��6�D$H��HH�D$ I9�u�A��t]1��D$(��	ЈD$(�����H��H�=fl1��|��H�D$���H�sH�=l1��|��H�D$��H�|$u�����-��ff.��AWAVAUI��ATI��UH��SH��H��8H�D$pL�t$xL�$H�D$��$��D$dH�%(H�D$(1�M���I�L��L�D$���PL�D$L�`I��L�H�hpL�hxH�;�m[�����I�GH�T$M��H�
R���H�4$H�8����I�WI�G�z`t.H�SH��tH�5>jH���@7��f�{��f�{8�JM��tH�4$�H�=Mj��������|$I�ouCI�GH��p\�,f��I��5��H�L$(dH3%(L���xH��8[]A\A]A^A_�DH����!��H�x(u�A�D$X��u�H�3H�=�i1���z��I�H�5o[H���|6��I�o�x���M��H�
����1�H�5�h�cG��I�G8�g���f.�I�vI�>�d~��H�MjH�5ciH�D$ I��6��I�H�t$ 1����H�|$ �
���|$I�o���2���f.��sdH�T$ H�{8�n9���������I�H�T$ H�5�h�5�����@�H�=�h����I��������s`H�T$ H�{�9�����9���I�H�T$ H�5kh�Y5�������+��ff.�@��AVI��AUI��ATUH��SH�����ރ���'H�5ZiH��I���W��H�uL����}��H��L��L��jH��H��L�
hjE1��s ����H�� []A\A]A^����AWI��AVI��AUATUH��SH��H���GX������uBH�GE1�E1�L�
�gH��M��L��L��jH��H��ATP�T���H��([]A\A]A^A_�D����H�="g�v��H�}I���J(��L��H�p�P���H�5�gH��I���V��H�uL����|��H�CL�
(g�j����@螂��L�kI��L����'��L��L��H���V��H�uL���|��H�C(�8u,H�C0�8uLL��E1�E1����L�
�f����f��H�5�fL���\V��H�s(L���@|��H�C0�8t�L��H�5�f�3V��H�s0L���|��뒾9H�=�e� ��@��AWI��AVI��AUATI��UH���@SH��踁��L�mH��L���	'��L��H��H����U��I�4$H���{��H������H��L��L��jL��H��L�
fjE1�P���H��([]A\A]A^A_�@��AWI��AVM��AUM��ATI��H�=XeUSH��H�4$�H�L$�����H��H���N���H�5�eH��H���!U��L��H���{���
H�5�eH���U��H�L$H��H����z��I�D$(�8uXI�D$0�8uyI�D$8�8��H��I��L��L��jL��L�
�dSA�t$H�t$ ���H��8[]A\A]A^A_���H�5�dH���|T��I�t$(H���_z��I�D$0�8t��H�5�dH���QT��I�t$0H���4z��I�D$8�8�f���H�ߺH�5�d�"T��I�t$8H���z���@�����SH�H�H�{�x��H��[��f.�DSH�����H��H�����H��t�P���tH�@([�fD1�[�ff.��AVH�5qeAUATUH��S��8��H�\�;u[H��]A\A]A^�H��I���$��H��I���*��L��H��H��I���IS��M9�sQL�L�-e�%��H�5eL���S��H��H9�t �3@��%t*@��/t�L��H���8J��H9�u�[L��]A\A]A^����L��L����R���ff.�UH��SH��(dH�%(H�D$1�����H��1�H��tH��H���-����u)H�}�x]H�L$dH3%(uTH��([]�fDH���#��H�L$H�T$H��H���e����tH�D$H��xH�E��f.���������$��@UH��AWI�ϹAVI��H�=�cAUATM��SH��H��H����H��L����dH�%(H�E�1���������H�=�cH����������H�=�cH��������H�=wc�}G��I��H�
�^E1�H��1�H����H��M���H��I�~HH���H��H������=�����GH���H�� ���H�PH�0L��H���v��M�4$L���+"��L��H��H��H�E��P H�E��H��H�5K^�P M�t$L���!��L��H��H��H�E��P A�EH��H��H��H��H��H���H)�H��H9�tH��H��$�H9�u�%���H��H����W��I�\$H���!��H�=��6H�ھH���!:��A�UH;P�cH�0H���������P1�H�]�dH3%(��H�e�[A\A]A^A_]�@H�=�a�E��I���z���@H��L�}7M��1�jH����L��H��H�=2]�G��f�HDž���H����XZ)�����'��I�~@L����H�����H����L������H���9l��������H������H���| ��H�=m�61�H��H���9��H�xt|I�~HH�����H��H�����Gu��H����H������@H�=�`�E��I�����@H)�H�L��j���f.�H����H�aH���������H����H��`H�������|���H��L��H�=�`1���o��H����H�������T���H��H�=t`1��o��H����H�������/����!�����AWAVAUI��ATUH��SH��H��H�5�[H��L�D$dH�%(H��$�1��x��H�{@H�D$����A�EH�|$��}���D$0���O	H�D$L� L������H�=(�6L��H���7��H�x�	L�t$HH�T$H��L���H
�����_	L�|$HH�51`L�����L��H�5#`I���z���I��M����	L���vK��L��H�$�'��L��I���/
��A�EM����A�?��L���o���H�D$ H�D$L�hL���)��H�=b�6L��H����6��H�L$PH�T$H��H��H�L$(��������L�d$PH�5�L������1�I���QC��I��M����H�T$hH�5�_L���������H�T$`H�5�_L��������	��L�l$`H�T$XH�5y_L���~�������H�D$`��L�l$XI9��HL;l$h�L��H�5�_�#���H�{PI��H��tH�?tH����H���������qL������H�5�_H�����H����P�������sH�x(H�S(H��t'�:t"H�����C��H�s(H��������aH�58_L�����L�k8I��M����A�}��H���kH�5_L���=0��H�5_L��I���+0��I�7H���TH�\$L��I���f�H��H�3H���0L���HM����u�L��L��H�=�_1��0l��H�\$H������H�|$(�
��H��$�dH3%(���H�ĸ[]A\A]A^A_�H�|$`�*���� ����H�T$XH���7���I9���I9��3���H�D$H��]H�������w����L�p �@��u��I��M��u;f.�L���(��H���a����	L���3A��L��L���l��M�vM��t�A�F���t�I�}M�~(t���fDH�\$H�5�]L��L�-\����H��tH�����I��H�4$�H�=b]������VL�5QiH�4$�L�������t:H�4$�H�=oY�����tH�4$�H�=yg��������@������H�4$�L�������tZH�4$�H�=Y�������H�4$�H�=g�������{���D$4�D$0�f.��D$4H�$�H�= ,H�PH����������H�=ZZH����������H�=�+H���������H�4ZH�D$8H�D$L�pL���I��H�=��6L��H����1��L�D$ E1�L��H�
cUH�$I��1�H���??��H�{HH�T$pH��I����8��H��$�H�T$����H��L�S/L��1�jL�L$0L��H�=
UH�L$��>��f�HDŽ$�)�$�I��XZ����H�{@L�L$L��H�t$L�D$xH���d�������HH�t$xH��$�H��$��Z�����cH�{HH��$�L���f��H��$�H�D$pH�D$1�H�5_TH�PH�81��>>��H��H�����L�|$H��I��AW�D$8P�t$(A�v�T$TH�t$XH��$�M����H�� ��uX���������fDH��XH�D$ �m����H�aXH�D$8�5�����D$4�D$0�����$�uIH�WZI��f.�L�L$L�D$L��H��H�L$ H�$�����b���H��$�H�D$H�}���L��I���	���H��$��<���H�����H���;��H�t$�H��H���E��H�CH��H������H����x��H�1��H��L� ��S��M��u\���I�<$t>H�uH�}�J��H�U1�H��I���[#��I�4$L���oM��L��I�I�t$(�_M��I�FM�d$M���m���A�|$u�I�D$ H�t$�H��H��$���D����@1�����f�H��VH�D$8����H�C(H���<����8�3���H�D$H�
�X�����H�����f�H�D$H�
!W�����H������L���j���H�=XH��1��e��H�\$H�������w����H�D$H�
WH�������a����H�D$H�
�W�����H��7����H�5aVH�bVHE�H�=�V�H�D$H�
W�����H����H�D$H�
uVL�������H�������H�D$H�
�V�����H�����H�4$H�=pW�"���H�D$H�FWH���������H�D$H�jVH���������H�D$H�
kV�����H��g���H�D$H�
�V�����H��N���H�D$H�
zW�����H��5���H�T$ H�4$H�=U1��>d��H�\$H��9���H�D$H�
eW�����H����H��$�H�=�V�d��H�L$H�����b��f���U��H�=�WSH���U���H��H�H��PL��6H�޺H�H�
K�6H�xH�����H��H��[]�D��USH��H�/H�H��tOH�]H��tfDH�{t	H�{�Hi��H�[ H��u�H�}�FX��H�EH��tH�H��H�@H��[]��H��[]Ð��H��t)SH�H����a��H��tH�@H��tH�1�[ø����[ø��������H��t6SH�H���a��H��tH�@H��tH�xt
H�1�[�fD�����[ø�����ff.���H����AUATI��UH��SH��H��H��'a��I��H��t/H�x�Fh��I�}M�eH��tyH��1�[]A\A]����H�;�(H��PH�;H��I����H��M�eI�EI�EH�CI�E H��tL�hL�kH�{L��I�uH��[]A\A]�@��DH��[]A\A]�D�ff.�@��H����AUI��ATI��USH��H��H��G`��H��H��t?H�x�fg��H�}H����1�����H�}I�T$I�4$H��[]A\A]��?��fDH�;�(H��PH�;L��H���H��H�EI�t$H�;�3-��H�EI�T$H��I�4$�?��H�EH�CH�E H��tH�hH�kH�{H��H�uH��[]A\A]�?�����H�;I�t$��,��H��H�E�A���ff.�@��H����ATI��UH��SH��0_��H��H��t~H�xt	H�x�Hf��H�SH�C H��tKH�B H�C H��tH�SH�PH�C H�CH�}L���0����1����1r��[]A\�f�H9]u�H�EH�C 뭸����ø������L�1�A�	D�A�A��	wMUL��S1�H��f�H�����\Y�H��D�A�A��	w-��v�uA��v�H�������[]�f���H��H��H��tL)�L��H���=���]H���[]���UH��SH��H��H�7H��H�UH�U���H�EH�H�] H��[]����AWE1�AVAUATUSH��H�_H;_ �(I��H���"m���I��H�H��Pu��-��@��_������M������i��H�]I��H9] ���3@��.��f.�I�@��Bu@��-��@��_������DM��tL���+4��H�]H��H��H�]H;] ���PI�H��Puʀ�-��@��_����t�@��.ukM��t�.L����3��H�]H��H��H�]H9] v�p@��.�V���H��QA�����H�EH��D��[]A\A]A^A_�@��.t�E1��M���DA�M��t�L���M��I�$��H��QA�����H�E�@��AWAVAUATUS1�H��HH�4$dH�%(H�D$81�H�GH;G s�8[t)H�L$8dH3%(���'H��H[]A\A]A^A_�@H��I��I��1�H�GH��t���ag���[H��H���2��M��tA�D$f�A$I�FL�|$H���D$L��H��H�D$���������\$A�I�FI;F sO�8.��H��t�.H���N2��I�FH��H�|$L��H��I�F�r��������D$���A��u�ˉ\$M��t�A�\$fA�$I�FI;F �:�8]�L�<$H���I�FM��������]H����1��H�����I����f��
H�<$H���M�V M�~M9���L�T$��i��L��E1�L�T$�@@��-u-H��I�VI9�t�2L�A�qt�I��H��I�VI9�u�L��M��A��I9���A�uKI�PI�VH��tL)�L��H����9��I�VM�V I9�v	�::��H��O�����I�F����DM�~��f.�H��O�����I�F���H��O�����I�F���H�O�����I�F�r�����e���[H��H���n0������f�H���8���H�5�NH�x�h����H�<$�1I�F�:H���#0��I�^I�~ H9���L���6�fA�@��H�C�D�2H��fA�ptH��I�FH9�u�H9���H�<$tH)�H��H���v8��E�������I�vf�H��L�l$ )D$ H)��Z��L��
H���p-����~cM���s���foL$ �
fA�$AL$�X����I�FH�<$A�H�XI�^�������H��M�����I�F����H��M�����I�F���H�߻��������H�=�MH�p1��Y��I�F�����g
�����ATE1�USH�GL�G L9�s�8"tD��[]A\�H��H�pI��1�H�wH��t��c��M�D$ I�t$H��L9���L9���H�=0�6�H�F�Wu�fD�
H���Ot
H��I�D$I9�u�H��tH)�H����6��M�D$ I�T$L9�sR�<\upH�BI�D$I9�v}�JH���6H��J�tiH��tH����-��I�D$M�D$ H�pI�t$L9��M���H�^MI�D$A�������fDH���j���<"t1H�
MI�D$A���������H��LI�D$A�����[D��]A\�H��I�T$A�H�������H���#���H����ff.���US1�H��L�WL�G M9�spL�
��6A�A�At^I�RH�WI9�v2A�BA�At&I�B�fD�
H��A�ItH��H�GL9�u�H��tH��H��L��L)���W��H�EH����[]�ff.���UH��SH��H�������tH��[]�H��H��H��[]�o?��ff.�@��L�GL�O 1�M9��!ATI��UH�-��6SA�H���DMu	��+��M9��$A�I�@�DUu����
H���DM��H��H�CL9�u�M����L)�L��L���{4��L�CL;C ��A�8+��I�@H�CA�@<0rb<9���P���wR��7I�PH�SA�p@��0r<@��9vv�V���w.���D�I��L�CM��t��L���?+��L�CL�K ����f�H��JH�C�����[]A\��L��@M���>���L�C�Q���fD��0�q������D�됸���AUATUH��SH��8dH�%(H�D$(1�H�H�H��t�?H��u,H�
H�E1�H�L$(dH3%(uoH��8[]A\A]�@I��I���
��L��H��H����H��L���4����x(�H�L$ H9L$s�H�:LI�$������DH�D$I�$�����������H���hAWAVI��AUATI��H��USH������I�,I9�sTI�D$L�=��6�$H�D$H�z�6D�(L���fE�,Wt6H��H9�w�H��L��L��L)��T2���<$��H��[]A\A]A^A_�I��M)�<$uH9�wL��L��L���2��H9�v��<$��e���H�
H�6H��A�Wf���e��H�
p�6f�tsL��L�s�)���$L9��L���H��L��"[]A\A]A^A_��(���H�t$L��H��L�$����L�$L��L��L���y1���j���@�\L���(���3�x����f.���AVAUATUSH��0dH�%(H�D$(1�H��t�>H��u+�H�L$(dH3%(��H��0[]A\A]A^�DH��A��I��I���W��L��H��H����H��L�������xZH�D$ H9D$r6E��u�H������H������H;Et�H�\JI�$������p���fDH�JI�$������U���H�D$I�$������?����(�����H�H�H��t�?uH��H���@AUATI��UH��SH���H����[��1�H��H��H��I���@C����~L������I�$�H��[]A\A]���AWAVAUATUH�,SH��H9���H���6L�-��6I��L�5>ID�8DH��D�fE�|Et-H��H9�w�H��H��L��[H)�]A\A]A^A_�X/���H��L��H)��B/��H9�v�L��L��1��=<��H�sH9�w�H��[]A\A]A^A_�D��AUA��ATI��UH��SH��8dH�%(H�D$(1�H���Q��H��L��H����H��H�������u9E��u'�����H�L$(dH3%(u=H��8[]A\A]��1�H��H���4����~�H�T$1�H;T$ s�1��: ������8�����USH�����t/H����]��H��f�H���]��t�Xu�H��1�[]�DH���[]�@�����t.H�n�6�
H��6f�Bu�@f�BtH�����u�Ð1��ff.�f���H��tGSH��H�?H��u�)f�H��H�;H��t��?����u�[�f��[�f���f.������tE< t&H���6�
H�P�6f�BtH�����t< u��G��tH��< u�1�����f.���AVAUI��ATUSH��@dH�%(H�D$81�H�H�H�H��t�?H��u;H�_FI�E�����H�t$8dH34%(�;H��@[]A\A]A^�f.�I��H������H��H�|$H���E�L�t$(H�\$0I9�s|��[��H�0A��FtjI�VH�T$(H9�v5A�N�Nu��-u%I�Ff�H��H�D$(H9�t�H���Nu�-t�H�|$L���DV��L�t$(I�$L;t$0��A�> tH��EI�E���������DH�|$I���H�����L�t$(��!��H�T$(H�L$0H��H9���L�d$�3�H���6�BH���6f���H�D$(H�PH�T$(H9��~�< u�H�BH9����z ��H�|$L���sU���L��H��H�D$�+��H�D$(H�L$0L�pL���H�|$�H��PH�E��/���f.�H�|$L���U��H�t$�H��H�D$�*���H����/��H�H�{�n^��H�H�E�����@H�YD���@H��D����'������AUI��ATI��UH��SH��H��tI�}L���X���A�$E1�L�<uA�T$A�I��L��1���"udI�\$�H9�wZA	�E����H��tH��L���>��H�EM��tI�]1�H��[]A\A]�f��� �����H��H9�v��@��u��"tH��>u�@��txH�sH9�v_�KH����\u�H�KH9�tE�{v?H�{H9�t6�KH����"u�H��H9��G����1��@@���3���H�sH9�w�H�������[]A\A]�H��tH��L���6=��H�EM���#���H��1�I�]����f.�AT�A��UH�o(SH��H��dH�%(H�D$1��GH����HD�����u��H��H�������tK~,H�kH�K H9����E<@��A�����H�|$dH3<%(��H��[]A\�H�K H�{H9�v�H�5�6�L�"�6D���fE�pu��.u�H�wH�sH9�v;�WfE�Pu��.u+H�GfDH��H�CH9�tD�H��fG�Hu�A��.t�H���^H)��J��H�EH�kH�K H9��)����A���4���H�x�H�C������$����H�w�>"����H�o@H���6H�E�H9���}�@u��fD�8@�_H��H9�u�H9���H���6L��6�H�M�6fH���DH��H9����fA�Pu�H��BH�C���������@H����CHH��H�kH�k0HD�H��������O���1�H��H���,�����:���H�CH;C ���CHt	�8>��H�AH�C���������DH�k��������H��fD�CH��H�kH�K ������u\H�{H��H���=�������CHH�,$��H�k@�CH�t?H;k��Y��H��H�sH�k@�~���@H������H�G8A�� HE��f�H�s�Q����H�;H����O��H�C(�^���H�(@H�C������*���H���R����CH�����<>�|��������#���H��?�KHH�C�����ff.����H���,AWAVAUATUSH��(L�&M���H�GH��L��H�t$H�D$� ���M�4M9�sbH�ؿ6L�=�61�D�(L��D�fE�,W��H��I9�w�H��L��H��L$L)��$���L$L9�����u!����H�t$�H���H�������"H�����H�\$H�CH���G�8�>�@H���w��H�[H���[���H��(H��H��[H��]A\A]A^A_�$���I��M)��uNI9�vI��.��I9���L��L��H����#���.H�����1�L�cM9������"���H��L��H��L$L)��#��I9��L$�������t��H�ǿ6H��A�Gf���W��H��6f�tJH�������H�t$H��H�ǽL�T$���L�T$L��H��L���#���D�\H���K���3�H��([]A\A]A^A_�Ä�������}���f���UH���<SH��H�����H��H���O��H��H�߾>[]�������UH���SH���YN��H��H��H���{O��H��H��[]��ff.�f���UH���SH���N��H��H��H���{J��H��H��[]�M�ff.�f���H��tH�GH��t�8u	�,��@�ff.�@��H��tH�wH��t�>u	���@1�H�(�H�=��1����f���f�H�GH��t�>tH�7H��t	�:tH�WÐ��AWAVAUATUSH��8dH�%(H�D$(1�H���+H�I��H���H��I��H��I��I�M��A�L�D$�b��L�D$H�,�E��uyI�oH��t�}u*I�$H�D$(dH3%(��H��8[]A\A]A^A_��@H������H��tvL�t$H��H��L���s<��L��A�Et9�T+��I�$�fDA�H��H��L��H����J��I�.H���g�����+��L��H���(��I�$�Y����E1�H��H�;H��L�����I�$�1�����L��:H�
�=1��H�5�:H�=_.����f���AVM��AUI��ATI��UH��SH���P���M��M��L��H��H��H��[]A\A]A^�Q�����f�H�GL�N M��t[A���tSH�ݻ6L���6�
�и����fA�PtAL����fA�@t)H�����u�L�H�F(H��t	�8tH�G1��fD������f.���AWAVAUATUSH��H���}I��H�>H��H�����.�L�pH�hH�{H��t	�?��E1�H�{H��t�?ukE1�H������H�U�H9��2S��I�H��L���PE1�H��M����E1�M����1�M��u{L�EL�}H�MH��H��[]A\A]A^A_�D��L�hH��H��I9���R��L��x�����k�L�`H��H��I9���R��L��?���E1������K�L&H�sL��L�D$H�H���t��L�D$H���\����N�|5H�sL��L�D$L���G��L�D$�+���DL�@H�3L��L���&��I������fD1��������AVAUI��ATA��SH��H��xdH�%(H�D$h1�H��tH�M��tI�H��t�>u6A����H����I�E�L��PH�1��f.�f�L�D$L�t$)D$)D$ )D$0)D$@)D$PH�4$�P�H�4$L��H��H�����H�D$0H��D����L��H�D$P�D$X��	ЈD$X���L�D$��~ZH�D$0H9D$(umH��tI�v(L������H�1�H�L$hdH3%(u]H��x[A\A]A^�fDM��t)H�T7I��������M��tH�F8��tH�T$I�������M��t�H�77I�������������AWAVI��AUI��ATA��UH��SL��H��dH�%(H�D$x1�H��tH�M��tI�H��tH�M��tA�}u\A��
A��
�VH��tI��L���PH�EE1�H��tL�+H�|$xdH3<%(D����H�Ĉ[]A\A]A^A_�f�L�|$ L�D$)D$ )D$0)D$@)D$P)D$`L�<$��L��L��H������H��L�D$��H�L$@1�H�D$`�D$hH���ƒ�	�H�T$8�D$hH9�v	�:<�a�T$h��A���8��`H�D$8H9��R�8@�IH��H�D$8�JfDH�D$8H�T$@H9��n���,��H�HH�L$8H9��?�x@�5H��H�D$8H�<$1�L�D$��L�D$���H��6H�D$(��T$hM��t	H�D$(�I�f�H�|$0D$H���\A��@�R�?<t
A���C���nN�����[H�$A�� H�T$H�p8�HD��������
H���8H�D$A�����H�H������H�4$L��H��(����H�E���H�D$@H���^���E1�H�<$D��L�D$�d�L�D$�������T$hH�D$8H�L$@��H9��9�8>�0A���A���D�׃���H��H�D$8H����H9����� �
A��@�M��t
H�D4I�f�H�|$0D$H�������A����������H�5M���h����f���H��tH�D$`H�A�����������׃�uAH9��X������>��1�H���V���f�M���
���H��3���H9�v	�8>�	���H�=3H�D$(M����������H��3H�D$(M����������fDH�E1�A�� �#���H�|$H����H�t$8@��t
I�}H9���L��E1��+��H�D$X������H���D$hH�T$8���H9��/����DA�����M�������H��2I����f.�H��3H�D$(���H�4H�D$(����H�O3H�D$(M������������:u�H��A�H�D$8�v���H����*��H�D$X�+���H�2H�D$(M����������H��1H�D$(M���y����w����?�ff.�@��E1���7��@��AVI��AUI��ATI��UH��SH��`dH�%(H�D$X1�H��tH�M����I�M���OA�<$�Df�H��)$)D$)D$ )D$0)D$@�@�L��H��H�����H�D$ H��H��A�ľH�D$@�D$H��D	�D$H������H�D$ H9D$��E1�E��tH�s(L������H�EH�L$XdH3%(D����H��`[]A\A]A^ÐM��tzA�<$tsf�H��)$)D$)D$ )D$0)D$@��L��H��H������H�D$ H��H��A�ľH�D$@�D$H��D	�D$H����~H�D$ H9D$�D���A������Q���fDH�r0I�A������6���H��1I���H��1HED$I�A����������<�ff.����UH��SH��(dH�%(H�D$1�H��H���/��H��H�����H�L$dH3%(uH��([]�������ATI��UH��SH�� dH�%(H�D$1�H��H����
����x/H��L���D��H�E1�H�L$dH3%(uH�� []A\�DH�E��������l�ff.����USH��H��tAH����$�H�;H�����H�{H�E���H�{H�E���H�EH��H��[]Ð1�H��H��[]�@��SH��H��H�� dH�%(H�D$1�H��H����.��H����H�L$dH3%(uH�� [�����UH��H��SH��(dH�%(H�D$1�H��H�������x)H���Y�H�E1�H�T$dH3%(uH��([]�@H�E��������D�@��AUATUSH��dH�%(H�D$1��L$�D$H��tmH�>H��tdH�H��I�վ�PH�3H�T$E1�I��L��H��1��_��H��I�$H�s�_��I�D$L��H�T$dH3%(uH��[]A\A]���L��,H�
I/1���H�5O,H�= ���ff.�@��ATUSH��dH�%(H�D$1��T$�D$H��t_H�?H��tV�I�����H�;1�H�t$H��L��1����H�{H�E��H�EH��H�L$dH3%(u	H��[]A\����L��+H�
i.1���H�5�+H�=L����ff.�@��H��tWUSH��H�H��t9H�.H��t1H��t\H�vH��$����u#H��H��H��[]�1��f.�1�H����H��[]Ð1�H��t1�H�>�����D���������f���H��tWUSH��H�H��t9H�.H��t1H��t\H�vH��$����u#H��H��H��[]�
$��f.�1�H����H��[]Ð1�H��t1�H�>�����D���������f���AUH�5�-I��ATU1�SH��L�%�6I�\$��H��H�s��H��t L��������u�H��A�D,H��[]A\A]�H��1�[]A\A]���AWAVAUI��ATI��USH��H�����t�f�{t"�oCAD$�CA�D$�Cf��tfA�D$H�s H��t	�>�"H�s(H��t	�>��H�s0H��t	�>���C8��tA�D$8�C<��u�sH��u H��[]A\A]A^A_�DA�D$<�sH��t�H�C@H��L��E1�H�D$I�E�PH�$�CH��tD�D��H�D$L��A��H��L�4(H,$I�6���L��H�EI�v�u��H�ED;{Hr�H�$I�D$@�CHA�D$HH��[]A\A]A^A_�L���@��I�D$0�C8���.����$���L��� ��I�D$(���fDL�����I�D$ ����f.�@��AUf�ATI��USH��8dH�%(H�D$(1�H��t�>u>�����M��tH�'I�$H�\$(dH3%(��H��8[]A\A]�f.�H��H��H��H��H�����L�l$H�\$ I9���<��H�0A�E�F��I�EH�D$H9��@A�M�Nu
��-�,@H��H�D$H9�����Nu�-t�L)�H��L���/��H�t$ H�EH�D$H9����8=uvH�xH�|$H9���H�
�6L�~�6�
�PfA�P��H���fD�H��fA�PtzH��H�D$H9�u�H)��.��H�E�����H��-H�D$�����M�������H�T$I�$���L)�H���3���DH�E��e���fDH�y-H�D$�f.����1��m����j��f.���AVAUATUSH�� dH�%(H�D$1�H�H����H�@H��1�H��I��H�sH����H���|��H�EH�EH�H�L�hI�L9�t?I��H�3L��H���I��L��H�$H�s��9��H�UH�}L��H�D$��
��I9�u�H�D$dH3%(u
H�� []A\A]A^����ff.�f���AVI��AUI��ATUH��SH��H�� dH�%(H�D$1�H�?t^f�L��H��I��)$���L��H��H�$���H�SH�;L��H�D$�E
��H�D$dH3%(u<H�� []A\A]A^��H���@H���I��H�CH��{�������@��AWI��AVI��AUI��ATI��K�<UL��SH���5��H��L��H��H���e���H������H��L��L��[L��]H��A\A]A^A_�1��ff.���AWAVAUATUSH��L�'M����M�4$I�l$L�I9��}I��H��H�|$M���DI��L9�t_I�}H�������u�M��tI�EI�H�D$L� M�4$H�D$L��L��L)�H�PH����H���F��H���[]A\A]A^A_�f�H��1�[]A\A]A^A_�ff.�@��ATUH��SH��H�>����H��I�����L��H��H�����H�UH�������t]H�
��6�1H�
l�6�f.�H�����t5f�4Au�L�*H�
�.1���H�5�&H�=t������=H���C���H�mH���'��H��H��[H��]A\����D[]A\�ff.�H�H��tpAUATI��UH��SH��H�L�hI�L9�u�?�� H��H������I9�t"H�3L����	����t�H��H��������fDH��[]A\A]�D����ATUSH�H��t@H�L�`H��I�L9�u�,@H��I9�tH�;H���t�����u�H��[]A\��1�H��[]A\�fD��AUI��ATM��U��SH���"��H��1�H��t5H�{����H�<�2��@��L��I�EH�sH�������������D�H��[]A\A]�ff.���ATUSL�L�M��t5I�h1�H��H�wH�Dž�t!M��tI�A1�H�v��t9�t21�[]A\��M��t�I�A1�[]A\H�v�����f.�I�I��H�H9�u�0H�pH�{�s&����u�H��H9�tH�3L���!��H��u��@��f���f�FF F0H��tdATI��UH��SH��H�2���L��H��E�CH�u�
��L��H�CH�u�
��H�U0H�s0L��H�C�E �C H�E(H�C([]A\����@�ff.�@��H��0�S-����AWf�H��AVAUATA��UL��SH��H��$�H�|$H��H�5��H�L$H�\$ H��$�L�D$H�\$(dH�%(H��$�1�AAAAA AA0H�D$t�D$|H�D$`L�L$h�T$p�.��L�8M����H��L�t$0L�l$P�A��t>�H��H�=$��€����p�H��H�=$��€����)A��t�H��H�=:"��€����LH�|$H���&H���>�����H�L$XH�T$PH��H�t$�o1��H��L�;M�������L��L��L��H���������H�|$P���H�D$PA��t�H�=�!H����€������H��H�=#��€��������UH�|$X����H�����P��H�E�H�=�"H��I���������H��L�;�EM���1���1�H��$�dH3%(�4H�Ę[]A\A]A^A_�DH�}H�|$X�H���jL�|$HH�t$@L���u%������L�L$@�H�=0"L��������2H�|$�H��PH�E����A�� t�	H�=} L���������D��%�=���H�D$H����L��H���P�������EH�|$L���
��H�E����H�}H�|$X�qH����H�T$HH�t$@�$������L�|$@L�����L�I9�sBH���6L���6�:A�fA�<P�+L���fD�
fA�<H�H��H9�u�H�|$L���t	��H�E�l���H�|$H�L$8M��L�κ�>�����YH�D$8H�E�9�����U H�|$X����H���������H�=� H����€���uO�E ���H�}(H�|$X��H����H�u(�����������H�
#��DH�ƹH�=9 ��������E ����fD�E�m���@�H�=}L������������E�?���fDH�t$0H�=�1��E!��H�\$(H�H�D$ ����������H�D$(H��H�H�D$ ���������1�H��H�\$(H�H�D$ ����������H��!��1�H���κH���H���1�H���@1�H�W!�1�H�w�1�H���1�H�!�y���H���m���1�H���_���1�H��Q���H�t$HH�=�!1��. ��1��7���H�t$HH�=�!1�� ��1�����H�t$HH�=�!1����1������^��ff.���H��0�����H��0�����AWAVA��AUATI��UH��SH��H��H�9L�ot
@�����{�F3���CH��#Hc�H�>��D��%�=���2���H�5H�����f�L�{D��%M���K����H�S(H��t
A���M��tI�<$tH�S0L��H������H�uI9�s
H����H��[]A\A]A^A_���6)��H�3I��H�>��H���N*��H��H�5r��:���I�7I�WH������ H���^����f��H�51H�����L���$��L��H��H����� H����C ��ta���������$�	H�5�H���������H�5�H��1��	������f.���������C ��u��	H�5�H���\��������H�5kH���<���L�{L���`��L��H��H���"���� H���U��0����
H�5H����������A�� ��0���H�5�H���������D�H�5�H������a���XH��[]A\A]A^A_�l����H�=���ff.���H��0�������H��0����UH��SH��H��H�?H��t����H�5�H��H������{�Z0���CH�� Hc�H�>��H�jH�5dH���Z��f.�H�SH��tH�5RH���8���C ��tP��t����H��H�58H���
��H�S(H��uH��[]�DH��H��H�5[]�#��H�YH�5�H��������H�SH�5�H������X����H�H�5�H������5���DH�hH�5tH���j�������=H�=�����@��f�FF H��tXATI��UH��S�BH�ӉFH�2���H��I�$H�s����H��I�D$H�s����H�S I�t$ H��I�D$[]A\����f��ff.�@��H�� �!����AWA��f�H��AVAUATUSL��H���H��$H�|$H��H�5���T$<H�L$(H��$L�D$H�L$0dH�%(H��$�1�AAAAA �$�H�D$pL�L$x��$�D��$���"��L� M����H��H�D$HH�D$H�D$`H�$�o�A��t�H��H�=���€�����H�|$H����H����������H�L$hH�T$`H��H�t$�c��H��L�eM���j���H�L$H�$L��H���)������H�|$`�7���H�D$`A���U����H��H�=���€����6���D�cH�|$hE���H���H�5���!��L�(I��M�����H�l$ L���D$;A���!f��S�C���DE�M��t[M��L�eH��A�}t�H�5ML��誯����t�H�5@L��藯����uc�C���DE���CM��u�f.�H�l$ D��A�����|$;��D�cE�������H����f.�H�5�L���!��������C���DE���C�0���H�;L�t$h��M��������L��$�L��H��L���M���H�t$PL��������UH��$�H;�$��?�8;�6H�t$PH�|$�j����H��$�H���!��L��H��I���������^H��$�H9�$��eI�I�NH�H9�sAH�R�6H�5ۑ6�:�fDH��H9�t�f�<Vu�E1�H����L��谻��H�|$H������H�;H�5|�H�CI���ͭ�����"���L�����I������E1��L��L��H����H���`H�x�U�x0t%�D$<�DH�P H���7�:�.�@0H�|$H�T$XH���������H��H�D$XL�eH�CM�������@1��k@H�5�L��������u�C���DE���C�$���@M�����D$;����DH�D$0H�QH�H�D$(������H��$�dH3%(�H���[]A\A]A^A_�H�t$HH�=�1��}��H�\$0H�H�D$(�������E1�H��H�\$0H�H�D$(D� ������E1�H�z��E1�H�<��E������E1�H�t�H���E1�H�R�t*H��$�H�=�1�E1������E1�H�q�{���H��$�H9�$�r�E1�H��Z���D�d$;A!�E���[������ff.����H�� ������H�� �s���H��ATI��UH��H��SH��H�H���Z���L��H�C���H��H������H�C[]A\�f.���AVAUA��ATI��UH��S�AH��L�w��t����H�H��t	A��u@M��tI�<$tH�S L��H����H�uI9�s
H���l[]A\A]A^�f�H�5{H��1��?���H�;H�5(�耪������L�kM���w'��L���3��L��H��H����� H���(��c����H�5���C��t8=��'���H�5�H���� H�����������u<�u`�tۺH�5�H���p���fDH�{����I���L�����H�5EH���<�C�tE�,H���h��H�5%H����C�a����,H���=��t������?�����[H��]A\A]A^���fD��H�� ��������H�� �`����AUATUSH��H����H�����ub�F9Gu`L�/I��H�6H��L���v����uHH�5n�L���c����tGI�t$H�}������u#H��I�t$ H�} []A\A]�%���DH9���H����[]A\A]�DI�t$H�}�
�����t���@��ATUH��S�GH����t%��tw=���%��H��H�5H���&���H�H����H�5H������H�;H�5���������H�SH���%��[H��H�5�]A\����@� �6���SI�������t#I�|$���H�5CL���2��S��tI�|$uz�H�5'L����L���&���H�5KH��H���T���H�H���.���[]A\�H�{���H���H�����H�5�H�����S�U���@�,L������t���fD�,L������8���f.�@H�>tZATI��USH���)fDH�+H��H���y���H��L��H���;�H�;tI�|$tվ L���`���fD[]A\��ff.�@��ATI��U��SH���薻���+L� H�@H�C�CH�C[]A\Ð��U��SH��H���H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�H��H��H�D$H�D$ �$�D$0H�D$�c�����H��H��趺��H�D$dH3%(u
H���[]��ǿ������w�F���w�O�W1�H�=c�-��D1��D��AU� ATI��USH��H�_H�;���H��tRH��H�����H���xA��H���+���H��H�(A��v(A�M�I�t$�H��DH��H��H��H9�u�H��H��[]A\A]�f���AWAVAUATUSH��H���6��/��!���{�"��H��1�H�=��R
��H��I���7��H�[I��H����H�;L�=��ur�D�-H�����M��t#L���ּ��L��H��H����� H�����L�#H��L��謼��L��H��H���n��L��H���^�H�;t8L��耼��L��H��H���B�H�{�w���� H���j��r���DH��[]A\A]A^A_ÐL���8���L��H��H����M��t#� H���(�L������L��H��H�����H��H��[H�5�]A\A]A^A_����ATUH��H��SH���������/�� ���{�� ��I��H�5N1�H���~���M��t#� H����L��脻��L��H��H���F�H�sH��[]A\����fD��ATUH���S����H�ËE-�=gvH�uH�����H��[]A\�����H���8���UH�5�H��I��1����M��tþ H����L�����L��H��H��������UH���SH���Y��H�uH��H���
���H��H��[]錯��ff.�����oSH��H�BH�FH�r�@��H�C[�f.���ATI��USH�H���PL��H��H��H����H��[]A\�ff.���ATUH��SH���-����3H�=�I��UHL��H�=��U@�-���cw[]A\�H�m@H���$��[H�=��H��H��]A\��UH��SH��H���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H�shH��tH�"�6H�8H��P H�ChH��$�H��H��H�D$H�D$ �$�D$0H�D$�`�H�ChH�D$dH3%(u
H���[]��}���ff.�f���AWAVAUATU1�SH��H��F�.uaD�?A�G�<@��A��2��@ ����_L�w��t7I��I������1�H�01���DNt2����t2��I���TS�A���u�H����[]A\A]A^A_�fD��t�@��.u�A�FM�F1�1Ʉ�t�D��B�DNt.����t.�<�I���|x�A���u�M��u�@1��@��t�@M��t�M�$A��0A�U�E�}A�}�f���ff.�f�AWI��AVL�wAUATL�%�USH��HdH�%(H�D$81�H�D$H�l$ H�$H�D$,H�D$H�$I�?1�L������Ã����������I�GH�T$H�A�0I�GI�W ����A�O0Ic�L�>��L)�I�(H�GH�H����L����I�G I9G��I�(H��sH���P΀��a�Q��5�T��0������1�k�d�P�A�\��-��A�w4I�G8���E�A�G0I�GI;G ����
���;�� ����-�2H��A�gX�I�GA�G0I�w A�GptI�W8�:���H9��H�Q�6L�-ڀ6�:�fA�|U��H����
fA�|Mt
H��I�WH9�u�H)�I�(H�OIOPH�I;O�H���t�I�GI;G �FA�G0�8
�A�G0I9G �#���
��H��I�(I�G�F���A�GpI��H�D$ I�G(tH�x��A�O4��I�`L��A�O4H�@IGP�)�I�@I�WHH��H�D$ ���I�(H��%A�GX�,A�G0M�oI�_ I9���<��L����H��I�WH9�������:H��Dyu����DI�(H���I�G`H��t
H�I�`�Pf�H�=&AG0AG@AGP�����I�G`H�H��RI�`�@H�����I�G8�4��I�GHI�G@�)���H9���H�
�}6L�-�~6��fA�\M�?H��@H9�v+�A�|MH�
6f�9tH��I�GH9�w�f�I�(H)�H��H�OIOPH�I;O���\�I�WI�G H9��+�fA�\E��I�(� �n��I�GI�W H�pI�wH���f���fDA�O4���#���H9��s��� �gH�
h~6L�-�}6D�fE�TU�IH�P��
�� ��H��fE�TM��H��I�WH9�u�H)�H��I�(H�OIOPH�I;O�H���y�I�G I9G�KA�G0I�W�: �A�G0H�Ѐ8
���H��A�G0I�G���DH�5�
L��1�����������H�\$8dH3%(��H��H[]A\A]A^A_�D��
����� ��^��H�=|1��"��H��L��1������H�5������1��i���A�GX����A�G0I�?�I�wI+w����Z���@H�5\	L��1�����������;���DA�OXI�WA�G0���f�H��A�G0I�GA�OX����fDI�_8�{	�����H�t$H��L���B����jL�L$ A�O4A�< wQH�$H��sAI�G8I�����Q�t$,L�L$ �����9�u����;su�D$09C��@I�G(�{����A�G0I�W�����1��)������@H��I�(� I�W�z��I�GI�W A�G0H9��J����I+GI�?H���a������@9�����H�51L��1�������Z�������DH�=	z1��2������D1��,����D$49C�,���@H�D$,H�C�D$4L�L$ �CI�G(A�O4���fD1�����H�C�C�C	A�O4I�G(L�L$ �T����A�0����� ��^��H�={y1����H��L��1������H�5����������I�?�G �����W��uvA�G0��tgH�5L��1��G������H)��0���H)�H���%���I�W�h���H�5GL��1�������������H�=�x1�����`���1����1��h������H�5�L��H��1�����J����'������AUI��ATUH���xSH��L�%@{6I�<$H��PH��L��H��H�����HD�L�+H�k�f��I�<$���x��H�C(H��H��[]A\A]�fD��USH��H�H�H�{(��H�C`H��t
H�H�{`�PH���x���H�-�z6H�shH�}H��t
H��P H�}H�ChH�H��H�@ H��[]����UH��SH��H���+���H��tH�]H��H��[]���@H��[]�f���ATI��UH��S�G0H���������sp����	�@�spH�shH��tH�z6H�8H��P H�ChH���i�����~eH�{@H�sH1�H�GH����������H�SH1�H���ɹ��H�C@�C0H�S8H�HH9KH����H�H�BH�C8[H�E�]A\�H�Sh[]I�$A\��Gp�ƒ�@8��^����V���-������ATI��UH��S�G0H�������CpH�sh����CpH��tH�y6H�8H��P H�ChH���~��~jH�{@H�sH1�H�GH�����c����H�SH1�H���޸��H�C@�C0H�S8H�HH9KH�.��H�H�BH�C8[H�E�]A\��H�Sh[]I�$A\��Gp�����������3����ATA��UH��SH��H���H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H�sh�C@H��tH��w6H�8H��P H�ChH��$�H��H��D�c`H�D$H�D$ �$�D$0H�D$���H�ChH�D$dH3%(uH���[]A\��0���ATUSH��H�� dH�%(H�D$1��G`H�GhH�8H�����G �L�d$H�l$�H�t$�V���H�{81�L��H���e���H�{8��݋Gu ��u H�L$dH3%(uvH�� []A\���t$��Zu/1�H���H���Y���������f�H�{8�g��������H�,S�H��H��1��"�����������z����)���f�AW1�AVI��AUATUSH��H��HdH�%(H�D$81�H�D$(L�d$0H�D$H�D$$H�D$DH�t$I�>L���h���A�Ņ���L�l$(L�|$0M�A�~@M�n M�~(����A�F@Hc�H�>���L��M�nXI�M9�����s,�>��H��f�I��M9��CA�E�DBu�L��H)�H�� �7I�FXM9���H��L�����I�n(M�n I�FHI�FXA�F@I9���A�E<
��<
�JA�F@I�n �U��
��H�uI�>A�F@A�I�v H+t$(�)���H�\$8dH3%(D����H��H[]A\A]A^A_�M9�s)A�}
I�Eu�%fDH���x�
tI��I�F I9�u�M9���I��A�F@M�n I�~0���L�-it6I�vHI�}H��t
H��P I�}I�vPI�FHH��tH��P A�Vpf�M�~(AF@I�n ��AFP����A�F@L9���M�nI�N0M���D$E1�H����L�yM9�v�|$��M9����|$����H�H�
�
�L��HD�H�V1��6���I�>I�v A�����H+t$(迖�����f.�A�VpM�nI�N�Ѓ���I�N0M���D$H���[���E1�M9��l����M�F I�nX�I�v(L�H9�r0�f��U�T$$����Hc�I�v(H�H9���A�Vp��u�H�T$H)�H���B�������y�H��L��1��R�������DA�F@I�n �E<
�(<
��A�F@I9n(�]���I�>H��H+t$(覕��I�>���H���>���fDI)�I�� �M�nX��DH�1p6�t$$�4rH��p6f�2�����M�F H��L)€|$tL��L)�H9��xI�VXI;n(�z����L9��	�E�H��<	t< uf�H��L9����B�< t�<	t�A�Fp��L9���A�8 ��H��
�L��1���������fDH��I�n ����A�F@L9����������f�H��
�L��1��������D����"�����&���I�>�G ��
���W����A�F@H��
�L���������DD�1��r������DH��I�~0H����L)�L�����I�~0����I�FPI�n I�FXA�F@I9n(�������DA�Fp���fDE1�I�>�
�M~XL9�w\I�~0H����I�v H��H)��(��I�n I�FX�����EA�<�v�H�#n6H�D��>����DI�n �y���H��L�����I�FP�;���< �dI��A�F@M�n M;n(�I���I�>L��H+t$(����>���H��������H9�wH��H=HB�I9�LG�H�uo6L��H�8�ھ��H��I�F0�����B���<^��L���
��
tH�=�
1���I��A�FpH�
d�
H��
HD�H���
�L��1�����k������H��K�L��H��1�������A�FpH��
H��
��HDڃ� <^v;H�=f�
1���H��I��H�o�
�I�����H�=<�
1����I���O���H�=&�
1����H������� <^v1H�=�
1���H��H�M�
L��1�����������H�=�
1��v���L�E�
H�
f�
1���H�5��
H�=I�
�܅��ff.����H��m6ATI��UH���xSH�8H��PL��L� H�����H��t�oECH�EH�CH�{uH�CH�{uH�C H�{uH�C�H��[]A\�@��ATI��USH�H�{8����H�{0���H�-Im6H�sHH�}H��t
H��P H�}H�sPH�CHH��t
H��P H�}H�shH�CPH��tH��P H�ChH��调��H�}H��H��P []I�$A\�fD��UH��SH��H���{���H��tH�]H��H��[]����@H��[]�f���H�8H��t����fD1��D��AVI��AUI��ATI��UL��SH���Gp���cp��C`A�$H�EH�shH��tH� l6H�8H��P H�ChH�����~CH�������~W�C@�����H�CHH���I�H�CPH��HD�I�E�[]A\A]A^Ðt�S`A�$H�Sh[H�U]A\A]A^�fDtԋS`A�$H�ShH�U�C@�fD�G@���)������!���L�=�
H�
�
1���H�5�
H�=��
�$���@��USH��dH�%(H�D$1�H�8�v��H�OH��H��H9�rLH�?���H��H��H�$���H��H�C8詁��H�{8�0��H�C8H�T$dH3%(u+H��[]�DH��Z1�H�5G�
���H��H�C8��\���ff.����SH��dH�%(H�D$1�H�8����H��H�?���H�sH�$H���u.H�C8H�����H�C8H�T$dH3%(uCH��[��H�=�
1��b�H�sH�<$�ZH�����H��H�C8豀��H�C8�覞��fD��AUI��ATI��UH��SH��H���Gp���Kp�C`A�$H�EH�shH��tH��i6H�8H��P H�ChH�����~4H�����~H�C@�����H�CPI�E��cp�H��[]A\A]Ðt�S`A�$H�ShH�UH��[]A\A]�@tҋS`A�$H�ShH�U�C@�fD�G@���8������0���L��
H�
~�
1��DH�5L�
H�=�
褀��@H�OHH���H��t`�p@t[H�P H�����r@u�@�p@tH��H�B H��u�H�WH�B H�G H��tH�xH�z H9��t]����DH�GH���H�G H��tH�xH�������DH���H�������f.�H������ÐH���i������SH�_HH���蛹��H��[�r��f���H�
}�
1Ҿ,#���f�H�G(H��tH�PH��t~SH��H�8H�H9�sr�H��< vEI�$H��H9�t
�< w�I��s��}��H���e��H�;H���j��H�C8[�@I�$I��s���fD��1��H����USH��H�����H�W8� ��H�O(H��t#H�ytH��H��u8�'���H�S8H���ufD�H�-��
H���
HE�H��uH�����H��H�{H�5t�
����H�タ�w�H�=d�
H��1���H�{H��[H��]�4���@H�-�
H��u���� t��f�SH�_H������H���H���4���ɧ����xu[ÐH����D����[�DH����,���H����������[�ff.�f�AWA���AVI��AUI��ATI��H�=�
USH���e�����H��H�H��P�SH�5��
H�(H��L�`HD�x@L�pxL����@�@TI��$p�T��H��H�C�8���H��H��[]A\A]A^A_�fD��H��H���]��H���F���fD���G����ATUSH�H�H�����CH�kH���d���P���S��t[]A\�f�L�c1���H���
L��薚����uRL���z����{P�����H9� �9��H�{`�*{��H�{���H�H��t	H�H��P[1�]A\�f�D�����L��1�D��H�
��
H�5+�
������AVAUATUSH�o(H��t[H��H��E1��
���L�uI��L9�w5H�mH��H��H���_�����uA�M9�tB�D-<
A��< ��A	�[D��]A\A]A^�E1�[]D��A\A]A^Ð������ u	������������� u�t���H�H��Hy�fD����ff.���H�GxHLJ�����AWAVAUATUSH��HdH�%(H�D$81�H�H�D$H��t>H�L�`H�XPE��$���uGE��@��E1�H�����@��������H�D$8dH3%(�iH��H[]A\A]A^A_���0�S�A��E��@�Ń���@ �A��t�H�����H�D$���@���������x�D��A��8�H�D$��� �b�������U����Y���@H�D$E1�H�x��H�5��
����H��H�D$����.���1���H���
H��H�$覗��L�$����E����L��H�(�L��
LD�H�
,�
H�5��
1����H�D$H��E�����@P������������v�������������������H���H��tH�����H�D$Hǀ�E��t���������v��t
H�|$軀��@������E������A��$H�����L���B�����DA����D��������@@���@L�x1���H�^�
L���E������=H�
��
��L��1�H�56�
���A��$����N���H�D$H�pH��H�P H����H�V H�P H���VH�pH�rH�@ H�@A��$����M��A��$����DL��萍���3���L�D$ H��
�(#H�$L��L�D$����H�$H�=�
�D$$	H�D$(�QH�$L�D$H��L���#�H�D$���H�$�h���fD@����H���H�������<���f.�L���������H�pH�P H���OH�V H�P H��tH�pH�rH�@ H�@I��$�����I��$����H�D$H������I;�$������H�PI��$�����I;�$��s���I��$�H�P �b����L�x1��H�O�
L���6�������H�
��
�L��1�H�5'�
���A��$�����H�L$H�QH�A H����H�B H�A H��t~H�QH�PH�A H�AA��$H���H�����������L��舋���fDI9�$�����I��$H�P ����H�x ������v���I;�$u�H�AI��$�w���I;�$�T���I��$H�A �C������L�
�
H�
��
1���H�5�
H�=F�
��t��f���ATUSH�� dH�%(H�D$1�H�H�$H����H�H�xH�PPH�|$����H����H�xp��������H�h1��7H���
H���k�������H���K���H�,$H��H�}��H�EpH�$���H�\$H����iH�@H��H�P H��tH�BH��H�D$dH3%(��H�� []A\�f�H�hxH�@x�߉��H�<$����H�$�����yOH�|$H�D$�h���H���{��H�|$�����@H�
��
�7H��1�H�5��
�������fD��@H�xH�5k�
����L�z���I��H�$���u"H�=��
A�T$L��H����H�$���A��$�1��RH��
H��I�������ukL���ۈ��H�$H���'���H���H���H�$����f�H�
�Y6I�غ=1�H�5��
質��H���H�$H�\$�e���fDH�����H�
��
�RL��I��H�5x�
1������p�������fD��AUATUH��H�LjSH��dH�%(H�D$1��3��H��HDžH�$H��txI��H�k1��qL�c ����H���
H�������tlH�
�
�qH��1�H�5��
�O�����������{P�^���H�spL��L���y��L�$$M��u�H�D$dH3%(uH��[]A\A]�DH���X�����!������H��HdH�%(H�D$81�H��H�T$ H�T$ �4$H��H�D$(H�D$H�T$�D$	����H�D$8dH3%(uH��H�跍�����AUATUSH��dH�%(H�D$1�H������������H��������H��H�����H��H���̰��H�$I��DH������H��L���h���H�$H�X H�$H��u�M�l$1�L��I����E��t/H��A�E�L�d�H�H��H��H�$���H���%x��L9�u�H�D$dH3%(uH��[]A\A]������AVAUATUSH��dH�%(H�D$1�H�����������H��I���"�����H��H�����H��H���ׯ��H�$I��H������H��L���x���H�$H�X H�$H��u�M�u1�L��I������E��t3H��A�F�L�l�@H�H��L��H��H�$���H���2w��L9�u�H�D$dH3%(u
H��[]A\A]A^��ˋ��ff.���USH��H�LjH��dH�%(H�D$1�����H��HǃH�$H��t+H��f�����H�X H���]���H�$H��H��u�H�D$dH3%(uH��[]��5���D��H���H����ff.�f�SH��H�H��t1�1��
�H�CH�{0[��l�����ATI��1�1�USH� H�GI�t$(H��蜯����t-H�ÍE�H�l�DH�;1�1���H��H��萍��H9�u�[L��]A\�o���ff.�@��H���H����ff.�f���H���GT9�t��u�����X���wTH���L�[�
H�
�
1���H�5W�
H�=��
�m��f.���AWAVAUATL�%��
UH��SH��(dH�%(H�D$1�H�� H����L�k`M���f�L�sHH�\$I���M�~`螦��H�|$�����
�tI���H���&I�Ǿ L��覨��L��L��車��H�����L���D$舨���D$�����Ic�L�>��H���H���Z��� �����w
�C@��H��H��� ���u�f����uH�@ H�����@@u�H�X1���H���
H���ډ������H�
��
��H��1�H�5��
�E����{������F������DH�D$1��5H���
L�hL���q�������L���Q���H�D$H�x`�j����I�H9� �'H�{��H�5@�
�Z���H�=��
�PH�{(H���H�wH�����H�������1���H���
H��I���܈������H�{(��z��H�
t�
��L��I��H�5��
1��;��H�5]�
H��謂����tH�CH��IH���H���y���H�����Hǃ��`���@H���
�.#H�|$�ʹ��I����{��L���k��L��H���˧��H��H�=
�
H��1��g��H�
;�
�,#L��H���P��������H�L$dH3%(��H��([]A\A]A^A_��H�D$1��ZH���
L�`L��豇������L�����H�D$H�@hH��t:I9Er4�~��L�D$�WL��H�
��H�5v�
耠��I���L�c1���H�X�
L���?�������H�
q�
��L��1�H�50�
���H�� H9�tH���#�H�� H�����H���~���1�����H�D$H�PhH����L�h1��IH���
L��贆�����H�
m�
�IL��1�H�5��
���H�|$���������t�A�������H�|$L�o1��QH�c�
L���J���������H�
6�
�QL��1�H�5;�
������I����dy��L���n�����������f��CP��IH�C(L�kHH���N�s0H�PH9�w�0��H�C(s0�s0H�PH9��I�}`H)�H0�x��H�����H�[1���H���
H��胅����tGH�
]�
��H��1�H�5x�
�����g���H�[1���H�\�
H���C�������H��� }���5���L���}���p���H�� �o���������������1���H���
H��I���ل����t�H�
b�
��L��1�H�5��
�H������L���|�����H9��=�L�kHA������S�H�S����H�C H����H�B H�C H����H�SH�PH�C H�CI��A���H�CH�C I��H���PH�X I��A��L�k`�CPM�����������f.�H�
��
�5L��1�H�5��
�S���]���fDH�
��
�ZL��1�H�5��
�+�����fDL���x{����1�L���j��I�������f.�H�[1���H�_�
H���F���������H�
��
��H��1�H�57�
����&���H�X1���H��
H������������H�
��
��H��1�H�5��
�m�����L����j�����������I�����H�����H�C H����I;��t*I;���E���H�CI����5���I;������I���H�C ������H��I6H��H�
��
H�5T�
L�к�1������8���I;U�V������H�D$�Ջ��H�D$�����ƀ���G����AUATI��USH��H��H�oHH����H�����H�{�5H�5��
��H�=y�
�P�CPH�5��
H��I���{�������������H�{(H��t�H�57��_����C@�t
����M���
A�|$P�vH�CH���H�C H���"H�X������H����wH��裏����H�oH��螾���bf����������B���H���H�C H�CH���H����H�X ���H���H�����A����GH���
1�H��H���h���H�
@�
�G��ufH��H��[]A\A]�6x��fD�H���s���HxH���ҽ��A���1��UH��
H��H��������t�H�
��
�UH��H��H�5��
1�[]A\A]�g����L�cI�D$ H�C H��tH�XI�\$ L9�����������������H�����A����vH���
1�H��H���g��H�
s�
�v���a������fD���H���H�C H�CH���H����H�X H����e���DH�������@H����H���@H9nH��������f�I��H�
��E1�H�5��
�Ø��H���������H���������fDH����c���ff.����U1�H��1�S1�H����H�� H��H�����H��H��[]�f���S1�H��H�N dH�%(H�D$1�H�AH�v(��� ��?bH��H�Ft2H�$H��tH��H��H��軺��H�D$dH3%(u#H��[�DH�H��H�2���H���Z����c|����1����D���w@����ATUH��SH��H���z���SP�����L�c(M��t[H��L��]H��A\�4���@H�;�p襢��H��H�C(I���Fz����@��UH��SH��H��H�(H��tH��H��[]�x��f�H�;��H�T$�N���H�T$H��H�C(H��H��[]�dx��@��H���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�H���$H�D$H�D$ H�D$�D$0���H�D$dH3%(uH������z��ff.���AVAUATI��UH��S��H�w`H���0���H�Uh�L��蟜����~+�����ۃ�	�[�����]A\A]A^��u����H�Eh�@L�m���H���
L���k{����t?L����^��L��I����M��L��I��H�
��
H�5I�
1��q����L���s���ff.���AWAVAUATUSH��(H����_XD�gTH�oHH�|$L�xH�D$D9������I�����_XH�H�5��
���I��H�D$���u4A9�t
A�-���cv"H�=&�
A�UL��L���^��H�D$���A���1���H�n�
H��I���Rz����uFL���6r��A9���H�D$���xM��tH�t$L��A��H��(�[]A\A]A^A_������L���t$�L$�l���H�T$H��L��t$D�JTD�BX��V�L$ H�5��
QH�
��
P1��C���H�� A9��i��������/�H�D$H�HH�P H����H�Q H�P H����H�HH�JH�@ H�@�����xy�xPt�@PH���Ę��H�|$芩��H�D$���xM��tH�t$L��A��@H�|$�b��H��覶�������H;��i���H��H�P �Y����@P��H;��R���H�PH���B������GP��AWI��AVAUATI��USH��HH�dH�%(H�D$81��Ó�����kI�O 1�I�H�AI�w(M������� �M�w@I�0M���`H��8H�D$H�D$(H�D$0H�D$H�D$(H�D$�DL�d$(I�0L9t$r���G ��I�GL9�8M��LF�8I�w8�h@L��M)��m����L��H�߃�H��H�D$0����L��H�5j�H��H�D$(�M��H�t$0H�|$(1�����H�|$�"X��H�|$(1�L��H�5n�
�lg��H�|$(L�����I�W(I� H�t$����I�G Mo81�H�@I�w(9�@����I�@tM�w@H�|$(�^��f.�H�D$8dH3%(��H��H[]A\A]A^A_�DI�G8H9r��j���H9�8HF�8H�D$fDI�0�WX�����I�0��������I�0I���V���f����/����P�H�L�$�L���6��������I�@u0�G u.H�|$(H���E���L��H�5�����1����I�@tM�w@I�w8L���Yk��I�1�H��H�D$0H�|$(�a���H�|$0�V��H�|$(L��1�H�5��
��e��H�|$(L���$��I�G 1�H�@I�w(�������L���V������G������I�G�R�H���
H�XH���tu����tHI�0��X��H�
��
�RH��I��H�5_�
1���k��I�H�g�
�.#貦���=�����s��H���m����ff.���1��u���D��S1�H��L�F H�N(dH�%(H�D$1�I�@H�������H��-���cv7H�FH�$H��tH��H��H��脱��H�D$dH3%(u?H��[�fDH��L��1��ˮ��1�H�����H�C 1�H�@H�s(��u�H������s����UH��H��L��SH��踉��H�5��
H��H���Vc��H��H���{��H��H��[]��I��H��1����ff.�@��ATI��L��UH��L��S�W���H�5%�
H��H���b��H�{(L���i��H��H�����H��[]A\�fD��M��I��H��1����ff.����U��H��H��SL��H�����H�5��
H��H���b��H��H�����H��H��[]�ff.���I��H��1�韄��ff.�@��AWM��AVI��AUM��ATI��U��SH��H�������H�L$@L����H���S������H��tM��tI�<$��L���O���H��H�5�
1�H���b��M��t_H�}(L��L�M��tI�D$H9�����M�$$� 蒕��H�}(L��L�鋳�����H�}(I�WH�GH9�uI9�rOL��H�����H��H��[]A\A]A^A_�f.�I�D$H���K����8�B���L�������=���@L���{���ff.���H��AQM��I��H��1����H��Ð��AW��AVI��L��AUM��ATI��UH��SH��H�L$@����H��H������H�5��
H��H��1��a��M��tbH�{(I��$L�H��tH�EI9�$ �s��H�m� �Y���H�{(H��L��A��$��¿��H�{(I�WH�GH9�uI9�r$L��H���Q��H��H��[]A\A]A^A_��L���z����ff.���H��AQM��I��H��1�����H��Ð��AWI��L��AVA��AUI��L��ATI��USH��dH�%(H�D$1�����HH�$H�8H�ŀ��H��PH�5$�L� H�<$H��H��H�H�{H�C���L�k0L���k���A��$�@��H�{�H������$���H�s0H�<$H�C(H�C ��F���H��D��L��H����A���H��H�5��H��H�$�{��H�<$H�5��
��^��H�<$L������H�S(H�{ H���o�������H��H�L$dH3%(��H��[]A\A]A^A_�f�A��$@H�{H�����H���a���H�C(H�S@L��H�C ������~0H�C@I�UH9��@��H)�H�C@I�EL��H��H�C8�U����a���H�C@H�{0����I��$8H9�v�H�{0��\����rm��f���M��I��H��1��~��f.�f�USH��H�H��tjH�H�{xH�kt	H�{x�'p��H�SH�CH��tZH�BH�CH��t=H�SH�PH�CH�H�CH��tH�H��H�@H��[]��H��[]ÐH9]xu�H�CH�Ex��H9]pu�H�EpH�C�ATUSH��dH�%(H�D$1�H�H�$H��t/H�H�XhH��H��H�@hL�`p����H��tL��H���H�D$dH3%(u	H��[]A\��?l��ff.�@AT��I��H�5W�
USH�������H��u���H�=f�
�P���H�=��
�PH��H�=4�
�PH���H�=7�
�PH���H�=9�
�PH���H�=;�
�PHL��H��H�������HtH�5/�
H�=,�
�U@H��[]A\�ff.�@ATUSH�� H�dH�%(H�D$1�H����H�H�kH����5n��H9����H�C H9����H�S�����H���H�B H�C H����H�SH�PH�C H�C��������H�{�'������tH�H���K��H�H��PH�D$dH3%(��H�� []A\�@H���OH�B H�C H���H�SH�PH�C H�C�������r������I��(#H���
L����d��H�{��H�5<�
�D$	H�D$�^���H�=w�
�PL��H��H��������1���H���
H��H���j����tcH�
}�
��H��1�H�5��
�f��������H�C H���H�C H9���]���H���H�C H�S����R�������H���xb�����H9�����H�CH�������H9�������H���H�C ���H9������H�CH�������H9������H���H�C �����h��ff.�AUATUSH��dH�%(H�D$1�H�H�$H����H��������H�H��H�󈐈��������L�`pL�hxH�xH�@`��H�5c�
H�@p莅��H�=��
�PH��H��H���&������1���H�*�
H��H���'i����tcH�
����H��1�H�5�
薪��H���N���M��t	L��H��A��H�D$dH3%(u*H��[]A\A]�DL�``L�hh�@���H���`����qg���AVI���AUI��ATI��H�=�
US�^c����H��H�H��PL��H��H�(H��L�`��O��H�s(L��H��H�C �e���I�D$xH�CH�CH��t'H�XI��$�I�\$xt(H��[]A\A]A^��I��$�I�\$pI�\$xu�I��$�H��[]A\A]A^�ff.�@AVI��AUI��ATI��UH��H��SH��PI�$��L��PL��L��L� H��H�hL�k0�N��L��L��L��H�C(�yh��H���H�C H�CH����H�X ���H������H�����H�}��H�5.�
�A���H�{(H�C�ĝ����H��I������H�=��
H��1��S���H�{H����m��H�{L��H�5��
�4���H�sL��蘬��H�؃��[]A\A]A^�DH����K���@H����^���@��H��dH�%(H�D$1�H�H�$H��t H�H�@�@4��v��u"H������H�D$dH3%(uH����e��L���
H�
��
1��}H�5�
H�=g�
�G��f.���H��dH�%(H�D$1�H�H�$H��t+H�H�P����t.�B4��v��u/H������H�D$dH3%(uH���@�u��0���Zd��L���
H�
��
1��sH�5v�
H�=��
�RG��f���H��������H�wpH�WxH���ff.���AWI��AVI��AUA��ATUH��SH�����uA���H�=��
��_���PI��H�L��P��H�5��
�@H��L� D�h0L��L��H��p�̌��H�5~�
H�CH���k��H�k(H���\��H�k1��H���
H���d����t/H�
O�
�H��1�H�5_�
��H��H��[]A\A]A^A_�H���8\����fD��ATI��L��UH����L��S�N��L��H��H��H���d���H��[]A\�ff.�����G����USH��(H�dH�%(H�D$1�H�H��tH�C(H�D$�C���������CtH�D$dH3%(��H��([]�H�k1���H�v�
H���vc������H���V[��H����D��H�����������t&H�l$H���H��H�D$�|��������u�{4����H�{�?���H�H��t	H�H��PH�|$�t`���D����H�
��
��H��1�H�5��
�[����`����a�����USH��8H�oH�|$dH�%(H�D$(1���H@��H�_(1��?H��H�s�
�vb������H���VZ��H�D$H����C��H�D$H��@�T���H�D$H��8�C���H�t$H�FpH�FPH��t(H�l$�H��H�D$�s�H�t$H�FpH��u勖���t.H�l$fDH���H��H�D$����H�t$�����u�H�~8tH�~8�mc��H�t$H�~@tH�~@�Xc��H�t$H�~HtH�~H�Cc��H�t$H�F8H��H�F@H�FH�N���H�|$�4wpH�wXH���&�����1��gH�%�
H��H���"a������H���Y��H�D$H���@4H���'��H����H�|$�3���H�D$(dH3%(�/H��8[]��H�
��
�?H��1�H�5��
�3����8���fD1��;H���
H���`����t&H�
r�
�;H��1�H�5^�
���y���@H���@X���h���H�
���gH��1�H�5(�
軡������fDH�\$H���
�(#H���Y��H�|$H���D$	H�D$�y���1��rH���
H��H����_���������H�
L�
�rH��1�H�5��
�5�������[^��ff.�USH��H�(�������H��������H�tC�{4�	�������C4���\H�{8H���/�C0tk蔔���df��u�H�_1���H��
H���_�����BH��H��H�
��
1�[��H�5��
]�g����H�{@�C4��H�{(H��H��[]�D��@H�o1���H���
H���^������D���D���H��1�H��[H�
'�
��E�H�5P�
]���f�H�k1���H�6�
H���6^����tb1���H��H�
)�
H�5�
襟����H���f�H��[]�f�H��H��[]��U��f�H��H��[]邐��f�H���U����H�c���@H��H��[]�U��f.���AWAVAUATUSH��8H�ndH�%(H�D$(1�H�}(����L�mI��H��1�H�O�
L���O]������L���/U����H�u�uH�uPH9���?�Hǃ�H��H�l$�Pq�����A�$L�k`L�shH�C`������L�{��c�����	Ȉ��H�\$ ��c�1��R���������H�C I9����H�SH����H�B H�C H���aH�SH�PH�C H�CA���I���H�C H�CI���H���H�X A���I���I�����M��t	L��L��A�Ջ]4H�|$�:�����wH���M���H�D$(dH3%(�H��8[]A\A]A^A_�f.�L���(���H�
��
�L��I��H�5��
1������D���A����=H�5d�
A���H�{�w��H�=��
�PL��H��H���#������1��@H�'�
H��H���$[����u H���S��H�|$ �^�����f�H�
_�
�@H��1�H�5�
�s����ɐH�}8�����H�}(�L���H�EPH�EH����I���H�H��H�L$�PH�L$H��L�xH�D$ H��H�p(��A��H�L$H�s0H�C(H�D$ H��H�P0�W[��H�D$ H�PpH�SpH�PxH�SxH�xH�{�e<��H�|$ �����fDI���I�������DI������@I9�������H�CI������I9���i���I���H�C �Y���I���H�C �1����sX��USH���4H�|$vH��[]��H�o(H��8H��荠��H�|$H�������1��%H�T�
H��H���QY������H�
��
�%H��1�H�5)�
輚����@��H�  6H�D$�oH��@� ����H���@4H������H����H�t$��Hy$H�|$����H��[]�H���P���fDH��蘫����fD��SH��H��H��H�t$��l��H�|$H���H�G@H��tH���H���H�|$HLJ�H�����H�|$萫��H��[�f.���AVAUATUSH��D�v0H�t$A����H�O��I��H���Kl��H�l$H���H��t)H�}H�H�5w�
�g���H�D$H����8��H�l$H���E���L�-��
�D���H�{��L���s��H�=�
�PL��H��H���P������1���L��H��H���UW������H�
��
L��H��1����Ę��H�CpH��t	H�sxL���H�l$H�Cp�E0��H���H����H�C H������H�S����������A�$-���c�"����������fDH���N���o���H�}8H�����H����������������v#A�$-���cvH�}h��f.�H���t;H�|$茩��H��[]A\A]A^��E��tӃ��w����E��u�H���H�E8H��tH���L���H�l$H�uhH��HDž�H��ID�������1���H�l$H������H�}L���T���H�EhH�l$�F���fD��SH�� dH�%(H�D$1�H�H�H�D$H����H���i��H�|$���H�D$H�XpH��t#�H�{xH��t芅��H�[H��u�H�D$H���H��tH���H��t�_���H�[ H��u�H�D$H�x8H��t
�C���H�D$H�x@H��t
�0���H�D$H�xHtH�xH�{V��H�D$�����t/H�\$�H���H��H�D$���H�D$�����u݃x4v'H�|$轧��H�D$dH3%(u%H�� [��H�D$H�|$�@4芧�����R����AUATUSH��8H�|$dH�%(H�D$(1�H���dH����HH�o�@���@1�����HH�Ϲ
H����S�����gH���K��H�|$�h��H�|$H�GPH��@謚��H�|$H�GpH��t,H�l$ f�H��H��H�D$ ��H�|$H�GpH��u�H���L�l$L�d$ H�D$H��u�WDL������H�l$H��H��t8H���H��H�T$ H�h Hǀ�H��u�L����H�l$H��H��u�H�|$��HH��������H�}X��H�}HtH�}H�yT��H�l$��HH�EH�ƒ⿈�H���H�|$�إ��H�D$(dH3%(��H��8[]A\A]�f�H���ؗ��H�
�
��H��I��H�57�
1��ȓ���t���H�8��H��8H�����H�l$H�}X�@���H�}H��譭��H�EXH�l$�&����1���H�ҷ
H����Q����tfH���F���H�
r�
��H��I��H�5��
1��6��������H�_XH��������'���fDH�@t)H��@H���U���H�l$���H���PI������������L���L�d$M��t.H�l$f.�M�d$ H��H���0�L�d$M��u�H�l$H���H��tH���H���H�l$HDž�����@H��舃���A����O��ff.���UH��SH��(dH�%(H�D$1�H��H���(J��H��H���
K��H�D$dH3%(uH��([]��1O�����AU�mH�V�
ATI��USH��H��(L�ndH�%(H�D$1�H�Fp1�H�D$�L�8����!P�����yL��葕��H�
�
�mL��I��H�5�
1�聑��H�D$H���̼��H�{(H���������cw!��H���i��H�C`��H��HuH�x�H�@x��������C4H��H�\$��c��H�|$L���u�D�k4H�|$觢��A��wq��HuhH�CpH����H�x H�D$�ͅ��H�{H�5�
H���j���H�D$H�sH�x(��3����cv#��Hu�{4��H�{`��DH�D$dH3%(��H��([]A\A]��H�4����C4�(����L���F�������cv��f�H�sPH9px�������H�CPH�CHH�D$���H���
�-#H���dk���_����H�;L���ݩ��H�C`�D���@L��H���H���0�����L��ff.���USH��H�(�����H��H��H��v��H��CH�5ų
��u��H�S(H�CH������>��H�{H��H�5k�
[]�{T��ff.���S�4�����H���H����0t��u
[��H��8�d�����0I��H�
D�bH�50�
賙��H��8[�f.���AWAVAUATUSH���G4L�g(�������M���W���H�opH��H�������H�} I��I���w���H�{H�5ɴ
H������H�} 諤��H�{H�5��
H�����H�sH�}(�k1��H�{��H�5��
�h��H�=g�
�P���1���H�`�
H��I���]L����uyL���AD����3��H�E6�o�H�}h����L�}hH��L��L�up�C4�u�����H�tA��$�tGH�{PthH��[]A\A]A^A_�f�H�
�
��L��1�H�5��
�S����m���fD�C4� u�H��H��[]A\A]A^A_�*f.�H�{(1�����H�CPH�CH�ff.���AUATUSH��8H�|$dH�%(H�D$(1��_��H�\$��H L��@L���=���H�sXH��tDH���E��H�D$H�|$��H��V���H�D$(dH3%(��H��8[]A\A]���C4��whH�{(�n�����u0H��H�\$�_��H�|$1�1�讚���k4H�|$����w��C4��w@H�{P�m���H�{(1����H�CPH�CH�U����H�s`H�sXH���;���H�{(�H�����H�k1��yH�,�
H���,J�����DH�
T�
�yH��1�H�5�
藋���{4�>���H�{PH��t��g��H���L�-q���H�����H�EH��H�SPM��H�{(L�E(1�H���H�M S��p��H�CPH�ExH���AYAZH��u�H����GH�SHH��t��H�u	H�{PH9�tH�{H�K��H�{P��HH��t������H���������%���H�k1���H�
�
H���
I�����jH�
|�
��H��1�H�5�
�u���L�����f�H�D$ )D$H�sXH���~H���6C��H�CX�o)T$H�@�L$H�D$ ���]���H�{Ht	H�{H�DJ��H�CP�D$���T���H�t$H�����B���fD��HtH�CPH��������H�k1���H��
H���H�����GH�
\�
��H��1�H�5��
芉��H�{PH��t��e��H���H���\���L�-5�DH�E H��H�{(L�E0H�SPM��1�H���H�M(U����H�CPH���H���_AXH��u�����������H�k1��H�`�
H���`G������H�
��
�H��1�H�58�
�ˈ��L���C���f�H�D$ )D$H�sXH����H���A��H�CX�o)L$H�@�t$H�D$ ���V����^���DH����>������H���>��������-����H�m����H���>���`���H���>�����H�{(H���l���H�SPI��H�
��1���W��H�{PH�C@H��t�4d��H�������������tBH�{(H���N���H���H�SPI��1�L����)V��H�{P��H�H�C8H��u��H�k1���H�֫
H����E����tRH�
Y�
��H��1�H�5��
�E���H�CXH��t6�o)\$H�@H�D$ �T$��������ڳ��f�H���h=���H�|$H���
�*��>���D$H�D$��D�����H�XtH��@t/�fD@��u�4v]��Htۃ4w>���f�SI��H��H�
������H�5ު
1���^��H��@[�fDH�G`H�GXH��u�볐�ff.�@��AWI��H���
AVI��1�AUI�͹�ATM��USH��H��H�oH���uD����tyH�
�
��H��1�H�5Q�
�����H��������γ���{4�����L��L��H���u��H��1�L�hhH��L�`p����H��H��[]A\A]A^A_�fDH����;���ff.���ATUSH�p�����H��H��M�����L��H��H��[]A\魓��ff.�f���AWI��H���
AVI�ι?AUM��ATM��USH��H��(H�oH�t$1�H��dH�%(H�D$1��PC������H�
#�
�?H��1�H�5(�
軄����H��M���������C4���a���H�{pu	�����H�=ܫ
�=��H�T$L��H��H��H�D$����H��H�D$H��tH�H�|$�PL�u`1�H��L�ehL�mpL�ex�]���H��H�T$dH3%(u.H��([]A\A]A^A_�H���`:���@����C4�d����A�����AWI�ϹdAVI��H�.�
AUM��ATM��USH��H��H�oH�t$1�H���B������H�
�
�dH��1�H�5�
�{�����H��������U����C4�������H�{pu��tTH�t$L��L��H������H��1����H��L�h`L�`h�M���H��H��[]A\A]A^A_�H���`9������C4�ff.�@��AVAUATUS�4�������HH����q�����A������I��I��I��H�o����1���H��
H����@������H����8����HH����c���L�������0L���H���L�����t0H��8�����I��H�
���H�5w�
���H��8H�߾[]A\A]A^����fDH�
��
��H��1�H�58�
�ˁ���W���fD1���H��
H���@����t&H��H�
0�
��1�H�5��
艁��H�k���H����7��H�k����ff.�@��AUATUSH���4����HH��������������H�oI��I��1��AH�~�
H���~?����urH���b7����0��HL���L�����t0H��8����I��H�
;�LH�5'�
誋��H��8H��H�߾[]A\A]����@H�
r�
�AH��1�H�5�
�{����t���fD������H����	�@��H���ATUS�H���W4-���c��H��L�g��v61��$H���
L���>������L���`6��H��H��[]A\��8���1��!H�J�
L���J>����t�H��较��L��!H�5'�
I��H�
��
1����H��H��[]A\�8�����tC[]A\�fDH���p���L��$H�5٣
I��H�
d�
1��`��H��H��[]A\�A8���H�o1���H���
H���=����t2H�
�
��H��1�H�5��
����C4H��[]A\��f�H���X5����fD��H��H�X�����H��(H���:����H���@���G4����H���G4�������H��6H��H���ff.����H���4���G4H�T�
Hc�H�>��f.�H���
H���@H���
H���@H���H���@H��jH���@H�(H���$��������tK��w5H��6��H���fDH�Y�
H���@H��
H���@��uH�ܥ
H��þnH�=�
�1��ff.���USH��H��(dH�%(H�D$1�H����?��H��
��H��H��1��M��H��H���D$H�D$�&6��H�D$dH3%(uH��([]��J:��f.���SH��@H��tH��@�{��H��@H��8tH��8�{��H��8[�f.�f����ff.�ATUSH���H��t@H�L�`H��I�L9�u�,@H��I9�tH�;H���4����u�H��[]A\��1�H��[]A\�fDSH��H��H�� dH�%(H��$�1�H��tH����^����teH��(H�CXH��t5H��荁��H���V��H��$�dH3%(uHH�Ġ[�f�H��0H���AI��H��(��H�� H�S`H�sX��T�����8��DATUS���H��������HL�%��
H���
LD�H��p1���H�j�
H���9�����}H���1��H��H��2H�߾�O��L��H��H���(��H��H�5@�(��H���H���(��H����3��ǃ�[]A\���u8L�%߭
�e����M��H�
�
H��1���H�5­
�z���f�����H�=��
��.��f.�AT�I��H���
U1�SH��pH��H����8����t]H�
��
�H��1�H�5Z�
�8z��H��H�>BH�߾�N��L��H��H���'��H���3����H[]A\��H���P0���ff.�SH��H��X�P#��H��`H��tH�-6H�8H��P Hǃ`[��UH��SH��H��H����H���oN��H������H���ZN��H��H��[]�\l��ff.��AWAVAUATUSH��H�nH9��~���H��I�ξ I��H��M��I���Z��L���4��L��H��H���cc���=H���Z��L���~4��L��H��H����Q��I9�t
H�{�wH��[]A\A]A^A_�f�H���8)��H�<(�o=��I��H;krFH���)��L��H������L;cr=L���4��H��L��H��H��[]A\A]A^A_��b��f�H��H���@���L��H���u@������uH��(t
H��xt�f�SI��H��H�
r	LJ���	H�5�
1��uP��H��x[�ff.��USH��H��HLJ�H���H��P0H���\����xc��,H��p��t2H����I��H�
o+��H�5��
�n���H��pH��[]Ë�(H���Ҩ����u�H��[]�fD�+��H��p1����H�Q�
H���5����tRH�
��
��H��1�H�5'�
�w��I��H�
�J��1�H�5
�
�hO��H��pH��[]�f.�H���(-����2������AWAVAUATUH���SH��H��pH���|����<1�L��p����8H��@f�����<��H��L�$���1��H�j�
L���4����uaL���,��D���1��HuH���H��xI��L��H��H��0��5����I(ujH��H��[]A\A]A^A_����@H���X���L��D���I���E���H��E��L��AWI��1��H�
O�
H�5��
�u��XZ�\���DH��[]A\A]A^A_Ð1��H���
L����3�����!���D���L���ҏ��H�
�
�L��I��E��H�5S�
1��/u����f.���USH��H��pH���z��H��p1��H��
H���Z3����tVL���H�
��
H��1��H�5�
��t��H��xH���H��H��0�5>����I(tH��[]�DH����*����fDH��H��[]���f�S��H� ������� H����HH��pH��t��z��H�{`H��H�5U=[�Oo��ff.�@AVI��AUATUSH��H�� dH�%(H�D$1�H����xL�l$H��p1��9H��
H���>2�����&H���*��H���H�kXL�c`H;{Xt7�dY��H����+��H��� |��L���(��H���H�CXH���H�C`H���B��H��H��M��AUH���L���H���H����x��ZY���oH���+��H������H���H��H�5��d��H����I��H������R�=D����t
��H ��H�{`H��H�5�;��m��1�H�L$dH3%(�UH�� []A\A]A^�fDH�
��
�9H��1�H�5��
�r�����fDH��xH���H;}PttH����H�T$H����zC�����R���H�t$H�=��
1���}��H�D$H��H�=*�
1���}��I�������E���@H�����1��2���f�L�l$H��L���pN����xtH��(H����c������H�s H�T$H�=\�
1��m}��I�����������O��H�s H�=h�
H��1��F}��I���������H�5��
H�t$�A���H�t$�7����.��f���ATI��USH��H��H���H���dH�%(H�D$1�H���,������H��������H��p1���H��
H���O/����u+H��1��1'��H�L$dH3%(����H��[]A\�f�L�$H�
��
H��1���H�5��
1��p���H��p1�����H���
H����.����t%H�
��
��H��1�H�5j�
�Hp���r���H���&���b���H�$�����I�$�M����I-��f�H���ATUSH�:H����H�H��H����H�~H�A1�H����������p�H9������H��H�H�<0�š��H��H���ih��H�;tJL�%��5�f.�H��H�;t-L��H��H���G��H��u�H�UH�}H��H���Y��H�;u�H�uH�}�^��H�U[1�]H��A\�7��f.�[]A\�H������ �O��H�EH�E�Z����ff.�@USH��H���H��t.H��H���c*��1�H��H���U��HǃHǃ�H��[]�f���USH��H��xH��(dH�%(H�D$1��s�����uH��(��H��p��I��1���	H�[�
H���,����tbH�
��
��	H��1�H�57�
�n��H���H���
H���%��H��(H���o*��H�D$dH3%(��H��([]�@H���($���fDǃ���@1��o	H���
H���
,����tNH�
�
�o	H��1�H�5��
�ym����I�H�پH��H����)��H��p�����H���#�����i*��f�AUI��ATI��UH��SH��H���L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$H��H�=�5H�D$H�D$ �$(�D$0H�D$�2f��L��L��H��I��H���.�H�D$dH3%(uH���[]A\A]��)��ff.�UH��(#SH��H��(dH�%(H�D$1�H��H���$$��H��(�D$	H��tH�_ H���(��H��H��u�H�D$dH3%(uH��([]��)��AUATI��UH��SH��H�����H���H��tH�@1�H���H�Å�uH��[]A\A]���[-����H��H��H���L��H���H���1�I��H�FH��H�������A��H��L��1�I��1����I�]I�EH�I��H9�u�+@H�sH��L���I9�tH�H���c�����I t�H���H��1�[]A\A]�3���H�����H����������USH��H����1���H��H��p�p��H��p1���H���
H����(����u H���� ��H���H��H��[]�{���H�
�
��H��1�H�5]�
�;j����f���ATUH��SH��L��pHdžP�����1��<H��
L���`(����ulL���D ���E����H�B�5��8H�4�H��H�:H��P��8H��@H�uH��I��H��A��H���sF��D��<H��[]A\��D�E1�H�
��
L��<H�5��
�_i���E���{���������3H�Y�
�L���'����uCL�����H��p�n��I�غ71�H�
�H�5�
�zA��H��p[]A\�fDL�ML���L��1�H�
��
�3H�5�
����ff.�AWAVA��AUI��H�=��
ATUH��SH��8H�t$�dH�%(H�D$(1��!���PI��H�L��PI�u�"ǀhH���H��L��`L��xD����H�H���Wf�}t�oM���E���H�uH��t	�>��E(	��H�u0H��tL���<F��H���H�uxH��t	�>��H�uHH��tL���ro��H���H�uPH��t	�>��H�uXH��t	�>�H�u`H��t	�>�H�EhH���PH������������t��(�����t��,H���H��tH��0H���H��tH��8�����t��@H���H��tH���H���H��tH��������u�����H��`H���H��H�F:����
�����	�������������u��
���H�}0H����赀��L��H�����H�4@H����F��Hǃ�H���L�}0I�?tOL�t$�f�L��I��H�D$ )D$I�w��X��L��H�D$H���H����3P��I�?u�H���H�����8����������H�=R�
��������H�=��
H������H���H����H��H������H�5p�
��K��H�D$�������H�5D�
H�=��
1���p��H�|$H���i*���������H��
H�|$H�5�!�X��1�H��t��H�|$���H�D$H�T$H��H���H��xH��0���H���H�|$H��p�<K��H��H�L$(dH3%(�UH��8[]A\A]A^A_�fDI����H�5z�
��J��H�D$������
������H�5J�
������H�5�
����H�upH��������>�����L���V��H�����fDL���V��H�������@L�����H�� H�uHH������������L���`��H���H�uXH������������L���8��H��H�u`H���������L����U��H���H��H�EhH�����������[ ������ H�=h�
�u��D������D��H���@��ATUH��SH��H�� L�&dH�%(H�D$1�L����H�������H���H��`��H�D$f�L��)$�,U��H�uH�$H��tH��`��@��H�D$H�uH��tH��`�@��H�D$H���H���H���L��H�D$dH3%(uDH�� []A\�DH������B��H��`Hǃ�H���L�e�E������D��ATUSH���H��t<H�L�`H��I�L9�u�(�H��I9�tH�;H���\����u�H��[]A\�1�H��[]A\�fD����H�H�`H��t�O����ff.�@������D�������ATUSD��(E��thH��tUH��pH��1��=H��
H���e����tYH�
R�
�=H��1�H�5��
��`��H���tB[]A\�D��Iu�[H�ǀ]A\�'f�����H�������fDI�غ@D��H�
V)H�5��
�Zk��H���뗐�����vsUSH��H����(����H��H���tSH����H��p1��ZH�*�
H���u������H���U��H���H��[]�sf������Iu�H��t>H��p1��VH�Ғ
H�������tyH�
�
�VH��1�H�5��
�_��H��H���[]�d��f.�H�
ߔ
�ZH��1�H�5u�
�S_���Y���fDH��H��[]�J,��f.�H������fD������_��H�RAUATUSH��H������� H�����HH�������@��t���H�5�g
H��I���	I��H��hM�l$tH�5��
H���KK�����KH�5�
H���4K����t(��H��������L�ܓ
����H��ptH�5̓
H����J�����H��xtH�5��
H����J�����������P�������f��`��f��LuBM;l$r#��HH��[]A\A]�f���L��� ��H��H������H�5=�
H���AJ����t�H��L��w�����I��tf��L
��H�
�
L��L��H������k���DH�5�
H����I�����E���D��`L��L��1�L�N&H�
��
H���������fDH�5��
H���I�������D���L��L��H��L�&H�
b�
1��������H�5D�
H���YI���������D���L��L��H��L��%H�
�
1�A���8��k���L��
H�
֑
L��L��H���������L��hL��L��H��H�
9�
�������L��pL��L��H��H�
��
�������L��xL��L��H��H�
l�
�|�����L�C�
�[���H��1�H�=a�
1��a=��I���B���f���H�`H��t��I
��f��ff.�@��ATUSH��PdH�%(H�D$H1���I uYH��H��H��t7H���I��H���eH����J��H���1�H���#��H�(L�`���������It"H�D$HdH3%(�4H��P[]A\�DH��p1���H�ȍ
H�������uoH�����f��H��H���ǃHǃ���H��p��_��I�غ�1�H�
/�H�5e�
�3e��H��p�U����H�
as
��H��1�H�55�
�Z���w���fDH���H������H�@1�H����������������H��p����H�������
���@H�!�5�@H��H�8�::���Hǃ�H��H����e�����8��t>H��p��^��I�غ�1�H�
��H�5g�
�5d��H��p�W���f�H��p1��RH�8�
H���������H�
܎
�RH��1�H�5�
��X��H���H�t$0�)������H����H��p1��[H�ϋ
H���������H�
K�
�[H��1�H�5��
�X��H���H���H��L��PH�6���i����8���q������fDH�������I��H�
u���1�H�5D�
�c��H��p�4���fDH���h������H�i�5�ǃ8H�8H��PfoD$0H��@�T$@�P��H�]���fDH���H����L�d$H��p1��fH�D$H���
A�D$H��H�D$��,H�l$(�D$������tOH�
�
�fH��1�H�5a�
�?W��H���H��L��L��PH����_L�����H���r
�����H���e
����H���H�T$H�t$��G������H��p1��yH��
H���6�����
D�D$�yH��1�H�
0�
H�5��
�V���D$H�4���8H���5H��H�8H�V�H������H9��
���H��P�T$H�t$H��@H��H��H���#3������L��p�o�H�C�
L�������tv���c��L���L��H�
ڒ
I���oH�5�
1���
��H��p�`[��I�غt1�H�
�H�5�
�C.��H��p��8�V���H���	������L����������D��H�55\5H�=�
����f���USH��(dH�%(H�D$1������uH�D$dH3%(��H��([]ÐH��pH��1���H�5�
H��������H�
9n
��H��1�H�5
�
��T�����uH�����H�{`H��t��I���H��PtH��P�\��H�����.��H��p�Z��H��x�Z��H����Y��H�����Y��H����t��H���tH�������H���f��H����J	��H���Ro��ǃ���ItOH�� �������fDH���`
��������.���H�5׉
�$^��H�{`�+>������fDH��H���
�(#H�����H��H���D$	���H��H�5��
�G�H��(#H�}�
���H��H���D$	�����L������fD��AW1�M��AVA��AUE��ATA��UH����SH��H��H�=��H����^��L��D��H��H���g�H��H��`H���E��fD���H��pH��H���H�5�
D����F��H��p1���H��
H���,����t8H�
��
��H��1�H�5��
�R��H��H��[]A\A]A^A_�f�H��������fD��ATE1�UH��L��E��SH��H��H��tpL�L$0H���������ǀ8H��H���5H�8H��PH��@�oE�U�P��H��D	�HH��H��[]A\�f.�H��L$A��t$D�L$�El��D�D$�L$H�‹t$�`�����AU1�I��ATA��UH��1�SH��H��H�=��
H���C3��L��D��H��H�����H��H��`H���D��H��p1���H���H�a�
H�������t0H��1�H�
:�
��H�5=�
�Q��H��H��[]A\A]�DH���`��H��H��[]A\A]�f���H����h�����������hH���ff.����USH��(H�dH�%(H�D$1�H���h���g�������h����I����������IuH���f�H���>��H�����U��H����U��H��p1��	H�>�
H��������AH���i��H��(tH��(�k��H��H�7�
�(#H������H��H���D$	���H�5�
H���j�H��
�(#H�����H��H���D$	����H��(H��t�H�o �WA��H��H��u�H������H��@H��tH���5H�8H��P Hǃ@H�����H���H��t
H�H����PH���H��t
H�H����PH��`H��t
H�H��`�PH�D$dH3%(u+H��([]�f�H�
,t
�	H��1�H�5Ձ
�N���������f�U�eH��H���
S1�H��H��pH�|$H����������H���UR��H�
��
�eH��I��H�5i�
1��EN��H�|$���H�|$��I���H�|$H���=�H�D$H��(H��t@H�_ H���|
��H��H��u�H�D$H��H���D��H�D$H�|$��I��	��H��[]��H������n�����AVAUI��ATA��USH��H��@dH�%(H�D$81�H����L��pH�չ|H���
�L����������L�����f�)D$ M���b��������H��pH�l$ �R��A��*#��H�D$ H��H��D�$$H�D$H�D$�D$	�D���H�D$8dH3%(��H��@[]A\A]A^�I��H�
��L��1��|H�5�
����P���f�)D$ H��t[L���V���f���8��<9��m�����1����O���I��H�
�����1�H�5b
�$��H��p�P����_	���S���f.���S���H����t]��u8��Mb���,H�=|�
1�����W��H�߾+#[H�
��
H�������t[��H�=�~
���f.���Mb���,H�=�
1������PW��H�
%�
H��H�¾*#[�8�����Mb���,H�=��
1�����W��H�
Ӂ
��ATI��UH��SH��H����H�= s
1���V��L��H�=ʈ
H��1���V��H���I��H��ti�)��H������H��H��H�=��
1��V��H��H����5
����t1L��H��H��[�*#]A\�j��f.�H����
����upL��H��H��[�,#]A\�9��f�H�=!�
H��1��V��H���I��H��t��k(��H���„�t�H��H�=�
1���U��H���W����H���h~���Q���f���H�W`�B�� tP��htKUSH��H��H���j)��H�{`H���~���H��H�=�A
H��1��U��H��H��H���
[H��]�r���f�H���
H�5҇
�]���ff.�f���USH��H�o`��HH��t&H��H���3��H���s&��H�߅�xH��[]�qE���H��[]�f�H��[]��D��U1��"H�:|
SH��H��H��pH���v����tZH�
�
�"H��1�H�5|
��H��H��p�P}��H��p�KN��H��H��1�[H�
�
�)#]�o���H�������ff.���AW�ZH��{
AVAUATUSH��H���H��p1�H�<$H��dH�%(H��$�1��������H�
@
�ZH��1�H�5A{
�H��H�$���8�����cvn�����u��H��u��=��H�4$H���>���H��$�dH3%(��
H���[]A\A]A^A_�DH�������fDH���H��P0H�����Hǃ�Hǃ H��)���(1����H�������H�$H�@H�8H�h��H�D$PL�t$HL�l$8L�d$@H�D$�^H�|$@�6U��A�ǃ��2���2����=u"H���H�t$8�A%��H���f.�D	��H��H�}�H���L��L��L���3�����L��p���H��y
L���������L�D$H��L��1�H�
�
H�5~y
��
���f.�H�D$8H���r���H�8H���f���H��������R���L��p���H�'y
L���r�����CL��H�
��
��1�H�5�x
E1��J
������DH�T$@H��H��H�T$���H��H�D$ ����H�D$8H�T$H��H�D$(H���H��H�D$�^��H�������H���L�D$ �+H�D$f�H�|$L�D$)I�0��7��H�t$(H�|$H�D$P�#��H���H�t$H���H�D$X�|/��L�D$H���H��I�P����L�D$H���H��I�P���������H���H�t$8�'#��H������L���������H��p1���H��w
H���������H�
�{
��H��1�H�5�w
�fD��H��pH��t��J�����uH����.H���pH���@����H���<�����H�v�����H����2H��p1���H��v
H���E������H���%���H��H���=�U��H���H��H���^0�����MH��H���f�H��)D$PH���iH�D$PH�T$XH��H�t$PH��H�D$`���H�L$HH�T$@H��XH�t$8H����?�����*H�D$@L�l$pH���������H�PH��H��H��H�<��(Y��H�T$@f�1�I��H�t$8L��D$|H�^�5M���$��$�DŽ$�H�D$p�D$xHDŽ$������>��L��L���_-��H���gT��H��`I���w��I�l$H���tH����L��H�DH=������H���F��H�پH��H��`H����H��L��H�5z
H��1���H������H��hǃ�����@H���@����u�����H�߈�H�7�����f�H�����������O��H�������H��p�G����I�1�H��pǃ���H��t
H����������H�
�u
��H��1�H�5Zt
�8A��H�4$H���L��H���$��H�������9���������H��p1��H�t
H���V������$H�
Gx
�H��1�H�5�s
�@��H��H��H�߾���H�5%I
H��H���8�H��������H������C���H��H����?��H�5x
����L� H��M��u��H��L�eM����H���L����,����t�L����>��H��H���y���L��H�=�
1��K��H�D$HH��H�=�w
1��K��H�
�
�+#H��H��H�D$H�
�����H��H��p�1���H��r
H�������������L��H�
(w
H��1���H�5�r
�i?�����@H�
}v
�-#H��H���	
���f���H�
�v
H�~
�*#H�������F���L����H��1�L���H�
~
H�5r
�>���/���H��H���H������L�%E"H��L��L��H�5�v
H��1��L����L��E1���������1���H��q
H�������������H�
v
��H��1�H�5�q
�l>�����H�-��5����H�
�u
1Ҿ+#H������b���H�|$�@L�D$H������L�D$Hǃ�H������H�T$P���L�d$HH����O��H�=�}
L��H��1��I��H�
~
�+#H��H��H�D$H�������H��������(�H�پH��I��H���~��A�<$H���b������H��H�=�|
1��#I��H��H�D$H�g���H����9�����H��H�=|
�H��H��H�D$H�>����X������AT��I��H�(p
USH��H��H��p1�dH�%(H�D$1�H���Q�����t}L����@��H�
�t
��H��I��H�5�o
1��<��A�$-���cw]H��H���|����x`H��pH��t�C��H�����H�D$dH3%(uQH��[]A\�fDH����A�$-���cv�L��H�����DH�$H�
�|
�*#H����	����I���f���AVAUATUSH��pL��hdH�%(H�D$h1�HdžhM����p���H��H��=N��-���c�D���uH�����H�����H��p1��0H��n
H���������H�
�s
�0H��1�H�5{n
�Y;��H��pH��t��A����HH��詿��H�D$hdH3%(�(H��p[]A\A]A^��H�GH�x��H��`H�8�H�?�H��H�����H�����H��`H��H���^�L��H���O��H��`H��hH��tH�	�5H�8H��P Hǃ`�G���H���������L��p�(H�zm
�L���������H���0>��H�
�q
�(L��I��H�5Dm
1���H��H���u������=��H�=�z
H��1��E��H�
$r
�+#H��H��H�D$������f�H���=��H�=�z
H���@L�����fD�3���I���k���I�UH��H��H�4R�g��L��L�-�51�I��H�EM��L��H��A�����BH�l$I�VH��XI�6H���2������H��XH�T$H�t$H����5������H�D$H�l$ H���������H�PH��H��H��H�<��O��H�T$f�1�H�t$I��H��I��D$,D$<D$L�D$\L�l$ �D$(H�D$0�����!4��H��L���f#��H�پH��H�t����o��H��`H��H���
�L��H���2M��H��h����fDH�t$H�=p
1��C��H�D$H��H�
}p
�+#H���������H�EH�=)y
H�01���C��H��H�D$���(������AT��I��H��j
USH��pH��1�H���5�����tqL���;��H�
y
��H��I��H�5�j
1��7����H���|l��A�<$�tQ�����t"H��pH��t�=����H����Ht[]A\�H�����fDH��[]A\餻��@L��H��[]A\�����H��H�|$��H�|$�/#H�
}o
H��x
���H�|$���H���f���UH��SH��H�|$H��pH��t
�M=��H�D$H�x`����Å�~yH�|$��H�D$H�x`�$��H�|$�wH����x;H�D$H�h`H��t2��Hx)H��� ��H���l����yH�|$�����	@�����H�|$�)�H����[]�t�H�|$���H����[]�ff.���AWAVAUATUSH��H��H���dH�%(H�D$81�H�|$ H���H�D$0������D$H����������fDH�D$ H�xX����A�ă��t���H�D$ H���������t�E����A����{j��H�D$ H�xX�4��H��H�D$ H�xX�S��H�s H��H�=
w
H��1���@��H�|$ �*#H�
zu
H��H�D$0����H�D$8dH3%(��H��H[]A\A]A^A_�f.�H�D$ H���������H�\$ H��pH��t�A;���H�\$ ��H ��H��L�l$0L�d$(��H�D$ L�t$H�x`�"��f�H�D$ H��H��(H��t
����K�t$L��L������FH�=�l
�UE��H�\$ H�l$(�D$������E=��H��H���$H;� tsH�����A�Nj������H�{`��L���������h��E���6���fDH�D$ H�x`H��t
��H�7H�|$ �k��i���fD���u�-���c�YL��p1��H�af
L������|H���7��L��H�
l
�I��H�50f
1��3��H������L��L��� ���������H�D$ H�xX���}�W��i�����&�M�����uH�|$ ��I�'H��k
1��Y�f�������H�D$ H�X`H������H���H�����H���i��������H�|$ �������f�L��p1���H�He
L�����tWH���6��H�
 t
��L��I��H�5e
1��1���E=���H���Q���L���������a����
g��@L��� ���fDL����H�����@H���(���H�\$ ��fD������H�D$ H���������Z������f�H�
�s
-�H�ʃ�cvoH��H����H�|$�'����������kf��f.�H�|$������n����Jf��f�H����4��H�=�i
H��1��<��H�
�i
H��H�߾-#���H�|$����������e��f�E���������e��f��{��H��H�D$ H�xX���H��H�=�(
H��1��6<��H�|$ H��i
H���"������G �����t���������H�t$0H����e��H�=�i
1���;��H�|$ �-#H��H��H�D$0�����y���H�
4i
�-#H��H������]���H��H���B�H�|$�������0����e��H���3��H�=}h
H��1��o;��H�߾-#H�
yh
H���X���H�|$�~���������d���H��m
1��2����������AUATUSH��H��8dH�%(H�D$(1�@���6������{@��<��H���H����H���H���,H�CXH��H���H�C`H���莲�������H���Y���H�����H�D$(dH3%(�BH��8[]A\A]�f�L�d$�<H�T$L�������"d��H��p1��~H��a
H���������D�l$L����H��H�
�p
�~H��I��E��H�5Qa
1��-.������H�t$H�������J���H�s H�T$H�=�'1��9��H�
Mn
�*#H��H��H�D$��������{<�(������H��p���H��`
H�������L���H�
:p
H��1���H�5�`
�d��s�����{@� �����L���H��p���H�]`
H��������L���H�
�o
H��1���H�5.`
������H��p�q�H�`
H���P���u,H���4���H�����H�������L�C H�
3f
H��1��qH�5�_
���DH���������H������_�����fD��U1���H�j_
SH��H��H��pH������tbH�
�e
��H��1�H�57_
�,��H��p�1���������H��1�����H��H��1�[H�
Al
�*#]���fDH���(��fD��SH��H�dH�%(H�D$1�H���IH�$� ��H��(�� ��IH��tDH�_ ���H��H��u�H�$��H���	�����H������H���O���H�<$��H�$H����0��H�$H����0��H�����H�D$dH3%(uH��[�����SH��dH�%(H�D$1���XH�<$��th��tD������H��H�GXH��t�P����H��h
H�5Id
�7���H�D$dH3%(�H��[�fDH��p1���H�X]
H������uOH����H���?���DH�w 1�H�=�l
��5��H�<$�*#H�
�`
H������y���f�H�
�c
��H��1�H�5�\
��)��뚐H�
j
1Ҿ*#�m����8����H���x��H��H�$H�xX���H��H�=�!
H��1��45��H�<$H��b
H���!����������H��Ht��H��HH��`����D��SH���H��tH���� ��H���H��ptH��p�'��H��pH��xtH��x�'��H��xH���tH����k'��H���H���tH����N'��H���H����H��(H��tH�����H�[ H��u�[�ff.�f���AT��	H�[[
UH��1�SL��pH��L������taH�
�a
��	L��1�H�5&[
�(��H��0H�E H�EH��0H��t5H�h H��0H��1�1�����H��[]A\邯��f�L������fDH��(�����AU��	H��Z
ATUH��SH��1�H��L��pL��(L�������td��	1�L��H�
Da
H�5iZ
�G'��H�SH�C H��tOH�B H�C H����H�SH�PH�C H�CI9�t<H��[]A\A]ÐL���X��H�SH�C H��u�H9�(u�H��(H�C �D�������\����u���IH��Dž�H��[]A\A]�Y���f�H9�0�j���H�CH��0�Z�����AT��	H�{Y
UH��SL��pH��1�L�������}H�
9`
��	L��1�H�5BY
� &��H9�(�\��H�CH�S H����H�P H�C H��tEH�SH�PH�C H�C�������[����t9[]A\�@L������fDH9�0u�H�CH��0�f.�Dž�[H��]A\�:���f.�H��(�f���@��AT�UH��H�="n
S����8I��H�L��PL��L� �oEH��@�E�CH�u���H�C �E(�C0H�u0H��tL���W��H�C8H�E8L��H�C@H�u@���L��H�CHH�ux���H���H�uHH��tH�;�w,��H�CPH�uPL���g��L��H�CXH�uX�W��H�C`H�EhH�CpH���"����0uH���L��Dº���������D�H��������H���H��HDºH���H���H��HDºH��������D�H������H���H���H���H��������
���^�������YH�5�l
H��0H���
��H�5��5H��H���%����H���1��H��[]A\�f�H�upL������H�Cx����ff.���UH��SH��H�H��0���H��(tH��(����H���	��H�H��t	H�H��PH�EH��[]�f���SH��0H�H��t@H���`���H�[H��u�[�D��SH��dH�%(H�D$1�H��(t1�H�L$dH3%(uZH��[�DH�GPH��H��t2H��(H��H�����y�H�4$H�=�\
1��-��H�������H�s\
H��������L��f.�f���USH��H��H�o H�6H�����,����u����C�������8�t�KH��[]����ATUH��SL�g(H�_ L���5������W��L�������tzH9��txH���05��H���H��tH�ݩ5H�8H��P Hǃ�H�}��%��H���H�������U���	Ј���U���	Ј��[]A\�f�Hǃ��x�����AWAVAUATUSH��H��(H�o H�(L�g`���I��H�C(A�D$H�@0t'H�5�5H9p�EW��H��(L��[]A\A]A^A_�@H�5a�5H9p��V��L��(E1�M��tI�F1�M�6H��0I��1�1�L�=T5f���	v(D9�s���H��L�L�H�RL��L��������	w؉�D9�sC�ډ�H��H��H�L$L�H��L�I�<H�T$L��L�D$���L�D$H�L$��H�T$y�H��L���A�T�u���D��H���C7��H��H������AWE1�AVAUA��ATUH��H��SH��8L�u dH�%(H�D$(1�I��XI���H�D$H�E(H�D$��H�D$ �?��D��H�T$ ��@����H��A�����A�����gH�}�A��A��H��PH�t$ H�}H�����D��H�D��D�c���H�t$ A��A	��CA	�D�c��L�d$A	�D�{I�\$`I����)�������KI�����H��H�z���1�L���0-��H�|$H��H�������-��H�|$�M+��H�D$H��tH�H��tI��`H��H��Ѕ���H�|$�������H�|$�H�H�D$(dH3%(��H��8[]A\A]A^A_�DA������D8��4���I����8���@I����(���@1ҾL���i����@H�
lg
H���H��1����S1���f���fDI���A�������H����/���1����(���H�|$������������S���^��ff.���1��e���D����R���f���ATUSH��H�_ dH�%(H�D$1�H�G(���H�$��S��H;����S��1�H���H��L��X�e�H�<$�)��M��tWI�D$H��tMH��`H���H�<$1�H��þ�+����;ujH����H�D$dH3%(udH��[]A\ÐH�<$1ɾH����*��H�<$�����u�H�
�g
H��g
��H����/����H�<$�����u���R������U1��H�(g
SH��8H��xH��XH�|$H��dH�%(H�D$(1��������H�
S
�H��1�H�5�f
�|��H�|$H��tzH���tpH�GXH�|$H�D$H�G`H�D$ ���H�D$H�T$ H�t$H��`���H�|$���d�����<��H�T$ H�t$H�|$����fD������x\H�|$������R��H�����Q�����H�|$����1�H�L$(dH3%(u4H��8[]�fDH���������H�|$H�5f
�r
��f����������@��USH��H�_ H�{`tH�o(H������uH��[]�@��H���S�����Q��H�{`�r��H�������x�u4H�{`�G��Q��H��H�5,���H�{`H���[]���H��H��[]��f���SH���3�����[��H�{`�3��H�������yܸ����[�@��USH��H�_ �����xt+��Q��H�
,e
H��H�8e
��1�[]�-���tT�>u/H�o(����H�����H��H��1�[H����1�]��'��DH��H�
e
H�e
1�[��]�,��H�
�d
����ATUSH��H��0H�W(dH�%(H�D$(1�H�G H�L$ H�t$H�T$H�T$H���H�D$H��X�]����IH�T$H�zX�G ������y��H�D$(dH3%(�$H��0[]A\�@H�D$1��nH��d
L��xL�������tzL�D$�nL��1�H�
�d
H�5�d
���H�����H�|$��$��H����O��H�EH����O��H�T$H��H��`H�T$�Ѕ�&�pH�|$����@����L������fDH�|$�
�����H�D$��x���,��H�|$H���N
�����f�H��x1��VH��c
H���������L�D$ �VH��1�H�
Md
H�5�c
�	��H���ѳ���D$��tt��uCH�
�c
H��c
��H��1��*��H�T$��y�c���H���|!���V������t�fH�=8c
���f.�H�D$��yH�
-c
�H�������b���H�
��
H�Vc
��H���*�������H�|$�������~���� N���T��@H��H�W H�
c
��xuH��(�u	H���@H�
�c
1�H��b
���)��1�H���ff.�@��AUI��ATUSH��H��H�o dH�%(H�D$1�H�G(L��XH�$�d�����u H�D$dH3%(uzH��[]A\A]�D1�H����H�<$�8"��M���^M��I�D$H���PM��H��`L��H��Ѕ�uH������H���>��@H�<$�
����u��=M���!�����USH��H�_(H�o H���f
�����eM��H���&���u
H��[]���H���������M����xH��[]�D��H�G �����AVH��H�5��
AUATUSH��L�o(H����(��H�
�b
H�(H��tL�`M��t2H�xt+H�
5`
H��H�>`
[��]1�A\A]A^��'��fDH�������u,[]A\A]A^�H�
a
H��_
��1��'��fDH��蠰��H�;�H��PH�;H��I���T��L��I�H�;�F��L��L��1�I�FH�����>"��[L��]L��A\H�����A]�A^�"��ff.�@��ATUH��SH��L�g H������H��H�߾�I��$�L�a�
[H�
,xLE�H�`
]1�A\��&��ff.�@��USH��H�G(H�x@��K��H�@0H���5H9P��K��H�o H��H��1��NH��wH�����H���Z�H��H��H�5����[]��
��D��ATUSH�_ H�o(������K����H��I���������eK����u-H������u	[]A\�@L��H�����H��([]A\ÐH���x�����J���ff.�ATUSH�o(H��L�g H���y����u5I��$(�t1�H�
�b
��H��H��^
�%��1�[]A\ÐH������u�H�������u���fD��UH��SH��H�_ �z�����uH��[]��H�}�o��H��H�߾[H��]�	��f���H��H�G(H�E�5H�@0H9P�~J��H�
�a
H��a
��1�H����$�����AWAVAUATI��USH��HH�o H�t$D���L��XdH�%(H�D$81�H�G(H�D$ H�D$������uH�\$H�����H�5ha
H��������s�C< ��<	��H�sH�t$�C�"��t�������ۃ��*��H�4$L�|$(��P�� E�����H�4$H�L$ M��L�L$��H��������mH�T$�
�� ��������yT�� �ZI��H��x1���H�h`
H���&������L�D$(��H��1�H�
�_
H�5;`
���I�<$�`H��P���H���mH��8H��tH�AH9�@�'I��H�	AWI�<$D��L�KE1�H�D$PH�t$����ZY����A��tH���H���eH�t$ I�<$�ϴ��1�H��H�c���H�H�Y�5H�|$�oCH���H�|$H��H�8�����n��H�;����H��H���f����H�|$���M��t@I�~ t9H�5�_
H���*��H��`H��L��H�D$0A�V H�|$0����������H�|$�������H�|$�d�@H�D$8dH3%(��H��H[]A\A]A^A_�DH�
Z
H�Z
��L��1��!���f������H�sH�t$�C< t<	�`���H�{fDH�|$�H��H��< t�<	t��:���@H�T$ H��t
H�:��L�D$(H�
~^
H�}Y
��L��1��*!���%���DH��H�T$�^���f��D$��tx���	L�D$(�+L��1�H�
!rH�&Y
�� ��������HX����H���H���W���H�RH���W����:�N�������DL�D$(H�
�q�?����H;C0�����H�
]
H��]
L��1��(�Q ���L���@�4���H�|$������"����
F��H�
y\
�K���@H�
9\
�;���@L���p�������V����H�=�\
�u���D��H���Է��@��AUATUSH��H�_ L�g(dH�%(H�D$1�H�H�$�����F����H��L��I�����>������E����u]L������t1I�EH���Q��H�D$dH3%(uBH��[]A\A]�fD�� H�}(1��.��H�<$H������L������t��.E���Z��f.�AVA��AUATUH��SL�g(H�_ L��L��(�����u_M��tz�����u�[]A\A]A^�f.�L���H��9��w�1�H�
�]
��H��H��]
�s��1���L��������u�L��������u��fD����tE��t�H��1�H�
Z]
��H�iW
���[1�]A\A]A^Ð��UH���SH��H�_ ������uH��[]�f.�H�EH�x ����H��H�߾[H��]���ff.�f���H�G(H�1�5H�@0H9P���D��SH�G(H�X`�n�����D��H�;H�
pZ
1�[H��\
���������AWAVAUATUH��SH��L�g H�t$1�E��$�M��$XdH�%(H��$�1�H�G(H�D$0��������H�\$H�����H�59\
H��������CA��$�< ��<	��L�{L�|$��H�\$@��҃���$�T$����$H�L$8I��L�L$L��H�����L�D$@H�
�[
����H�D$��� ��H�
�Z
����E��$ H�D$8H�x�vM��$HA��A��M��tI�@I9�$P��B��M�H�t$L�D$H�t$����L�T$PSD��M��H��H�T$4RL�D$ D��H�t$L�T$褩��ZY��L�$��D$,����L�D$@H�
�lH��S
��H��1��x���H��$�dH3%(�H�Ę[]A\A]A^A_��H�
jS
H�vS
��H��1��#��뱐����L�{L�|$�C< t<	�Y���H�{f.�H�|$�I��H��< t�<	t��/���@����L�D$@�+H��1�H�
�kH��R
����0���H��H�D$�[���f�H�t$8L��H���0���H�}�I��H��P1�H�U���L�0H�|$0H��H��H�G`�.��H�|$0H��H�o�������H�|$0H��H�F�������H�|$0A��$�)��M����@��I�}(��@��H�5�Y
L������I��$`L��H��H�D$HA�U(H�|$H���c�����GuiH�|$0����>���fDA�������H�8H�5Y
����H�
Y
���b����B���H�|$0�.�����u�H���R���H�
�W
����H�|$0�
�����u��`@�������H�=FX
軹��f.����SH�_ H�(�����u��X[Ð��H�G H��(H��t<H���H��t0USH��H�H�hH�H9�tH�;H���\���H9�u�H��[]��ff.�@��USH��H�_ H����?����$���@����H�o(��$H���&�������?��H��������u��$��u��XH��[]�f.���USH��H�o H����?��H��H��0H9tH��H�{[]�[����Ft2H��0���H��8���H�{HDž@H��[]� ���H�(�G����t�말��USH��H�W H�o(��$���w?����H����$����H�������tH��[]�@H��H��[]����f.���USH��H�o H���H?��H��H�~荢��H��(H���T?��H���E��H��H��[]�������H��H�G ���F?��H��0H��t;H����H��t%H;
s H�(1�H�
hS
H��S
�(���1�H��øH���fD��USH��L�G(dH�%(H�D$1�H�G L�$I�h`��H��tH�
UX
��X��H��(H�����HtR����u#�����H�����m������H�T$dH3%(����H��[]��]��u�H�
X
H�O
L��1��������������p���H�
�T
H��N
��1�1�L������~���fDH��t
������a���H�}t�EuYH�<$H�
|(
1�1�H��N
���I����4���@L�$H�
S(
�*1�1�H�]N
L�����������H��1��F������L���ff.��AVAUATUSH��H��0dH�%(H�D$(1�H�G H�D$H�G(H�D$�������H�|$�8��H�|$�
��L�k(H�k M�u`L��XM���I=��M���=��I�|$@�=��H�5�T
H���.	��H��`H��(H��H�D$A�T$@H�|$A���Ʒ��E��yaH��0�@����L����������<��A�H�|$�O��H�|$�U��H�L$(dH3%(D����H��0[]A\A]A^ÐH��A����������t�H��0������A�F��I�~�v������H�k1��'H��S
H���������yH�
�S
�'H��1�H�5�S
�o���H�C(H��H�h`�/���H�}膞��H�����������L�EH�
�S
H��1�H��J
��A�������f.�H��0��H���H�k1��+H��R
H���Q�������H�
LS
�+H��1�H�5�R
���H�{ A��������H�C H�[(H�S`H��0H�D$ ��X�B������1��H�zR
H��H�D$ H��xH��轼����u)H��衴��H�|$ H���$�A���������f�I��H�
~T
H��1��H�5R
�����fDH�{ �����f.�H���h��u�H�
`R
H�lR
��H�������L�c1��H��Q
L��������tRH�
�Q
�L��1�H�5�Q
�u���H��0H��(A�H�0�Y���H���!���H���I�����@L��蘳���fDA���������DH���x����W���H���k�������1������SH��H� ���H��[����fD��AWAVAUATUSH��8H�o dH�%(H�D$(1�L��(H���A:��M���:��H����9��L�wH�G(H��I��j1�H��P
L��XL��H�D$�Ӻ�����{L��賲��L��H�����H��������5A�D$tA�E0��H��1Ҿ����H��@H����I�t$H����9���S���A�D$��-���L�kH�D$1���H��O
L��H�D$�)������QL���	���H�|$���M����8��I�8��8��H��0��H�5�O
H�����H��`H��0H��H�D$ H��(A�W8H�|$ A��谲��E���7H�|$�]����t&H�|$�����A�D$�3H����H�D$(dH3%(�DH��8[]A\A]A^A_�H�
�O
�jL��1�H�5�N
�����k���fDL�k1���H��N
L����������H�
wO
��L��1�H�5�N
�y���H��@荺��A�D$�}���f�H�
UO
��L��1�H�5^N
�C������fDH�����(���I���1�H�|$H�@I�������������H�|$������6��H�|$��������H���`�H�5���H�������@L�������2����ֶ���6���AUATUSH��H�o L�o(H����7��I��H��H��0H��tH���Q7��H��0H�����H��0H��C��}H�٨u6H���L������H��u6H��H��L��[]A\A]�+���H������L�����H��t�H��H��L��1�[H�����]A\A]�|��@L��萕���C�r������ATUH��SH��H�_ dH�%(H�D$1�H��H��(��6��I��H��tH�����H�������tU��H��uj1ҾH������bH��1�H�I
�m��H����1���H��L��H��H�$�o���H���7���H�D$dH3%(u/H��[]A\�fDH�}(H�
�L
H��D
1�����������>��ATUSH��H�o(L�g �o���H�;� H��PH��H����1��HH��H��H�E`�"��H��H��H�0����H��H��H�i�����H��H��H�������A��$$[]A\��H�
C
H�C
��1���
��ff.���AT� USH�o L�g(H�?H��P�L��HH�Ë�HH�م��P����H���C��	�H���CI�\$`�8��H�پL��H���!����$��Xu
H��@t[]A\�f��C��4��H��8��4��H��@� �G���H��8[]A\�ff.���AWAVAUATI��USH��I�l$(L� H�4$L�u`I��(D�D$M����4��I�Չ�H��tL������L���������L��I�P��I���H9�s	H����I��P��uk���l$H�<$M�n��A�^��I�~��T-	É�	�A�n�
��I��8L��L�����I��8�\���1�H��[]A\A]A^A_�H��H�>��T���L��H��H������e���I�|$(1�H�
ZE
H��E
�(�������똸�����ff.���ATUSH��H�� H�o dH�%(H�D$1�H�D$H�D$���@��I����L��H�5r�
����H�8I��H��tlH�t$�¶����x^I�|$H����I�|$H�
$@
����H�%@
H��1�����H�t$H��tC��xx:H�������H�D$�'�H�
I
H��?
H��1������H�D$H�|$���H�D$dH3%(��H�� []A\�H�
�@
H�a?
���H����fDE1�H���H�t$�<��H�T$D��H��A�H��H�D$�~���@H�5�
A������t�H�
oH
����A������USH��H�_(H�o H��������1��H���F����t"H��(H��t�q���H��H��[]�s��H��[]�f���H��H�G(H��y5H�@0H9P��1��H�
\C
H�>
��1�H���A�����ATUSH��H��H�o dH�%(H�D$1�H�G(�>L��XH�$uy����H�<$1ɾH��������H�<$����M��tI�D$0H��tH��`H��Ѕ�~eH�<$�|���tHH�����H�D$dH3%(uTH��[]A\��H�
�=
H��=
��1��v����@H���X����fDt�H�<$����u��0��觮�����H��H�G(H��z5H�@0H9P��0��H�
B
H��<
��1�H��������ATUSH��H��H�� H�k dH�%(H�D$1�H�C(H�T$H�t$L��XH�$�����xhH��谍��H�<$����M��tI�D$PH��tH��`H��Ѕ�~pH�<$�?���tSH������H�D$dH3%(u_H�� []A\�f.�L�D$��H��1�H�
�J
H�w<
�.���@H������fDt�H�<$�����u��/���_���f.�D��ATUSH��H��H�o dH�%(H�D$1�H�G(�>H�$uhH��L��X���H�<$����M��tI�D$XH��tH��`H��Ѕ�~aH�<$�@���tDH������H�D$dH3%(uPH��[]A\�H�
�;
H��;
��1��>����@H���p���fDt�H�<$�����u���.���o���f.�D��H��H�G(H��u5H�@0H9P��.��H�
SJ
H�]J
��1�H��������ATUSH��H��H�� H�k dH�%(H�D$1�H�C(H�T$H�t$L��XH�$��������tbH�<$���M��tI�D$HH��tH��`H�T$H��Ѕ�~UH�<$������H�����H�D$dH3%(uyH�� []A\�H�
::
H�F:
H��1��������Őt�H�<$����u��-��@L�D$��H��1�H�
MH
H��9
����@H���H����o������f.�@��ATI��USH�_(H�o H���5�����-��H�������u	[]A\�@H���0��[L��H��]A\�Q�����USH��H�o H��(uHH��1�H������L���1�1�L���H��H��H�
j\
[��]����f.�H��H�
�H
H�:
1�[��]�����AWI��AVAUATUSH��hdH�%(H�D$X1�H�G H��H�D$H�G(H�D$0����)H�D$H��(H�D$H����H�|$H��H��XH�D$観�����>I�?�PH��PH��H�5l�
I������H�(H��H���H�D$ L�l$8L�d$@�jf.�H�l$HH�5hH
H���̎����t8H�5�!
�H�����I�v���HH��������V�H��H�+H����苭��L��L��H��H���������H�|$@�(��H�|$HI�t$L��H�D$@�������YH�T$@�H�=!
H��������6����H��H�=_
������HH�l$HH�5�G
H��������L���I�V �H���{������3���I�v I�?H�����H�+I�F H���#���H�\$H��tH�C1�H�t$ A�FHH�I�F@L��與��H�|$0L��1�H�7����R���H�|$0L��H������9���H�D$�����H�|$0�\���H�D$H��tH�@`H��tH�\$L��L��H��`��H�|$0�k����$f�H�
+F
H�@F
�&L�����H�D$XdH3%(�3H��h[]A\A]A^A_�f��H��H�=v
�����uvH�l$HH�5F
H��肌�������I�?H���O��I�F(����fDH�}H�|$H�r�����xfA�~
�����H�
�E
H��5
��L��1��5����K����H��H�=
�����u>H�l$HH�5�E
H�������Z���I�vH��������F���H�
�E
�D�H�=�
H����������H�=y
H�������upH�l$HH�5E
H���|��������I�?H���I��I�F0����H�
QD
H��5
��1��V����l����H�
�5
H�Q4
��1��6����L�����H�=�
H����������H�=�
H��������uH�D$H��H���?���H��I�/�������,���H�|$��H�t$ H�|$���H�T$ E1�H��������t�H�t$@H��H�L$(�T��H�L$(H��H�H�t$H�?��H�L$(H�A����L�D$8��L��1�H�
�C
H��3
�>����T���f�H�|$H�����H�=�
H�D$HH����€���uBA��Z���f.�L�L$8L�D$@L��1�H�
EC
H�3
�����������H�=r
H����€���tJH�ƹH�=Z
�������A�����H�|$HI�v8�a�������A�F8���A����H�|$HI�v<�5����������H�
C
����1ҾH����������H�qH�H��H�T$ H��H�D�H)�Ѓ���U�����1҉׃�L�>9�r��>���H����H�����H�D$ H�D$���H�
cB
�S������H�
�B
�B���f.�H�?��USH��H��H�oH��t@1��H�|B
H�������tJH�
�

�H��1�H�5XB
�]�H�{����H�{H��tH��H��[]����@H��[]ÐH��舛����fD�ff.�@ATA��UH��SH�hH�_htcH���3���H��@ �M%��H���.����C tH��B|���	%�����B|�c �H�}�OH�5�A
�+��H�CH��[]A\��H����'�GxH�?H�4�H�����H�Ep(H��H�Eh�Ex�p��1���H��D��薁��H��두AWAVAUATUSH��H�GH���%��H�XH�{��$��H�xI��A��觟��H��I��茔��H�kI��E���|I�EH�D$�
L���F���H��H����$��I9���$���x�
��$��I��L��L��M)�I�W����I�GH9�rPH)�I9�s9H�D$� L��L)�L�$�(���fDI9��$��L)�M��p���@H��[]A\A]A^A_��$��@AUATUSH��H��H��ʞ��H�{H��L�g誓��N�, L9���$���
H��H���m���H����H�PI9���$��H��I��H)ڀx
��$��H9�tTH�1��;<tH��[]A\A]�f.��>H������H��H��t L9�w��#��H�HH��H)�I9�v!�z tH��1�[]A\A]�fDL���H�I9�s��Z$��UH�5
@
SH��H��H�/�WH��A�H�CH�{H�5����+��Mx��v3�CH�=�?
�PH�C�01����H�{H��H��[]�G����H�CH�=�?
�01�����f.���AWAVAUATUSH��HdH�%(H�D$81�H�H�H�D$��8���=g��#��I����H��H��u=H�G90uMH�x1��R���u>H�D$8dH3%(��H��H[]A\A]A^A_������H�G;0���H�|$��H�5?
1�軇��H�D$I�GH����#��H�PH�T$0H��tH�zu,H�L$H��H�HI�GH�|$�I�_�t��H�C�]���H�1i5�H�8���I��I�GH�x�4���H�|$0I������H�T$0N�, H�RH��L)�H�L$I9���"��I�GI�V�
L��H�P 轠��H����"��I9���"���x�
��"��H�|$H��H�D$ 辛��H�t$L��H���~��H�D$ L��L��L)�H��H�D$(�c��H�D$(H;D$��H�L$H)�H��I9�sL�l$ L)�H�D$M��X���fDH�|$0�^��I�GL�pI�G����Hк��Q����9��U"���}.�K"��H�G;0t+@H�|$H���1�H�5g=
����H�D$�H���艜��H�xH���-��������}������"��@��H�GH��tH�@H�H�G��D��AWAVAUATUSH���Gx���"��A��9��"��H��A��I��L�?����H�xH��D�`H�(tFL��D��H���ؠ��H�!g5H�k�H�8���H��H�E�4���H��H��[]A\A]A^A_�f�I��(L���PH�C�ff.����H�щ�1������ATA��UH��H��SH�������H��D��H��藈��H��H��H�@H�x�$��H�EH���f!��H�XH���K���H�UH�B H�{tXH�u1�1��H����
uH�~ H�uH��H�KH9�w�H�V H��H9�s"HЀ8 �-!���-H��M []A\��H�߾-�#����M H��[]A\����H�ht5�Gx��t.ATL�ghUH��S1ې��L����z��H�����9]xw�[]A\Ð�ff.�@��AWAVAUATUSH���G �� ���>H����H�GI��L�=�L�`�O@H��H)�H9�s
�{�
��H��L��� ��H�k�L��L�����H�����{��I�FI�T$�
H��H�P �ߜ��H��I�FL�hL�����L��L��H�����H���u���H���ݗ��H��L��H�����H��L��[H�5^�]A\A]A^A_�}��DH��H��L���i���D���X[]A\A]A^A_����AWAVAUI��ATUH��SH��H�GH�x�K���L�eI��I�D$L�p�E ����I�|$�7���L��H���L���H�L9��g��1�A�< L����H�����H�UH��H��H�zL���%���H�mH�] H��tL�����H�H�] H��[]A\A]A^A_�f.���AVAUATUS�G �A��H�_H��H������H�{�N��H�{I��A��耖��H��I�����H��H��uE��uH[]A\A]A^��L����H��I���E���L��H��L��I��H�E[]A\H�xA]A^���@L�����H�=�8
H��1��7�H��H�����H�UL��H��H�zH��[]A\A]A^����ff.���USH���G ���H�GH��H������H�@H�x����H�o1���H��6
H���c�����u'H���G���H��@|H�;�K H��[]�Ό��fDH�
D���H��1�H�5�6
�����f���AUATUSH��H�_(�Cx������A��9��W��9��'��H�{h����H�{h���v��H�xI�������@ ����D��H���'�H��D�`H�I�EH��H�E���H��H��[]A\A]�ێ��ff.�AWAVAUATUH��SH��(H�_(�t$H�{hH�T$H�L$L�D$��D�cxE����L�khE1���E��E9���D��L��E�w��u���@ u�H�t$H�|$� ��H�L$D��H�ߋT$I���ق��L��I��H��諆��L���#���D;sxsDD��D��H��A���f��D9sxw�H��([]A\A]A^A_ÐA�E1��L��6
H�
:
1���H�5�4
H�=���=x��ff.�f���ATM��UL��SH�(�9���L��H��H���[��H��H������H��[]A\�t���@��H���L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H�G(�xx�9��H��$�I��I��H��H�D$��H�D$ 1�H�D$�$ �D$0���H�D$dH3%(uH�����
���ff.�f���H���L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�I���$(H�D$H�D$ H�D$�D$0�7���H�D$dH3%(uH�����Z���f.���H��H�(���H��H���Ӌ����H��H�(�x���H��1����H��H��餋��@��H���L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�I���$ H�D$H�D$ H�D$�D$0�B���H�D$dH3%(uH�����U���D��H���L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H�G(I���$ �D$0���H��$�H�D$H�D$ H�D$���H�D$dH3%(uH����蚑��f.���SH�(H��
��膟��H�5$3
H��H��脂��H��[���ff.���UH���SH���9�H��1�H��H����H��H��[]�k���ff.���UH���SH����H��H��H���f�H��H��[]�(������AUATUSH��dH�%(H�D$1��G t,1�H�L$dH3%(���^H��[]A\A]�f�H��H�=/2
�q��D$H�CH������H�hH�}����H�H��L�` M�l$`�]���H�SH�R H�T�< t<-����� H�UH�uL����H�kH��xq1��}H��/
H���/�����u+H��1�����H�|$�z���������K ����fDH���x�H��1�H�
��I���}H�5c/
1��f���1��wH�L/
H��辐����t:L������H�
K1
�wH��I��H�5/
1��"��L������E���_���H���h������1������H��H�GH�������-���c��H���f���USH��H�GH������H��H��H�=���0�UHH�CH�pH��t�>uH���=�����tH��[]�f�H�=���U@H��������u�H�m@H��设��H��H�=�
H��[H��]��f���AUH�C���ATUSH��L�o �]���H��H�@L�`H�XL��薌��L��H��H���X���M���L���y���L��H��H���;���H�ߺH�5���'���H��H��[]A\A]�f���ATUS�G ����H�GH������H�XH��H�SH�P H�GL�`L������L��H��H���ĺ��H�����H��H��H��论��H��[]�H�5p�A\閺��fD��AUI��ATUH��SH���H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1��G �Z��H�GH���%��H�XH�SH�P H�GL�`L������L��H��H���޹��H������H��H��H���ȹ��A�}u9�H�5��H��譹��H�D$dH3%(uXH���[]A\A]��H��$H�߾ �$H�D$H�D$ �D$0H�D$蕰��H��L��H������������AUATUSH���G ����H�GH������L�`H��H��I�T$H�P H�GL�hL���(���L��L��H�����H������H��L��H���Ը��H��u2�6D� L��H�����H�k�H���ۉ��H��L��H��蝸��H�;u�H��L��[H�5V�]A\A]�y���f���H�H�@ ��� u�H�5���̮��ff.����H�H�@ ���%�=�t�f�H�5z�键��@��H�H�@ ���@u�H�5I��l���ff.����H�H�@ ���u�H�52��<���ff.����H�H�@ ���u�H�5������ff.����H�5������H�H�@ ���t<H���H�A�H���wH�2H�5s�1�����fDH�5_�餭��@�ff.�@��H�H�@ ���u�H�5��l���ff.����H�H�@ ���u�H�56��<���ff.����USH��H��H�H�h H���d�����tpH��H��tTH�?tNH�5-�
����1�H�5�
H�=�,
H��1�踭��H��H��H��H��01�[H�5��]�����H�
Y,
���H��[]�f���H�6�dn��@��H�6H�?�Qn���AW1�AVAUATUSH��L���L���I�EI�]I��t[I��D�x�1���H�EH��L9�t;H��H�;L���m����u�H��L��L��I������H���[]A\A]A^A_�H��1�[]A\A]A^A_��ATL�%/
USH��H�oH�H��t�`���I��H�C0H��tLH�H�5�H���r���H�SH��H�5�.
�_���L��H�=��1��N��[H��]H��A\�Ϗ���H��.
H�5��H���"����AT�UH��H�=�.
S舃����I��H�L��P��H�5�.
L� H��H�@(H��x蕰���C8H�CH�k H��`�CxH�CH���H�CHH�C@H��tH�XHH���H��[���]A\�f�H��������SH��H�� dH�%(H�D$1�H��H�T$H���H���H�4$H���D$�L$�Ƴ�����H�D$dH3%(uH�� [��t���@��SH��������s��[�f���AUA��ATI��UH��SH��H���q���H��D��L��H��H��[]A\A]�vy��fD��H���SH��H�?���a���Hǃ�H����C���D��uH�`M5�H�5��H���y��H�]Q5H�߹H�5���x��H�jM5H�߹H�5����x��H�_M5H��1�H�5�,
��x��H��M5H��1�H�5���x��H�P5H��1�H�5|��x��H�wL5H��1�H�5p,
�~x��H�GO5H�߹H�5���cx��H��N5H��1�H�5���Kx��H��P5H�߹H�5e��0x��H�YN5H�߹H�5���x��H�6M5H��[�H�5M��w��f�H�!L5H�߹H�5����w��H�nP5�H��H�5G��w�����D��USH�����H��H������H�k1���H�V+
H���\�����t(H��1�H�
^+
��H�52+
����H��H��[]ÐH���}��H��H��[]�ff.���AUATI��USH��H��`�#���L��H�8H��L�������H�C�����H�����L��L���;x��H��H�C0�O���H�k1���H��*
H��蕄����t1H��1�H�
�*
��H�5k*
���H��H��[]A\A]�fDH���H|��H��H��[]A\A]�f.�H�5)���L���Q��������X���D�����u�G8�ff.���AUATUSH��H����
��H�GPH����I��I��H��u�#H�@H��t9u�L9`��
��H�@H��u�H�}�(H��P�L�`L�h H�UXH�@H�PH��tH�BH�EXH��[]A\A]��H�EPH�EXH��[]A\A]�D��L�GPM��toL���fDH��H��t\H�H90u�H9Pu�H�PH��t&H�JH�HH��t(H�PH�QH�@H�@�L9�u�H�OPH�H��H;GXu�H�PH�WX��PL���
1�H�
#.
��H�5�(
H�=���d��ff.���H�GPH��u�G�H��H��t>H�P90u�H�HH��tGH�QH�HH��t*L�@L�AH�@H�@H��H��u��f�H9GXu�H�HH�OX��H��H9GPu�H�WPH�H�ff.�f���H�����9��H�h�V���wxH���ff.�f���H���Gx���V��H������U1���H��'
SH��H���G<H�oH��蒁����t.H��H�
�'
��1�H�5h'
���H�{ H��[]钰��f�H���Hy��H�{ H��[]�y���f���H�OhH��tsD�GxE��tzH��H�wpH�y1�H��H��I��H9�����H�	�A ��t4A��H�I���@L9������y H��H��tL9�u�H���D1��D1�H��Ð��f.���H�OhH����D�GxE��t~H��H�qH�p1�H��H��H9����H��r ���tE��u@E�H�H��I���'@H9���
���J I�Ѓ�tH�H��A�@ uL9�u�1ɉ�H����1ɉ����H��9wx��
��H�htH��h�ϩ���@ t	H���@1�H���f���S�x��
����1�����H�P1�H��t9��[�fD��ATUSH�GhH��t�Wx��txH��H�PH9Wp�r
��H�81�E1�G u5�W�H�shH�Kp1҉�H�FH��H9��?
��H��HH��A t$�_�����DE��9kxw�D��[]A\�f�E1�[]D��A\�D��AWAVI��AUI��ATI��U��SH��L�D$`L�L$h��t=)D$p)�$�)�$�)�$�)�$�)�$�)�$�)�$�dH�%(H�D$81���+�y	��H��$0�D$ H�D$H�D$@H�D$A�Fx�D$0����1�L�|$ ��tjf.�I�vhH��t&I�NpH�F1҉�H��H9��7	��H��H��D u(�oD$M��M��L����L��AH�D$I�G�I�����A9^xw�H�D$8dH3%(u1H��[]A\A]A^A_�fDL�L$M��L���1�L��������:|��f.���H�G(H� ���������SH�W(H�_ ����������u
H��[�v��@��H�߈���_��H��[�vv��fD��SH��H�_(H� 軽�����[�f���AT1��sH��"
USH�oH�_(L�g H���|����t2H�
��sH��1�H�5�"
�%������L��[]A\邁��f�H���ht����fD��H�W(����u�@��SH��H� �����H�[1���H�""
H���(|����t$H�ߺ�1�[H�
�"
H�5�!
閽��fDH��[��s�����USH��dH�%(H�D$1�H�H�X H����H�$���[�P8���������P8�e���x<H�h����V�5H�5l!
H��袗��H�="
�P�(#H�=+�H��UHH�5"
H�=#��U@H�5��H�=�}
�U@���1��:H�!
H��H���{�����H�
���:H��1�H�5� 
耼��H�$H�H@H�PH�@<H���$H�QHH�PHH����H�H@H�J@H�@HH�@@���H���袴��������H�<$�a~��H�<$�Hs��H�$H�x蛢��H�<$H�H��tH��P1�H�\$dH3%(��H��[]�@��ڐ1��2H� 
H���z����t6H�
��2H��1�H�5�
艻���P���@H����q����H����q���/���H;������H�P@H�������H;������H���H�PH�����Nx��ff.���AUH��ATUH��H�5% 
SH��H��L�o H�dH�%(H�D$1�蕮��H�{H��H�5�
肮��H�{��H�5
�M���H�=�
�P���1���H��
H��I����x������1���L��H�
�
H�5�
�_���H�C0H����A��x��uA�� tH�
�
�@t}fD��t[H�xH�$����H�����H�C0H��H�<$�PH�$�P<��tcH������H�D$dH3%(��H��[]A\A]�@A�� u��@u�H�
D
H�7
�H��1��{����f��@<��L����o��H�C0H������H�
�
H�<
��H���0����`����vv��fD��AUI��ATA��U��SH��H�?dH�%(H�D$1�H�<$�����<v$H�L$dH3%(��H��[]A\A]�D����H�$H�@PH��u�_@H��H��tNH�X9(u�H�<$E��t.H�PH��tvH�ZH�PH��tYH�HH�JH�@H�@H�p �PH��H��u���tH��蕍����tQ��S����H�GPH��u���DH9GXu�H�PH�WX�H��H9GPu�H�_PH�P�|���f.�I�E����.u��ff.���AT1���H�>
USH��H��L�'I�l$H���3v����tOH�
{
��H��1�H�5	
袷��1��H��������t1�L��D$�[���D$H��[]A\�H����m����fD��AVAUATUSH�� H�_ dH�%(H�D$1�H�$H������H�OhH�������ox���wH�qL�Op1�H��I��L9��;L�D�]�1�E1�E1�A�A�P ��t.I�HA��H�������	�����wM��I��L���DE�L9�tH��M�H9�w�����D9W|����E���u���H�_ H�|$H��H�\$�غ��H�D$�Xx9X|H�X��1��H��
H���t�����H�


�H��1�H�5
����H�\$��H��聮�����yH�|$�/~����tH�$H��t���9���gH�D$dH3%(��H�� []A\A]A^��1���H��
H���t������H����k��H�|$1Ҿ�����p���H�|$������G<���R���wq��wuH�G ��yuH�H���'����)���f�H���xk�����A9�������pDH�
�
��H��1�H�5J
����\���fD�������9H�=%
�i��fD����H�|$�R���f��G|����ǃ�H�_ ����f���H��������H��H�Y
H�5m
�s���~����������H���t����u
H�|$���H�D$1��/H�w
H�XH���yr����t.H�
�
�/H��1�H�5O
���H�D$�@<����H���/j�����p�������ff.���AUATUH��SH��H��{<L�cvr1��WH��
L����q����u0L����i��H���j��H���u��H��H��[]A\A]�~���fDH�
���WL��1�H�5�
�+����f��ZH�5v
L��L�k 訍��H�=	
�P�(#H�=1�I��A�T$HH�5
H�='�A�T$@H�5��H�=�s
A�T$@A��$�1��_H�
H��I���q����tgH�
��_L��1�H�5�
育��H�S@H�CH�C<H��tFH�BHH�CHH��tQH�S@H�P@H�CHH�C@A�������@L���h���fDI9��u�I���H�CH�f�I9��u�H�C@I����f.���ATUSH��Cx9C|s
[�]A\�L�cH��1��H�
L���#p����t?1��L��H�
�
H�5�
蒱�����u*[H��]�A\��L����g�����t�H���s����D��USH��(H�|$dH�%(H�D$1�H�G �<H�D$�����H�O@H���G<H�WHH����H�QHH�WHH����H�K@H�J@H�CHH�C@�����dH�{h�����1�H�{h�M��H�xH���[���H�{�H�5�
�3���H�=�
�PH��H��H���+�����1��H��
H��H����n����uhH���f��H�EH�|$�=�tn=�tg��������H�|$�F���H�|$謝��H�D$dH3%(�#H��([]ÐH�
���H��1�H�5:
�ӯ��끐�x����=���H�D$H�|$�� u��xuH�5�
胢���
�H�5�
�t���H�|$誄���i���DH;�������H�S@H����q���H;���H���H���H�WH�8����{q������fD�k���H�|$������f.�H������H�=Y
H��1�觺��H�|$H���ʡ���Q����l����USH��(H�|$H�l$H��dH�%(H�D$1��T����Ä�t.H�T$�B<��vQ������H�zh����H���Ű����u9�H�L$dH3%(����H��([]�H�|$�v���fD1���@H�|$H�|$����H�|$�Gx��tm1��"f�H��舉����x�H�|$��;oxsGH��h���,K���P �Ӄ�uу�����H�|$�����t�H�D$�@<�I���f�H�|$�ւ���Ä��\���H�|$�ҏ�������j���H�t	��ATUSH�oH��H��(H����H�x�*H�5�
���H�CH�Ǿ�o���H�{ H�k�2���H��H�5(�H��I���͠��H�{(H���1���L�羀�d���H�=Y
H��1�裸��[H��]H��A\�$r��@H���H��t$�'H�5
�3���H��H�C�n����H��x�#H�5�
����H�5�
H���H����q��H����f���AVI���AUI��ATI��H�=�
US�ze����H��H�H��PL��H��H��H�(�@xI�D$ L�cXH�C��Q��H�s(L��H��H�C �Qk��H���i���H��[]A\A]A^�ff.�f������u#H���Gx���/������GxH���f��ff.�@��H�G0H��t�f�H�G �ff.���USH���Gp��%���H��H�H�������H��H�5�
�Bp���Ѕ��H�=
�PH��H��H���Ƚ�����1���H�P
H��H���ii����t%H��H��H�
��1�[��H�5$
]�Ҫ��f�H��H��[]�"a��f���H�wX����H�WXH��H�z(H�P�B0t�p`�oo���1��ao�����H��H�GXH���^���H�x(H�����ff.���AVAUATUSH��H�XH���O�����I��I��M�������t��8�����cvEL��L��誣��H�{ I������H���s`H�{XAU��I��L��1�L��
�[���XZ[]A\A]A^Ës`H�{XM��M��[L���]A\A]A^顐�����H���L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�I���$ H�D$H�D$ H�D$�D$0袹��H�D$dH3%(uH�����5f��D��ATA�UH��SH��H�X裯����t�EE1�-���cA��H�CX�s`H��H�x(�j���H�s D��H��H�����[H��]A\�l^��ff.����S�Gp�������H�5�
�GpH�����H�=5
�P�(#H�=��H��SHH�5f

H�=���S@H�5�H�=�h
�S@���1��H�^
H��H���wf����t#H�ߺ1�[H�
��H�56
���DH��[�7^�����USH���Gp��%���H���GpH�H�5�
�<���H�=m
�PH��H��H���4������1��H��
H��H����e����t)H��H��H�
0�1�[�H�5�
]�>���fDH��H��[]�]��f.���AUATUSH��H�����H���H����I��I��H��u� H�@H��t9u�L9`�l�H�@H��u�H�}�(H��P�L�`L�h H���H�@H�PH��tH�BH���H��[]A\A]�f�H��������L���M��tuL���H��H��teH�H90u�H9Pu�H�PH��t&H�JH�HH��t+H�PH�QH�@H�@�L9�u�H���H�H��H;��u�H�PH�����PL�|�
1�H�
�
�FH�5
H�=��F��f���AUI��ATU��SH��L�'dH�%(H�D$1�L�$$����I��$�H��um�H�L$dH3%(��H��[]A\A]�@H�PH����H�ZH�PH��tfH�HH�JH�@H�p H�<$H�@�PH��H��tH�X9(t�H��H��u��z���H���������j���I�E�b���DI9�$�u�H�PI��$��H��I9�$��l���I��$�H�P�[���fDL��� l��I��$�H���l�������a��D��SH��H�dH�%(H�D$1�H�H�$H��ti�����u]�Cx���!�P���Sx��uE��H������x��������H�<$�Gpt>H��荊��H�<$H�H��tH��P1�H�t$dH34%(��H��[��H���0���H�$�nH�5�

H�x�7~��H�=h
�P�(#H�=��H��SHH�5�
H�=���S@H�5d�H�=d
�S@���1��tH��

H��H���a����t&H��H�
-��t1�H�5j

����H�<$����H���hY��H�<$�	����*`��f.���������AUATUSH��H�H�CL��(M�����H�kH�����I��1���H��H��
�a����u1H����X��H�CXH��L���K��H��L��1�[]A\A]�Ҵ��f�H�
'

��H��1�H�5�
�C���븐��H��H�|$�Gpt
H�����+A��H��t�H�D$H�|$��Hp�n���H���f���AVAUI���ATUH��H�=M
S�
[����I��H�L��PL� H��H�h����H�������H���H�CA�EXH�;L�s@�C0I�u�IG��I�UL��L��H�C8����AoEHC H���H���dH�CHDž�L�cH�SL��H�5�

���H�SH�5k
L���Ӕ��H�{8����H�5p�L��H��踔��H�{8�O���L��H�5\�H��蝔��L��L���D��H�sH�=�

1�耬��L��H���f��H�{�@H�5>

�@{��H�=�

�P���1��CH�

H��I����^����u;L����V��H��XH��tH�@xH��tH��`H���H��[]A\A]A^�fDH�
���CL��1�H�5�
�����f�H���H�5�
L��1��F��H�C�_����H��x�8H�5n
�P���I��H�C���@��AWAVAUATUSH��H�/H�]H�H��XH��tH���H��tH��`H���H���H����H�G1�1�H���I���e���D��D�� E�G�t%E��t#H��A�G�L�|�fDH��H����J��L9�u��tQH�}襅��H�EH���H�H��H�@H��[]A\A]A^A_��fDD��D�� G�4,���u�H�}�gH�5F
�Hy��H�=�
�PD��H�=���PHL��H�=��PHD��H�=���PHL��H�=��PH1�H�=��PH�(#H�=��H��SHH�5j
H�=���S@H�55�H�=�^
�S@���1��rH��

H��H���{\����t7H�
��rH��1�H�5�

�������DH��[]A\A]A^A_ÐH���(T�������AVAUATUSH���H����H�L�hI��L�v(I�L9�u�L@H��L9�t?H�+I9�t�I�t$ H�} ��;����u�H�}(L���Yo����t�[H��]A\A]A^�f�1�[H��]A\A]A^�f���SH��H��H���H�t$tEH�L$1�H�t$H�YH���H�@H����A`H���H����=���H��[��H�?�@H������Y}��Hǃ�H����D��H���1�H��tH�B1�H��������ff.���H���H��tH�@1�H����f�1��ff.�f���H���H���H��t9ATUH��SH�L�`I�L9�tH�;H��H���q���I9�u�[]A\���ff.�@��H�H��H�5y��ɢ��f���AWAVAUATUSH�����H�w��/�H�����H�����H���/H�A1�H�D��D�� H���A�G�t%��t��L�|�DH�;H���|���L9�u�H�}��H�5�
��u��H�=s
�PD��H�=��PHL��H�=���PHD��H�=v��PHL��H�=���PH1�H�=���PHH�5��H�=���P@���1���H�L
H��H���Y����t4H��H��H�
s�1�[��H�5 
]A\A]A^A_�y���f�H��H��[]A\A]A^A_�P��f.�D��D�� G�t%�������AWAVAUATUSH��(H�OH�4$D��E��������H������H��������H����H�F1ҋ� L�>H����L$��T$�������L$E1�E1�H�D$�;fDD���p^��H��K�<�H���s��H���)�����t5A��I�FL;t$t=I��H�$H�x(�E0u�1��.^��H���f��D$M��I�FLD�L;t$u�M����H�}�H�5�
�s��H�=\
�P�t$H�=���PH�t$H�=}��PH1�H�=^��PH�t$H�=u��PHL��H�=z��PHL��H��H���`������1��H�5
H��H���W����t-H��(H��H�
\�1�[�H�5	
]A\A]A^A_�b���f�H��(H��[]A\A]A^A_�N��f.��� E1�D$�D$�D$H�$1�H�x(�\��I�����D$E1�D$�D$����AWAVI��L��AUI��ATA��UH��L��SH���w���I���1�H��H�AL�9I�����tP��E1�H�D$�@I��K��H�x 訌��H��L��D��SI��L�I
1�D��H���{��ZI�FYL9t$u�H��[]A\A]A^A_�f.���AVA��1�AUE1�ATUH��SH��H���L�fH���H�OH��H�������H�5�
H���]���A��$����H�5�H���:���fA��$���L���]��I��H��t>�
H�5�
H������L���.R��L��H��H�����H�5��H���܀���H�5o
H���Ȁ��M��$�L����Q��L��H��H��誀���H�5D
H��薀��L��螩��H��I���Q��L��H��H���u����H�5
H���a���L�eL���Q��L��H��H���G����H�5�
H���3���H�u8H���'����H�5�H������M��t>�H�5�
H�����L���"Q��L��H��H�������H�59/H�������H�5�
H�����H�} ���H��H����P��H��H��H�����H��H�5cg[1�]A\A]A^鑌���M��$�L���P��L��H��H���b��fA��$��(���I��$��e����8I�������H�5�
H���%��L���MP��L��H��H������H�5�Z
H���~������fDH9����H�A��t&A���c���H�8�l���H���t���I���K���@H�H�x �\���I���3���@SH��H���dH�%(H��$�1�H��t��yH��� t#�@uWH��$�dH3%(uZH�Ġ[��� H�∇y��v������yu���@��y�@t�f.�H���H�S`H�sX��l�����P��DSH���G���H�sXH����C��H�{`H��H�5�$脎��H�{`�[�%E��DATI��UH��SH����H���H��ti��H�5�
�y��L��H��H����8��A�D$��ufH�5�H�=�
1�贞��H��H���9X�������H���A��H��[]A\��I��$���H�50
�/y��H��A�D$��t�����H�5��H�=!
1��E���H��H����W��1�H��u�H���+A��H��[]A\�H�����H�5�
��x��H��A�D$��u�H�5E�H�=�
1����H��H���lW��1��6���� H�=W��dF��@ATUSH��H��H������H��t�����x<����)Ÿ9��vH��[]A\�f�L��x1��MH�
L���P����t/D���1�A��L��H�
�
�MH�5��h���1��@L��D$�G���D$�ff.�f�UH��SH��H��H�H�?H�5����H�UH�;H��[H�5_	
]�Ʉ��f�AWM��AVA��AUATI��H�=��UH���SH��L�D$�T$dH�%(H�D$x1��I����I��H�L��PL�D$L��hH��ǀpL��`L��XL��`�AoL$���AoT$���Ao\$(���Aod$8���Aol$H���Aot$X���Ao|$h���AoL$x���Ao�$���Ao�$��H����H�u(H��t	�>�H�u0H��tL���|���H���H�uH��t	�>�H�u H��t	�>�)�E��t����E	���E8��t����E<��t����E@��t����ED��t���H�EHH��tH���H�EPH��tH���H�EXH��tH���H�E`H�P�H���H����.Hǃ�����H�uhH��tL���Bm��H���H�upH��tL���*m��H���H�uxH��tL���m��H��H���H��tH��H���H��tH����� u
����������� ��	к�� �u��������� ��	¸�� ��u
����������� ��	� �u
����������� �����	¸�� ��@u
������������� ��	� �u
������� ��	Ј� H�}hH�����ŧ��L��H������pH����m��Hǃ@H��8L�}hI�7H���
L�d$DL��I�����L��H�D$H��@H��8�Yw��I�7H��u�H��8H��@H���|��H��@1�H���JU��H�}pH��������L��H������pH���?m��HǃPH��HH�mpH�uH���lL�d$�L��H�����L��H�D$H��PH��H�v��H�uH��u�H��HH��PH����{��H��P1�H���T��D�|$�D���7*��E9���D���d��H��H���IH��H�����L�l$`L�d$ ���L��H���F��f�1ɺD$,I��L��L��A�D$<H�5AD$AD$,H�D$ �D$(H�D$0�������H��L���'v��H����;��H�u1�H���€<0=�7H���gH���;��H��蟏��H���H��H�L$xdH3%(��H�Ĉ[]A\A]A^A_���D���)������fDH�������H��H=���H�����HF�H������fDD���Pk���������H��x���H��H����H����� L��H�
��H��1���H�5���,?���V�����|$�M�����N���H��x���H���H���oH������L��H�
��H��1���H�5T���>�����fDH����Q�����L���P|��H���H�u0H����������L���(|��H���H�u H�����������L���|��H����E���������f�H���?���R���H���?���R�����3���fD������1F��L�r�H�
��1��H�5a�H�=���))��f���H�GXH��t
H�H��hH�G`H��t
H�H��pH��`�ff.����W�����SH�PH��tH�{X�(�����uD[�f�f��x�u��P�����t�H���H��u�.fDH�@HH��t���t�[�@H�{P[�G��fDH���2��H�{Pu�[�ff.�@����y頒������y��?����ATUSf��x����H��H��I����V��H�{XM��H�麍H�5�� _��H�CP[]A\����USH��(dH�%(H�D$1�H�GXH�D$H�G`H�D$��x ����H�wXH��H��H���l��H�k`H���>��H�{`��[J��H�|$�A&��H�|$��8��H���o�H�D$dH3%(uH��([]��D������x�����Ip��f���H���trU1���H��SH��H��H��xH���D����u H����<��H��H���[]���fDH�
D���H��1�H�5���K�����f��ff.�@����xx
H���t	�������t�U1���H�s�SH��H��H��xH���PD����u<H���4<�����I��H�
���H�54�裐��H���H��[]�DH�
����H��1�H�5�胅��뭐H���H��t@�x<wNH���P<H�
�Hc�H�>��fD���uH���>m��fDH���s���H����ff.�@��H���H��t鋋������H���H��t�>��1��D����x@H�`H��t��r����ff.�@��H�`tuU1���H��SH��H��H��xH����B����u#H����:��H�{`H���[]�6���H�
?���H��1�H�5���+�����f��ff.�@��H�5U�4H�=N5�Y*��f�����p�@��ATI��UH��SH���H�T$@H�L$HL�D$PL�L$X��t:)D$`)L$p)�$�)�$�)�$�)�$�)�$�)�$�dH�%(H�D$(1�H��$H�=g��D$H�D$H�D$0�D$0H�D$ �f�����D$�X���H��H�T$H��H���%=��I��$x1��xH�{�H���gA����t{H���k3��H�
��xH��I��H�5N�1��˂���H�5�TH���m��I�|$`H�SH�3�=��H�|$�*����t/H�D$(dH3%(uH���[]A\�@H����8����?���!��@SH�GXH��H���H�G`H�����H�{XH����э��H�{`H��H�5sH����7}��H�{`�.p���� @u��xtH�5 �H��1��M����x@t*[�H���H���1�H��H�5��aM����x@u�H�{`[�k��ff.���AUATUSH��H��(dH�%(H�D$1�H����IL�d$H��x1��{H���H���?������H���7��H���H�kXL�k`H;{Xt7��f��H����8��H��衉��L���6��H���H�CXH���H�C`H��請��H���H���H���TH���I��M��L��H���,Q������H���8����x����H�߃���x�tV�)���1�H�T$dH3%(��H��([]A\A]��H�
���{H��1�H�5���C������fD��1���H���H�������H��`H;}8��H�T$H�����h�����}���H�t$H�=b�1�蛋��H�D$H��x�w�H�:�H���&>������L�D$1��wH��H�
��H�5
��|4����������f�H��5M��L��H��H�8�8&�����L�d$H��L��� g�����r���H���H����%q������H��x���H���H���=����tBL�L$L�C 1���H�
��H�5j�H����3��������U���H���45��������C���H���"5��������1�����;����ATI��H��1�US��H��0dH�%(H�D$(1�H�l$�\$H�D$H�u�FH�L$ �j����uH�D$���Q�����T$H�=���j���I��$x1���H����D$H���<������H�����H�
!���H��I��H�5k�1���}�������H��H��H����u��I�|$`H�SH�3�8��H�|$�%�����x��H�D$(dH3%(uH��0[]A\�@H����3����:�����AUA��ATI��UH��SH���H�L$HL�D$PL�L$X��t:)D$`)L$p)�$�)�$�)�$�)�$�)�$�)�$�dH�%(H�D$(1�H��$H�=~��D$H�D$H�D$0�D$0H�D$ ������D$���D��H�5`�H��H��1��!t��L��H�T$H���6��L��x1���H��L����:������H����,��H�
����L��I��H�5��1��T|���H�5{NH���f��H�}`H�SH�3�07��H�|$�$��������H�}`�.����u1H�D$(dH3%(u5H���[]A\A]�L���H2���fDH�}`�'f��H�}`��i����8�����AWAVAUATUSH����x����I��H���H��I��I��D��E�̓���H��tH��5H�8H��P Hǃ�L������H���M��tJA�>tDH���H��tH��5H�8H��P Hǃ�L��������H���H���D��xA��A��A��A��E	�D��x��uH��[]A\A]A^A_�fDH�{X��L���t��������H��[]A\A]A^A_���H����x�����H�WX����xH���H�W`H����tH���tH����H������H���WZ�����SH����x�b����x�t�u
H��[�t=��@H���u�[�@��AWA��AVA��AUI��ATE��USH��(H�l$`L�L$pH�$��D�D$L�D$h��H��dH�%(H�D$1���H��L��H���@�H��E��D��H�D$�l$1�H��H���I���UL�L$�>���H���H���H��xH��xXZ��H�|$��_��D�������x��	Ј�xE��t����H���nJ��H��x1���H�e�H���Q7����tEH�
���H��1�H�5A��x��H�L$dH3%(H��uH��([]A\A]A^A_�fDH����.�����5��f���AWAVM��AUI��ATI��UH��SH��H��H��8D�D$L�L$xL�D$pL�L$L�D$dH�%(H�D$(1��M��L��A���sg��E������L�L$L�D$���M��D����L��H����I��H��tf�}t�oE���EA����D$f��tfA���H��L���g�1�L��M��I���H���L��H�D$ �4���I���A��x I���I��xI��x�+�H�|$ �^��L����H��I��x1���H���H���5����u0H���-��H�T$(dH3%(L��u4H��8[]A\A]A^A_�fDH�
���H��1�H�5l���v����4��@��SH����V��H���K��x�[�f���SH����M��H��[�<��f.���H����@��H��t
H��H����fD��AUATI��U��SH��H��L��9�tK��H��L��������uEH��XH��twH���H��tkH��`H��L���[]A\A]��fDL��H���Հ����t>M��tH�U�4L��H�8H��P HǃL���Fz��H��H��XH��u�H��[]A\A]����H���H��t��J��1��D��U1��bH���SH��H��H��xH����3������H�
���bH��1�H�5���1u��H��H��tH���4H�8H��P H��(HǃtH��(�4!��H��0�x}��H��8�l}��H����1�H��HǃHǃX)���`1����H�H��H��[]�T?��@H����*���R���AUATUSH��dH�%(H�D$1���x�wH����x�H���H����-��I��H���H�$H��t H�@0H��tH�L��H�=��1�����I���  �fH��x1��%H�e�H���Q2�����H���1*��H�EXH��t
H�H��hH�E`H��t
H�H��pH���S���H���H�$H��tI��H�[HL���j��H�$H��u�H���s[��H�}`H��t�]��H���tH����_,��H����S.��H���tH������H��XH��t*H���t H�}P�NM��H��XH��`L�����x ��H������H�D$dH3%(��H��[]A\A]�M��H�
��H��1��%H�5!��r������H���4��L��H�=��H��1��6~��I���p���fDH�E<����H�}P�L��H�}X�~��H�}`�$���^���H���H��t$�C����uH����?P��H��uf.�H�u`H�}X����I�����H��H�=��1��}��I������
/��ff.�f���USH��H�H���p���C����P����p��tH����[]�1�H������H��x1��[H���H����/������H���'��H��XH��tH���H��t	H��`��H��� ��H�-��4H��xH�}H��t
H��P H�}H���HǃxH��t
H��P H�}H���Hǃ�H��t
H��P H�}H���Hǃ�H��tH��P Hǃ�H���1��7W��H��hH�����H�H��h�PH����[]ÐH�
���[H��1�H�5���Sp�����ff.���H��1�dH�%(H�D$1�H�<$���H���U8��H�D$dH3%(uH����+-��ff.���H��dH�%(H�D$1�H�H���yH�$��u��H�Lj�y�-���H����7��H�D$dH3%(uH����,��ff.���H��H�|$H�`�l��H�|$H���Mb��H������USH��H�o`��x�H��t&H��H���{Y��H���3L��H�߅�xH��[]�\���H��[]�f�H��[]�%y��D��SH��H��H�`��K����~�H��[�@t�H�߉D$��x���D$��@��AT1���H��USH��H��xH�|$H����,�����H�
����H��1�H�5���]n��H�|$��r��H�D$H�x`�e\��H�|$�`��H�|$����H�_`��H��t
�C�H�|$�I6��H����[]A\�fDL��x1��yH�_�L���K,������H�
���yL��1�H�57��m��H���.�H���%��H�|$H�_`��x@�n���H���t���H����W��H���J��H�|$��H�_`�E����H���#������K��H�\$fD��xx�H���H���/����r:����u��c���f�L���h#���M����.w����������@��AWAVAUATUSH��xdH�%(H�D$h1���yH�|$0�������t&H�D$hdH3%(�_H��x[]A\A]A^A_��;K��H�|$0��x�tH����=��"����`��H�|$0�����p��H�|$0H��X��yH��tH�@hH��tH��`��H�|$0H���H�|$8H��t
�{<�HE��J��H�D$XH�|$8A�H�D$L�%\���y������E����H�D$,L�|$PH�$H�D$HH�l$`H�D$H�D$@H�D$f�H���H�$M��H�T$H�t$�!��A����H��tH���[P��H�D$81���L��H��xH���)�����
L�L$HL�D$@L��H��H�
����1��k��H�\$8H�t$@L�t$H��`H��H�\$X菅��H��H�D$`��w��H�|$X�Ho��H�|$`L������H�|$�3������H�D$`H9����H����H�D$`H��������?����t��urH�|$8��xxd��y�	���^��H�|$8���H���H��������{<�HE�����H��� ���	���H�|$`�>?��H�D$0H��XH��tH�RpH��tH��`��H�D$0��y�H�|$0�2������H���xW�������u|1�����D�kt����fDH�|$8�H�GX�@ ��H��x1��L��H����'����ujH�������|$,�d����D$,H�
��Hc�H�>��f��s���(���fD�`�����5H�|$0��x�������z,���O���DL�D$P�L��H��H�
�1���h���{���DH�|$8H�5��[�����f�H�|$8�v/��H�
��H��H�r���1��y`��H�|$8��x�y�����y�:���E�������H�������H����<"����tXE1�H�|$8�k���H�|$8�.��H�
���DH�t$PH�|$8�[������@H�|$8��y��f.�H���L��H�|$8����H�|$0H�5u���Z���"���H���@}��1���H�>�H��H�D$8H��xH���&����tII��H�
'�H��1���H�5��g��H�|$8H���H��t�x<wH�|$8H���SZ���P���H������̀�y�r���5����n$��ff.���ATUSH�� dH�%(H�D$1�H�H�H�D$��y���>4H���
����~.����I��H�=���x��H�5�8L��D$�06��1�H�5�+
H��H�D$H�UH���1��]H��H�|$H��H�ھ�H�E�W��H�|$L���gY��H�|$�]����tH�D$dH3%(u	H�� []A\��{#��錶��fD��H��H�
�H�5"�H�|$H�|$�;1��H���fD��U��SH��H�7dH�%(H�D$1�H�4$H��t\H���x��&�����H�ӈ�x�tRH��H�5�7�#5��H�<$H�ډ�H���V��H��H�H�H�5���0��H�D$dH3%(uH��[]�DH��H��H���0�����"��ff.���U1��yH���SH��H��H��xH���#����tbH�
��yH��1�H�5���e��H���H��tH�b�4H�8H��P Hǃ�f�H����H��[]�ux��DH������fD������D��AWAVAUI��ATUH��SH��8dH�%(H�D$(1�H��hH�>H�$�}�����Q���H�}��^��������H�}�cr�����ߴ��I��(H����I��0H�Y1�L�1H��L�H��H�D$I9�t<L�eM����I��L9�t#I�?L��������X���~�L��L)�H���T$H�$H�uf�)D$H���SV��H�uH�D$H��t
H���A��H�D$I��0�t$H�T$I��(H���8,��H�D$(dH3%(uOH��8[]A\A]A^A_�f�H�<$�@H����C���IDž0H��I��(����D ��@��H��`�@����x�����ff.���H��XH��tH���H��tH��`��1��D������D��USH���H���x��H�ŋ����ud������H�5�H���L����x�t\�SH����C����x�tHH��A��C��H��H��[]���D��uI�H�5��H���_L����x�u��u�H��H��[]�b��f��H�5^�H���,L���˾�H�=:����f���H��(�@��H��(H��tH�@�ff.���f�FF F0F@�o��N����F���f�FH��xH��tYH�F H���H�F(H���H�F0��h��u���tD1�����������l�F8��p�F<�����t�H����fD�����ATUH��SH��H��`dH�%(H�D$X1�f�~t�oF���F����Ef��tf���H�} t|H���H��tH���4H�8H��P Hǃ�H�} �d��H��x���H���H���H��tH���4H�8H��P HǃxH�} �vd��H��xH�}(t7H���H��tH�E�4H�8H��P Hǃ�H�}(�8d��H����E��t��hH�}0H��tH����5�������E8��t��l��p��t	�E<��pH����9��H���H��x���H��XH��t/H���t%H��H��H��� ��H��XH��`H���H�D$XdH3%(��H��`[]A\�@L��x1��$H�W�L���C����uGL���'��H���H��tH�$�4H�8H��P Hǃ�H�}0�c��H�������L�M0L���L��1�H�
���$H�5���`^������f���SH��H��H��hH�t$��P��H�D$H��8H��tZH�@1�H��@���)���H�T$�p�H��8�e��H��@H��8�M��H��@1�H���U&��H��[��H��h�@H������M>��H�t$�Hǃ@H��8H����G������SH��H��H��hH�t$�P��H�D$H��HH��tZH�@1�H��P�������H�T$�p�H��H�Id��H��PH��H��L��H��P1�H���%��H��[��H��h�@H������}=��H�t$�HǃPH��HH���G������SH���H��tH����R[��H���H��[����f���H���H��t(H���b���oH�5��H��H���%���1��D��UH��SH��H�5��4H��H���1^���E��u"H�#�H��H��H�5
[]�O��fD��u	H���׾ H�=,��9��f���AT�UH��H�=v�S������I��H�L��PL��H��L� �E�CH�u�+N��L��H�CH�u(�;��H�C0H�u0H��tH�;�&c��H�C8H�uH��t�>u���H��L����M��H�C H�u H��t	�>��H���H�C(�E�x��Dº�C�E�C�E8�C@�E<��Dº
�CD�E@��D‰CH�ED�CL�oEHCPH�EXH�C`H�E`H�ChH�uhH��tL���9��H�CpH�upH��tL���9��H�CxH�uxH��tL����8��H���H���H�5=�H���H���H������������	Ј��������	Ј���������	Ј��������	Ј������࿃�@	Ј��������	Ј�������߃� 	к^���H����8@��H��H���H���f������H������P���4��H��H�������H��[]A\�@L���L��H�C(�<���ff.�@��UH��SH��H�H����R��H���tH������H����?��H�H��t	H�H��PH�EH��[]�f���SH���H�H��t@H���:��H�[H��u�[�D��SH��dH�%(H�D$1�H���t1�H�L$dH3%(uIH��[�DH�G8H��t�H��H��H���H���RA����y�H�4$H�=Ӓ1��d��H��������m��f.���H��:t��fDUH��SH��H���G���H��H���J��H�H���[]�f.����ff.���UH��SH��H��H��7\��H�C�E�H���4H�8H��[]����f�AUATI��U��SH��H��@H��(dH�%(H�D$1���\��H�{��H�5����1��H�=���PI�Ņ������1���H���H��I�������uPL���p
��H�CpH���D$�,$H�sxL�d$H�Cp��H�D$dH3%(��H��([]A\A]�@H�
K���L��1�H�5��V���f�L��H�=Y
A�U@A���1���H���H��I���������R���M��H�
�L��1���H�5���JV���5����p����H�WP��������ff.�AW�AVAUATUH��SH��HH�_dH�%(H��$81�H�L$H�T$H�{�]������L�d$ 1��"L���H�H�CH�D$8iC(���$�iC(���$��C��$(H�EH��8H�D$hH�EH��$ L�k01�M��tH�5C�L����������L������L$A��E1�H�T$1�H��I���"��H�u(I��1�L�N1�H��H�D$�_��H�|$I������H�E0H�L�hI�L9�t2L�5����H�3I��M��H�
`1�L��H���b�L9�u�L�}`H�u L��H��L�ehH�����H�} ���H��$8dH3%(��H��H[]A\A]A^A_�DH�5B�L�������������H�5]�L��1�������������@H�t$H�=��1���_���EH����H�}H���F��I���1�H�EPH�
����H�5U��i,��H�E@�J������ff.���S�wHH��H�WP��~H���%���H�Ch[�H��������ff.�f���H��t,��t1ҾH������H��������H������@��H�<�H������S���ˤ��H�PH��t[�H�G�wHH��H�5+�H�?H�@H��1����H�CP[����-���cw H�~Pt	���FH��UH��SH��H���V��H�=��H��1��n^����������p�����cwH��H��H��[]�K������1���g@�����f����-���cw��UH��SH��H���7V��H�=q�H��1��]����������p�����cwH��H��H��[]�������1���g@�����f.���AUI��H�=$�ATI��USH�������H��H�H��PH��H�(�Ao$H��@�AoL$H�AoT$ P(I�4$�H���H��H�CI�t$�7���H��H�CI�t$�&���H��H�C I�t$(����H�C0I�UH��tH�s8H���\��A�U���H�5������	кZ���I�}�7��H�5��4H���H���S��H��H��[]A\A]�f���SH�H�H����e7��H�H��t
H�H��[H�@��[�ff.���AUI���ATI��H�=��USH���	����H��H�H��PL��H��L�`H��H�(�%���H��H�����H�C(��0��H�C8�yH�5��H�C0I��$��6��H�{(H�C�E��H�{H�5jvH���C��H��H��[]A\A]����SH���cC��H��H���4�����[�ff.�@��SH�H�H�{t	H�{���H�{ t	H�{ �X��H�{Xt	H�{X��H�{ht	H�{h�Q*��H�{`t	H�{`���H�{@��T�����uH�{��5��H�H��tH�H��[H�@��H�{����D[�ff.���SH��dH�%(H�D$1�H������H��t@H�>t:H��H�?��H�S8H�{0H��H�$�9��H�D$dH3%(uH��[�����L�	�H�
y�1���H�5��H�=,G��ff.�@��SH��4���H�G01�H��H�@H�w8���C���H���H�51u�%U��H�f�4H�8���1�H�=��H��1���/��1�H���[���H�CH���(��H�C[�f���AWAVAUATUSH��H��H��L�g�dH�%(H��$�1�H�wX� H�W`�R��H�T$�H�C H����,����~H�{H�T$H�5��lT��H�{��H�5���'��H�=���P���1���H���H��H�������tZ1���H��H�
��H�5y��
M��I�|$tEH������H��$�dH3%(�CH�Ĩ[]A\A]A^A_�@H���(��I�|$u�L�sH�5�
I�~ �,a��I���t����H�����H���--��H��I�EH�D$H���Ԟ��I�}I�uA�t'��H���6��A�D$I�t�I��H�>u�L�d$H���H��L��H�D$�6��H��L��H���H�D$�c6��H�{(H�VH��tH�?t�@��L��H��H�D$�36��L��H��H�P�
L�d$ H�D$�6��H�C0L�8L�hM�M9�t-�I�?I���@���L��H��H�D$ ��5��M9�uھH���;���L��H�1��H�I�|$AiF(��D$ �D$$A�F�����$���	�H�S��$���H��$�H�S�����	Ј�$��rT��H�}����H�uH�|$L���$��H�s H��H���T��H�{ ���H�kXH��H��H�5�������������ff.���UH��SH��H��8dH�%(H�D$(1��{�H��H�D$��3��f�H��H�T$H�5{�)D$���H�|$�g����ucH�|$���H�|$H��t?����H�t$H�EH��tH�u�4H�8H��P H�L$(dH3%(�D$u$H��8[]ÐH�E��fDH�|$�>�������f.�DAUATUSH��H���H���'R��H������H����R��H������H�����N��H����#��H����O
��H����C
�����9��u
ǃ�����H���A�{1�L��H�
��H���B��H���1�A�|L���H�
��H�����H��H����H�G1�1�H��I����*��E��t_A�T$�H�hH�RL�%��H��L�l<H�}��H�}�"���}�t!A�fM��1�H��H�
��H������H��0L9�u�H��1��p����Xt��XH��[]A\A]�DH���1���H��H���s����tH�
0a��H��1�H�5���G���H���8����fD��H���4�>H�8���ff.�U��SH��H����H��HH��@��H��[]��f.�H���t��H���u�USH��H��H���H��t�Gu
�F�H��uqH���H��t�GtH��H��tcH�G1�1�H��H���)����tH�U�H�XH�RH��H�l@�f�H��0H9�t'H�;H��t�Gu��a����t�H���[]�@H��1�[]���ka�����t����ѐ��USH��H�G H�/H���
���H��H�wH�(��H�{�GtH�������u	��Xt*H��[]��a����u�H�������u���f�H��H��1�[]�p�����S1�H��H�KH�=n�1��'��H���[H���A�����SH���3����� tJ��$��u
ǃ$H�������H��Hǃ��Xu/H��t*[�����$H����u��(��[Ã��f�����$��tÐAT��H�G�U��1�SL���H��L�������tNH�
����L��1�H�5��	E����$��XuH�߾[]A\�9���f�[]A\�L���0�����ff.���AUATUSH��H���L���H���G���M���f���H������tqH����u��H���1��H�e�H��������� H�����H���H��H�5G�R?��H���H���[]A\A]����H����	H���H���`������L���`#��L��I���u���M��	H��I��H�
�;H�5��1�����,L����H����L�������u$L�����H��H�߾[]A\A]��-��DH���@�H��I���e!��M��L��I��H�
�;H�5>�1��"����H�
Ѿ�H��1�H�5��C������fDH���`����w���ff.���AUATUSH��H��L���L���
��������uH����[]A\A]��L���1���H���L�������tOL��1�H�
���H�5|��rB��H�������u:��Xu�H��1����H����[]A\A]�fDL�����H�������t�H����0���H����$���H���8���?����H���f,���-���H������H�޻H���A����tML���E!��L��I���Z���M���H��I��H�
�9H�5��1�����H�߽�����+�����H��������fD��AUATUSH��H���L���H�������M���f���H���&����H����!��H���1��lH��H���t������lH���T���H���H9��tH�����H���H����&��H��������H���I��H�
V�wH�5���%��H���H��H��[]A\A]���@H����eH�j��H����������L������L��I������M��eH��I��H�
!8H�5&�1��
����4�L����^H���L���`�����u$L���D���H��H�߾[]A\A]�=*��DH����H��I������M��^L��I��H�
�7H�5��1����H�
Y��lH��1�H�5}��s?���z���fDH������w���ff.���AUI��ATUSH��(H���dH�%(H�D$1�L�d$H�l$1�L��H��H����O������y�����~H�t$H������f����C����I���I9��t\I�������I���I����p$��I�������I���M��H�
C����FH�5�����I���H������I���1��H�c�H��������taH�
���H��1�H�5?��5>��L�������uA��Xu1�L���e���DH�D$dH3%(��H��([]A\A]�H���I��I����6�H�ԷH���7�����tHH�����H��I�����M��6H��I��H�
�5H�5��1��}�L����'���k���H����������ff.����U�0�H�O�SH��H��H���H�������t7D�CH�
�H��1��0H�5���H��H�߾[]�k'��H���P���ff.���U�9�H�϶SH��H��H���H���#�����t7D�CH�
ĸH��1��9H�5���~�H��H�߾[]��&��H�������ff.���U1���H�R�SH��H��H���H���������H�
����H��1�H�5��<��H���H��t�Cp�H���!��H���H���H��t�Cp��H���N�H���H�0�4H����o���)A���{���^H���H��t:H���H�����}���H��H�5���H���H������H�����E��H���H����H���H����H���0���H��H�5f���H���H�����H���H��[]�uE��DH��1���H��� ���fDH��1��<��H�����fDH����^���I��H�
h�����H�5���7��H���H���(���H���H���@���H��[]ÐH��H�5����H���5��H���H���[]�'��H�����2���I��H�
�����H�5/��E��H����{���f���AUI��ATI��UL��SH��H��H�7H��tH��L���C��H�CxHǃ�����H����oEL��C�oMK�oU S(�o]0[8�oe@cH�omPkX�ou`sh�Eh�������X��	Ј�XH�uP�,��L��H�CXH�uX��+��H�5Q���H�C`H�}`���H����uhH��@������H��L�����H���1���H��H���i�����t-H��H��H�
.^1�[��H�5ݲ]A\A]��8��fDH��H��[]A\A]��fD��H�5��1����H����p������UH��H��SH��H�����H��tH���'��H���H��[]�f���UH��SH��H���H�����H��tH����H�����X�H��[]�f���UH��SH��H���H����H��1�H�+����XH���H��[]�f���H����X�o���H���� H���<��fD��AVAUATUS���g���I��H��A��H��H��H����I��H�G1�1�H��I���U��I��E��t/D;`t^H�H0A�E�H�@H��H��f�I��H��0D9a�t:H9�u�I��I���&��I��1�H���j���L�0I��D�`�@����I�X I�h([]A\A]A^��I�>�`H����/�I���0Idž0H��I���2���f.���UH��H��SH��H��(H�?dH�%(H�D$1�H�����H��H�5G�1�����H���H�t$H���H�D$�~ ��H���1��:H��H���q��u%H���U�H�D$dH3%(u}H��([]�fDH�|$��9C��H�
Ͱ�:H��I��H�5��1��5����H�T$��H������'��H�;H�L$Hǃ�H�����������ATUSH�������x0�@�Q9��H�5Z�H��H�������H���b���H��������x%H������U��H�5,�H��H������H���H��H����H�G1�1�H��H������H�Å����x�����E�L�%��H�,@H��H���H��0�{�������H����������sL��H�C1��$@��H�{H���(���{I�ٹ`L���H�D���U��H�CH9�u�[]A\��6���f���U1��kH��SH��H�H�H���H���_����H�
CY�kH��1�H�5ԭ��3����XHǃ����X���H�������H����O�H������H����7�H������H�����H��PH��tH���H�������H�H��tJH�H��H�@H��[]���H���x��I����H���S�H���N����,���H��[]�f���SH��H���H��t�w���H���H��t�f���H���H��t���H���H��t���H���tH����>1��H���H���H��t���H���H��t���H���tH����O)��H���H��@H��[��ff.���AWH��H�=��I��AVI��H��AUATM��U�͹SH��8dH�%(H�T$(1���À��ۅ����H�=�gH����À��ۅ����H�=)�H��M����À��ۅ���L�@1�H�L$L��H�T$ L�D$����L�D$��x
�t$f��u_L��H�=��1�������=��I�EH�T$(dH3%(����H��8[]A\A]A^A_��H�xL��L���!��I�$�H�|$ D��L��L�����I�$�fD@��H�xL��L���e��I�$낾:H�ǻ�����-��H�=F�H��1��\<��I�E�V�����ff.���USH��H���ф����X�H��H�H���H���@1�H��H�;�H��$H������u#H���{��{��u8H���0��xZH��[]�H��H�
���@1�H�5���/���{��t�I��H�
��EH�5˩�:��H��H�����0��y�H��H�߾[]�
��f.���USH��H��(dH�%(H�D$1�H�d�4�D$����H�(�l��H��H�D$��@��H�T$H�5s�H���+���|$�tTH�����H���@��H�|$���H�|$�����$��u6��(H�L$dH3%(u'H��([]�f�H�|$�#���@����������@ATUSH��H��h�-4��H��`tH��`��+�������|ǃx����ǃ(�������������u&�����ǃ(H��[]A\���D��H�����~Y����fH�٬�H��������D��|H�
!�H��1��fH�5��A������D<��uH����H���'����/D��|H�
�H��1��uH�5M��{��5���fDL����Z�H�%�L���������A��H�
N�L��1��ZH�5���3��ǃ(H��[]A\����f��jH�ѫ�H���w����D��|H�
A�H��1��jH�5��A��������f��pH����H���'���t3D��}H�
x�H��1��pH�5P��~��8���f�H�����H��[]A\�,��@L�����#���ff.���ATUS�G9�x�ŀ��L���H��H��1�H�۪L������uBL���j��Eǃx������|���������u=�����x)[]A\�@H�
Ѫ��L��1�H�5u��+��말�����y�H��[]A\����f.���H��ht"SH��H��h�2*��H��h[�5���D�+���ff.�USH��H��H��`tH��`�(����x��xYH���1���H�ϩH���z���uFH���^���x�	��
����xJ��x1�H��|�f&������H��[]��H�
Y���H��1�H�5e��*��룐H������H�E�H�������t,H��H��H�
6�1�[��H�5�]�I��f�H��H��[]��f�H������H��H������t,D��xH��H��1�[H�
 ���]H�5������f�H��H��[]�B�f���SH��H��h�L/��H���t���[�=��ff.���USH��H��hH���/����x��>~����$����H��������1���H��H���������H����������x��+	������H��`��}��I��H�
[�������H�5���u��H��hH��[]��ǃ$H�������Z���1���H�q�H������uXH�����H���H���H��H��[]����f.�D�CH�
��H��1���H�5!��_(������f.�A����H��1�H�
1�H�5��-(���H������H�ͦH���x���u$H���\����x�	�����O����H�
A���H��1�H�5������Ő��AUATUSH��H�������<�����x������������H��|�"�����VH�=Ϭ4H����s���Lc�@�����C���tH��L)�L9���L���1���H�եL�������XI��M��H�
��L���H�5��1���&��H��t$I��H�
&�������H�5���C���H��hH��[]A\A]ÐH���1���H�X�H��������H�
���H��1�H�50��n&��ǃ(H��H��[]A\A]���f�H���1���H���H��������H�����H��H��[]A\A]�a����H���1���H���H���c���t/H�
���H��1�H�5����%���i���D1�����H������O���L��������H������%���H�
!���H��1�H�55��s%���K���ff.������LJ�������y��f�SH�����%��x�[�f.�H����?�H�ţH���p���t,H��1�H�
w��?H�5�����������[��H���(�������[Ð��AWAVAUI�����ATI��USH��XdH�%(H�D$H1�H���L�l$0L�l$8tH�|$0������I��$�tH�|$8����*I��$H����H�E1�H��1�I��$�D$H�$�0��H�$H�Ņ���E1�E1��F;��A��A��$x����a����M��$�1��
H���L���<�����H�
���
L��1�H�5i��#��A��$xI��$pH�=k�1��I/��L��H���.���|$0���B�|$<�����|$4��x�����D$4A��$��|$8��x��f����D$8A��$��D$������H��1�H�$�1�E�,��H��0D���#���D�m�H�CH9$�IH�ÍA�<�I������y�M��$��%�H�o�L��L�L$��L�L$����A�E�%L��E��H�
��H�57�1��c���f���fD�������w����H�$L�mH���Y��H�$I�Ǎ	�x�D$H���?��H�$L��I��H�X�A�I�D�H�D$H�D$@H�D$f.�H�|$H�4$�R�H�4$�����D$@H��I��0H���F��D$D�C�A�EЉC�H;t$u��D$A���������DL��������L��E1��-#��A��$xL��H�5+������L��I��$`���H�L$HdH3%(D����H��X[]A\A]A^A_�L�����������������M��$���H�ǟL���r�����H�
���L��1�H�5�������f���������]���M��$���H�g�L���������H�
��L��1�H�5?��m�������E1�E1��D$�R���DI��$����H���H�������t3D�D$D��H��1�H�
��H�5Ӟ���A��������fDH���X����L���N���w���L���A���v���I��$����H���H���+������H�
L���H��1�H�5X�����+���I��$����H�5�H���������H�
X���H��1�H�5
��;���|$0�����|$4�����|$8���v�|$<����D$���������1�H�-��I�D�H�$�A�?�����xq��I��L;<$�u�����A�<�����y�M��$���H��L��L�T$���L�T$�����CH�
��H��L��E����1��m���M��$���H��L��L�T$����L�T$�����CH�
j�H��L��E����1�����;���I��$����H�˜H���v���������H�
��H��1�A����H�5�������r���L���0������L���#������H������K��������}���I��$����H�H�H����������H�
����H��1�H�5 ��N���2����D�������I��$����H��H��������KH�
B���H��1�H�5ț����������������I��$����H���H���C�����nH�
%���H��1�H�5p������������]���I��$����H�@�H���������#H�
u���H��1�H�5��F�������|��H��������|$4����|$8���\�D$��tt��1�H�-КH�$�
H�CH9$tXH��A�<������y�M��$���H��L���F�����W�D��H��L��E��H�
ܞ1�����A�t$pI�T$`I�|$���#��A�D$p�l$0�\$<M�|$x�����$I��$pH�D$(��yL�-/�4A�m��yL�- �4A�]������t4����������q��L�-�4A9]t9�t��������p���<$��L��M��td�}���t6�]����p�����q������p��9�t���������p��H����H�-��A�^9�t	����I��A�>���u��`���������H��H������H�t$(�H��H������M��u�L���H��I�����I�?u�H�߾��	��H����I��$�H��tAI��$��	��I��$�1�H����I��$�H�HI9�$��o��H�8�,��H�{�o��H�H�8H��������������p��H���
���~���1����\������n����u*L�-X�4A;mt���k�����n�����F����Z�����������y��?o��H��4��8������4����n��������I��$����H�ǗH���r������H�
���H��1�H�5���������H���0��������������I��$����H�b�H���
����t/H�
՘��H��1�H�5>��l���P���L�������]���H�������6���H������5���H���������H���������fD��AW1�I��1�AVI��H��AUATI��H�=��USH�������H�=ޘI���.����H��H�H��PM��L��L��H��H��H���/��H���L��H��H��0H�K�H��8H�
�H��@H���H��HH���H��P�
��ǃx����H��p���H��H��[]A\A]A^A_�f.���SH���H��tH�������H���H���H��t[�)��f�[�ff.���SH��H����\��H��[����U1��SH���SH��H��H���H���������H�
���SH��1�H�5p����H������H��`���xu����uB���I�ٹn�lj��L��H���L���H���H��1�[]�@H��������E��fDH���X���r����˺�������H�����
���\H����H���'����tCH��`H�=�����H�
�z
�\I��H��1�H�5o��p��H�������[]�@H������H�������[]�@I��H�
n�`�dH�5'���H���H��1�[]���eH����H���w����t�L��`H�
U��e�Z���ff.����������H�Lj����U��@��SH��H��H���dH�%(H�D$1�H���.����H�$H�z0�t~@��ty�o���oJ���oR ��oZ0��ob@� �ojP�0�or`�@�ozp�P�o��Hǃ�����`H�L$dH3%(uH��[]�������ATUSH��H��0dH�%(H�D$(1�H���tW������I�غ91�H�
ZH�5}���H���1�H�L$(dH3%(�"H��0[]A\��H��`H�t$�/����7����H�{X��H���1��H�
�H��������@H�
�O�H��1�H�5�����H�CXH��`H��H��hL���H��H��h�C��pH���H�������1��!���fDH��`H�T$H�t$��������D$H�t$H�;���H��H����H���1��3H���H�/�H�������tyD�D$�3H��1�H�
�MH�5�����[���f�H�;����H��PfoD$H����T$ �P�ǃ�����H���(������H��������L����*�H���L�������t6������L��`L��H�
��I���*H�5R�1��Q��������L��������z��f.���USH��H�ǨH��dH�%(H�D$1����H�������������g�����H���H��������\g��H�4$1�H�=[�1���H��H���p��H���1���H���H���������H������H���f�?��H�{�4���������������tH��������EЉ����I�ٹ����L��
�H�
��>�{H�������H�D$dH3%(�H��[]ÐD�CH��1�H�
����H�5������H���f�?�<���H�ߔ4���������<���H������H�u�H��������tL�$H�
IH��1���H�5M��N��I��H�
���1�H�50���H����)���DI��H�
&	��H�5����H������f�H���X����!�����ATUH��S�H��L�������1���H���L���+����u_L������C��t�U9���)ЉC�EH�;�������EH�uH��H�����H��H���[]A\�����D�EH�
�IL��1���H�5&��7���D��H���L�������u#L���k���H��[]A\�j���f.�L�ML��`L��1�H�
����H�5������fD��f���SH��H�����dH�%(H�D$1����ǃ������|$��x��x2��8����xT�H�T$dH3%(��H��[�DH�|$A�M1�L��H�
�H�s��Y��������8kt�H����I�H�ؑH���V����t*1��IH��H�
��H�5�����������\���H�����������G��������ATUSH��pH��H��@��xH���H��txH�����|0�
uw�D0�<+��<-��1��WH�.�H��������4H�
���WH��1�H�5����H��pǀ([]A\ÐH��tTH���	��FH�ΐ�H���G������H���'��H��pǀ(����[]A\ÐH�����@H����H�������t�H�
���@H��1�H�5\��]����D��� <^��^H�7��H��������i���E��H�
��H��1��^H�5������L���H�
h��FH��1�H�5�����'���fD�CH�Ə�H���?���������H�
��CH��1�H�5��蚿������D1��QH�|�H���������H�
ӑ�QH��1�H�5T��e
��H��pǀ([]A\���aH�&��H��������X���E��H�
��H��1��aH�5������;���f�H���X�������H���H����~�����AUATUH��SH��H��pH���dH�%(H�D$1�I���Y���H���L��HDžp����H���H��@�W�� ����xL�$$��� L��H�����H��@H���=H���L�$$�W�� M��t*B�| �
I�L$��EI���;I�L$�A�H�$��tX��x����_��H�$H������� H��xH�������f�H����L�$$M��u�fD����H���L��H�ËG�������H��@H�����H����H����B t��xuH�4$H�����H��@1�H��t:H�$H��t1�|�
H�q���H����H�q���H�4$L)�I��H��t~H9�H����H)Є�HE�H��~vH�$H��xH�t$dH34%(H����H��[]A\A]�f�������4���H�$H��xH���u���� ����������������w^���H����G uqH������������3����H��t[M�������4���DE1��x���L���Ȳ��H�$�,����H���E1��W�� �����x������]��E1�����A�����������ATUS��$���LJ$uo���H��w��H��[D��]A\���L������H�J�L��������t<H�
���L��1�H�5&��'����DH���[]A\����L���p����x���ff.���USH��H�ǠH���'�H����[���|�H���H���H���+����twD�KL��`H��1�H�
���|H�5~�����H���A��1�ǃ$L�Y�H�
؍H�����H��Hǃ�����H��[]���H��蘻���fD��USH��H�ǠH���W�������H����E����H������H�ˉH���I����uMH���-���H���A��1�L���H�
�H��~����H��Hǃ�����H��[]����L��`H�
>H��1���H�5S��T����f����I��L�0��H�.���Z�H���H��[]�ff.����AWAVAUATI��H�ǨUSH��H�o�dH�%(H�D$1��k	��I��$����L���v��A��$��G������H�5��H��H����I��$�H��tQL�:L�rM�M9�tBf.�M�/�H��I��H�5e����L��H�������
H�����M9�u�A��$����H�56�H����H��u!�(fDH��H������
H����H�uH��u޾
H����H�SI��$�H�3���H���L����H�D$dH3%(��H��[]A\A]A^A_Ð�H�5��H������b����H��4M��$���H�8L�,$H��P1�L��L��pH��I�EH��XH��XH�g�H�C(H�L���H�CHH��X��H�CXH�V�H�C`����ƒ�����A�U��	Ј���h��L���`��H��1�L������H��I��$������@I��$��=�H���H��������u#H������L��������f�I��$����I��$�H����I��=H��I��H�
7�H�5!�1�� �����Y���f���AW1�I��H��AVAUI��H�=%7ATA��USH��H�T$1����H�=�I��������H��H�H��PL�D$L��L��H��H��H���o��H���L��H��H��0H���H��8H���H��HH�8�H��@��D��H��`�������	�H�؈��H��[]A\A]A^A_�ff.���AW1�I����AVI��AUA��H��H�=.�ATE��UA��SH��H�L$����H�=�H�$� �����H��H�H��PH�L$H�$H��H��H��I��L���r���KpL��H��H���H��0H���H��8H���H��H��D���fD���H��`H��A��A��E	�D���H��[]A\A]A^A_�ff.���AWAVAUATUSH��(H�$L�D$dH�%(H�D$1�H���DH��H���8A��H�T$H��E��A����������U��H�t$1�H�=Lz1�A���x��H�=քH�D$�����I��H�L���PH�$L�D$L��H�T$H��I���5��H���A�NpH��I��0H���I��8H�Z�I��HH���I��@���L��H�����H�T�H��L��I��`H���Z��A���I���A���fE�����A	�L��E���H�L$dH3%(uH��([]A\A]A^A_����L��H�
څ1���H�5��H�=M������ATUH��SH�G@L� �<@�C1�sI��H�H��tH�s1���H�Ņ4H��H�8H��P H�}P�@���H�]PH������u�[H�}(]A\���SH������{�t*H�{ �H��H�{���H�{�����{�^����C����H�{0[�]��ff.�f���AVI��AUI���hATA��UH�- �4SH�}H��PL��H�����L�kX�H�����H�H�}D�c`�C�������H�CHH�{@H�C@���H�CPH��[]A\A]A^�ff.���SH�H�H���	���H�{@����H�{P���H�3H��tH�x�4H�8H��P H�{0H��,S��H�V�4H��[H�8H�H�@ ��fD��ATUSD�gA����!S��H��H�?@��������Ń����H�{0����k����ӣ��H�������H�C������I��H�CL���H����k��H�{H�5��H�C �w���H��x<1��[]A\�f���������k�������8��R���C`u��R��H�{D���j��H�3H�=��H��1��f��H����ff.����SH�����H�CXH��t�Є�tH�-�4H�H��H+S8H��
H�{0t[�@H�C8H��1�[���I��H�
�����V��H�5���@��H�C0[�f.���AVAUATUH��SH��dH�%(H�D$1�H�G@L�t$L�(�s�H�]PH���L�����Q���C1�sI�\�H�;t)H�=Y����L��H�s�D$�L��谡�����]Q��H�!�4H��H�8H��P H�}P蜹��H�}�S���I��H��u�H�}�G��u_�G �?Q��H�](H��tH�}P����u0H�}(����H�D$dH3%(u!H��[]A\A]A^�f.�H��������Q������H�uH�=m�H��1����H���?����ff.�f���SH��H�P�/�����P����P��f�ATI��UH��SH��0�_dH�%(H�D$(1����tZL��L�$$�.���H�}H��H�D$H���H�D$H�D$�c�H��x01�H�L$(dH3%(��uH��0[]A\Ð1������y����n���H�}�����H�uH�= �H��1����H���U������AUI��ATI��UH���SH��H��dH�%(H�D$1�H�J�4H�8H��PH��H�$L�`L�(H�{P�*���H��H��������x+H�{(tTH�T$dH3%(H�$ufH��[]A\A]�DH�{(���I�غ�1�H�
���H�5������H�C(�@I��H�
V�������H�5e�� ��H�C(��U���D��ATUH��SH�H�L�gPL���O���H�E@H�pH9uH�O��L����7O��E�L$A�t$1�D��A�ID��I;�tf�9��O����1҃���I9�u�H�[]A\�ff.�f��������������@AUATUSH��H�H�H�H��t8L�-�~4I��fDH�SL���SI�}H�kH��H�H��P H��u�H��[]A\A]�ff.�f���SH�w@H��H���H�8�t���H�{ [�Z���f.�SH��H�� �C���H�s@H�{8H���?����{�t2H�{����H�{(�'���H�{0螪���{�v�������M���C����[�D��AVL�5�AUATI��USH��H�(dH�%(H�D$1�L�l$�h���H��yF�fDI�\$8H����M���EH�u<-�B<:uvH�S1��SL��������hM��I�|$(�3���H��H���7H�=�����D$A�D$H��t��UH�u��-����:t���+�!��A�D$H�D<+t|H�=�1���	��L����H�H�CH��tgH�BH�CH��twH�H�H�CH�H�S�SH��|4H��H�8H��P @���"���L���G�������f�H�1�H�CH��u�I;\$8u�I�D$8H�CH��u��I;\$@u�H�I�D$@��1��L���@��A�D$H���L������H�D$dH3%(u
H��[]A\A]A^�记��H�=�~1����A�l$H�F���D��UH���PSH��H��{4H�8H��PH��H������C����H�H��H��[]�ff.�@��USH��H�H�H���$���H�3H�-Z{4H��t
H�}H��P H�H�}H��H�H�@ H��[]��ff.���AVI��AUI��� ATI��UH��SH��0dH�%(H�D$(1�H��z4H�8H��PH��L�pL�`H�E@H�CH�H��t8H�XH�} H�]@t8H�L$(dH3%(H����H��0[]A\A]A^�DH�} H�]8H�]@uȃ}�tCL��L�,$臭��H�}0H��H�D$H��H�D$H�D$�����f.�H�}����E����JJ��I��l���L�%���H�c|����}H�����H�E�ƙ���}H�����H�E(�s����H�E0H��蒴���J����x������H�H�H�@H�w8H����H�~��USH��H��H�-ry4�@H�VH�PH�FH��tLH�H�H�FH�H�}H��P H�s8H��t7H�~u0�CHH�H��u�H�FH�C8H�FH��u�H9s@u�H�H�C@�@H��[]�f��f.�D��S���DI��H��H�(����H�{����C����KI��I�ٹp���L��H�e{�>���{H�����H�C �[����{H�����H�C0��H�C8H���'���H��t4H�3H�=~{H�1����H�{8H������H�{8[����fDSH��H�� ����H�{0�*���H�{8衤���{�y�������H���C����[����AWAVAUATUSH��H��(H�0dH�%(H�D$1��r���H���AH�{0�C@��H�D$L�-xzH�D$L�d$�`���I��H�����	L���D$�O���I��H����H�t$H�hL��菻��H��������A�~��H�w4�H�8H��PL��H�I�NjD$A�G�C���L��H��D$�SL���_�������G��H�{0���I��H���N���H�D$dH3%(ubH��([]A\A]A^A_��{���H��tԺH�5iyH���r������dG���K@H�{0����D�{�tH���:���H���r��������L��H�=�x1��Z����^���DSH��wH��1�H�=y�h���H�H��H�z8����H�H�x8����H��B���G����H�މBH��u4[H�8H�H�@ ��f���AUI���HATI��UH��SH��H��u4H�8H��PL��H����L��H���H�kH��H�C�C�������H��H��[]A\A]�f���USH��H�H��C����F���{�tH������H�{(�:�H�3H�- u4H��t
H�}H��P H�sH�H�}H��t
H��P H�}H�CH�H��H�@ H��[]��f���SH��wH��1�H�=�w����H�[H��H�z8�t���@��SH�1�1�H�H�=Ҿ����H��[H���E���D��H�5������SH�H����E��H�1�1�H�=!x
���H��[H�����f.�f�USH��H�H��s����H�ChH��tH�sp1���H�{P��H�{H����{@���u:H�-�s4H�s8H�}H��t
H��P H�}H�C8H�H��H�@ H��[]��f��������(E���C@�����f.�H�H�x(������g����E���AWI��AVAUATUSH��H���H�T$@H�L$HL�D$PL�L$X��t:)D$`)L$p)�$�)�$�)�$�)�$�)�$�)�$�dH�%(H�D$(1�H�=�o4H�s(�kdH��$ �D$H�D$H�D$0�D$0H�D$ �]���H�{A������KH�t$L��I��D�c�L$��H��H�s8M��jH��E��1�UH�=�vAV�L$,�~���H�� H�D$(dH3%(uH���[]A\A]A^A_�����H���Gd�H�|$H�tX�@H)�諺����~WH�|$Gd��vB�Gd�WX9WukH�GhH��tH�wpH��X��H�D$H�@hH�|$���H���@�GdH���t>�������ht2��t�H�|$H�5�1��*�����H�5�v1������H�|$H�5\v1�����ff.���H��H�5du1�H�|$����H�|$����H���fD��AUI��H�=JuATI��USH���ˡ���0H��H�H��PL��H��H�hH��L�(���H�{(H��1�H�C���H��H��[]A\A]�D��ATUSH�� L�'dH�%(H�D$1�H�H�\$H�l$I�|$(趑��H��H�$�DH�D$H���@�4���H�<$H��H������u�H��蹰��I�|$(��I�D$H��tH�I�|$�PH�D$dH3%(u	H�� []A\�輤��ff.����AWAVAUATUSH��8D�NdH�%(H��$(1�E����A���FH���pA��H��o4H��I��I��M�žxH�8H��PL�%�l4H�D$H�(�Ao$L�xh@(L�ppH�{H���F�i�H�T$H�B8�E �oK�oS �o[0�oc@���okP�os`)L$0)T$@)\$P)d$`)l$p)�$��E �D$0�n�D$<��B�D$8�B�o|$dz�D$t�B$�3H��$�������x@��H��$�D��$�H��$�I��`����L��H������H�t$0�`H��I���r����$�H�spL���_��L�|$I�8�A��A�G@L�|$A�@�����I�NI��3荴��H����I�NH�\$H9���D$0I��H�
�����H�5Nr��_�C�{�L�������H�CPH�\$H� r�{@I�����D�d$0H�CHH�](L��H�����H����H�T$L��H������D$0A�E�L@�E �D$0�~���@���H�
��8t_I�W8L��H�5�s1���H�|$�(���H��$(dH3%(�&H��8[]A\A]A^A_��H�}����H�D$螊��L�|$�Ao$��I�8)L$ �P���A�G@�w���L�|$L�D$A�@���t]L�=�i4I�H+EH���a���H�t$ L�����H�T$H�=�rH�r8H��1����I�L�|$L�D$H�EA�@�������A�8H�
��H��qHD����@�H�|$H�5�p1�����H�|$�	�������@��H�5wrH��1�������Ơ���>�����H��H��L��I���o�oH�oP �oX0dL�%(L�\$xE1��o`@�ohP�4$L��$�H�L$pL��L��H�D$)L$ A�B)T$0)D$)\$@)d$P)l$`�t�H�D$xdH3%(uH�Ĉ��������SH�(��H���M�H���o=��H�@h[�f.�ATI��1�UH��SH�?���H��H�EH�hH�H9�u�/�H�� H9�tH�{L��蛸����u�H��[]A\��1�H��[]A\�ff.�ATI��H��H�5ބUH��1�SH�� dH�%(H�D$1�����H�T$H�t$H��H��������xXH�\$H�}H�������u#H�D$dH3%(uBH�� []A\�f.�I�<$H���T��H�EA�L$ ����{����8t��L<��輞��ff.��AWA��AVAUI��ATI��USH��8H�:dH�%(H�D$(1����H�D$A�D$ �9<��H�=�p�d���D$�V���1�D��H���)�H��H�D$ �,��I�D$H�(L�pI�L9�����H�U1�H�5�pH���C��H�uH���G��	H���Z��H�uH���.��	H���A��H�uH��tH�����
H��H�� ���H�SH�3H�|$ �n���I9�t!H�{�v���1�H��脨���g����H�|$ �n�����xaH�|$ �@���H�|$��������A�d$ �D����������A�d$ �1�L�����H�L$(dH3%(u`H��8[]A\A]A^A_�H�|$ �O���H�t$H�=��H��1��I�H�|$ 返��H�|$蕇������:��A�d$ �L������������賜���T:���:��f�AW1�AVAUATUSH��H��(H�dH�%(H�D$1��t���H�{1�1��G���$���u?�������8�\:��1�H�L$dH3%(���.H��([]A\A]A^A_��H��L�|$L�t$H���������L�-�nH��H�D$�L�����H��D$�̐��H��I����������I�<$L���<������H�sH�{�'��H�S1�H��H�����H�D$H�EI�t$H�;����H�EI�t$H�;����H�EI�t$H�;���H�uH�UH��H�E����L���������99��H�|$���H��H���4���H�|$�o��uH�|$�n�����������H�sH�= ���H��1��G���H�sH��H�=�m1��0��ff.�ATUS�G ��8��H��H��H�1�H�wUA�����H��E�ȹ�H�=�n��A��XZA�����8��H��������x�K D��[]A\�H��A�����諮����f�USH��H��dH�%(H�D$1������xP�S 1���uH�L$dH3%(u<H��[]�@��u�H��H��H���%������t�H���H���#�����뻸������™��f���AT�I��H�=�lUS贕���(H��H�H��PL��H��H�(H������H��H���H�C�׼��H�C H�CH��[]A\���H��H�?H�H�H��tH��`��ff.�@��AVI��AUATUSH��H��dH�%(H�D$1�I��L���/���A�ă��t@H�{L�����H��H��tS1�謼��H�uH�UH��H�E�H���D��L��H�����A��H�L$dH3%(D��uQH��[]A\A]A^��H�sH�{����H�S1�H��H��貣��H�;�L��H�EH�;���H�E�p����>���ff.���AWAVI��AUATUH��SH��HdH�%(H�D$81�H�t$0H�t$�9����D$�����I�NI�VE1�H�AH��L�!H�T$(1�H�L$ H��H�D$D�h���u�fDA�_I�GM9�t4I��L��H��D��H��I�|艰����u�H�T$(L��H�|$ H�����;\$tIH�T$�t$L�������x$�H�T$8dH3%(u2H��H[]A\A]A^A_ø������f�H�|$�v���A�f �1���������ATUS�>�R5��H�O1�H��I��H�iH��H�w��tLH�H�H9�u�/�H�� H9�tH�{L��諯����u�H��[]A\��1�H��[]A\�fD�C���H�KH�i�f���AWAVAUATUSH��dH�%(H�D$1��:��4��I��I��H��H��L���q���A�Ń��tiH��H���΅��H��tH�xL���
�����uqH�{L������I��H��tuH�;H���Z��1�I�F迹��L��D��H��I�������x
�������H�L$dH3%(u]H��[]A\A]A^A_�@L�����c �1����H�sH�{����H�S1�H��I��負��H�;L������I�F�Y����I���f���UH���SH��H�g`4H�8H��PH��H�(H������H��H��[]�fD��H�1ҋwH�AH�@H�q9�t4�FH��1҉GH�yH�IH�GH��H9��s3��H��H�H��H�Ð1��ff.�f���H�7H�H��tH��_4H�8H��` D��AWAVI��AUATI��USH���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1������H�=)\4I�t$ �$H��H��$�D$0H�D$H�D$ H�D$覦��H�5�gH���1�����I�\$H�����H�5H�����H�{tA�T$0H�5�kH��1������H�=�[4H�s(�A���H�5�kH���1��~��D�k@H�{lD�{DLcc<�y�H��E��H��H���AUH��M��1�H�5wg�B��H�[XZH��t'H�=0[4H�s�ץ��H�S@H�5�gH��1����H������H��L��H���*��H��H�=lkH��1���H�D$dH3%(uH���[]A\A]A^A_�����ff.�@SH��H��8�s���H�{@�
���{4�������%1���C4����[ÐH�GH��t/H�@H��t6H�xtH�=k鋔��H�=�j�|���@H�=�j�l���@H�=�j�\���ff.��SH��C0����0�����C0��H�H�{��0���{4�tH���5���H�{@�,���H�H��ttH�SH�PH�CH��tH�H�H�CH�{H��G4t�����CHt!H��\4H��[H�8H�H�@ ��f�[�fDH�CH�8�l�����f.�H�SH�CH9Zu�H�BH�C�}���DUSH��H�H��{ �����H��x4�t�P0��� 0�����P0H�SH�CH����H�BH�CH��tH�SH�PH�CH�CH�����H�-�[4H���H�}H��t
H��P H�}Hǃ�H�H��H�@ H��[]��D�������y/��H�H�=m�H�@H�H�p1��߈���6���f.�H�H9Z�S���H�BH�C�F���fDUSH��H��H�H��tH9x�N/������H�{(���H�{ �ά���{�v������O/��H�{0���H�-�Z4H�s@H�}H��t
H��P H�}H�s8H�C@H��t
H��P H�}H�C8H�H��H�@ H��[]��f���SH�H��H�5�dH�81�����H��[�;���ff.���AW�`AVAUATUSH��H���L�oH�|$H�l$L�d$ �4H��L��dH�%(H��$�1��D$������x��H��`��H��th���]v���8�dA��L��g1�H��H�
�iH�Fh菠��H��$�dH3%(�OH���[]A\A]A^A_�fD�{0�H�5�cH�������f��T$p��tX�����L��$�{4L������T$pH��H9�t-H���R�{0��H�5�cH���k����fD�t$����H��$���1������dH�|$xH9�$����|$��h����t$pH��H�����$�1�L��$�fDA�|�<H��H�XH9�u�M�<61��v���|$p)�|$pH�Ǡ�O���foL$ H��foT$0H��H�FU4L��fo\$@fod$Pfol$`M8�oH�D$UHfot$p]XH�E�D$E(�E ehmx���S����T$pH���L��H����I���H�D$�@0H�EH�PH�UH��tH�jH�hA�E4tL���$���I�} H��H��L���.������f�H�5�eH��1����H�|$�4�t���H�|$�5����l���H����M�<������¹`H��1�H�5�a�x��������H��$�I������L��H�5/bH��H��1��J����H�5�aH��1��7����s���~q��H�5)eH��1������Y���H�5�dH��1������C���L��$1�1�M���$�����1�L��$�;���H�5~aH��1���������H�5�dH��1�����������@��ATI��UH��SH�~��H�0V4�8H�8H��PH��L� H�EH�CH�E H�C�u(H�}@�������H�C H�}���H�C(�E�C0�E(�����C4��	ЈC4I��$��Z*��I��$�H��[]A\�fD�F���*���a������ATUSH��H�/dH�%(H�D$1�H�H�EH9���*��Hǀ�H�} I������H�}H�<$H��u�=�{���L������H�$H��H��t!�4�H�_u�H���)��H�$H��H��u�H��T4H�u(H�;H��t	H��P H�;H�E(H�H��P H�D$dH3%(u	H��[]A\��k���ff.���H��T4ATA��PUH��SH�8H��P�#�D��H���@0L�����H�bH�hH�MQ4I��D�c4�oC ���H�����D��H�C8�����H�C@H�����H�H�EH�CH��tH�H�]�E4t[H��]A\�h����[]A\�ff.���SH���O4H� �����t[�DH�{ �ǩ��H�;[��z��ff.�UH�VSH��H�|$H�H�XH�+�����u	���tD�HHH�6�S�C4u$H�D$H�|$�@ �������H��[]��H���(�����fD�HHH�6�SH�{ �]����uH�{ � ���H���8z����(�����AWAVAUATUSH��HdH�%(H�D$81�H�H�T$H�D$ H��H	��(���B8H��H��L�d$,�D$4�D$,1�H�����D$0�|���L��D$4H�D$ H�x@����H��tKH���{H�D$ H�|$H��H�@�PH�|$����H�D$8dH3%(�DH��H[]A\A]A^A_ÐH�H���-H�D$H�=�`H�H�@H�H�p1��s��H�E1�L�
�`H��u�@A�@H��I��H����
H��L�������u�H��
H�|$ H�T$���4�t���H�|$ �e�L�t$I�L�xA�G4��H�|$����~���D$����4�H�����I�~lI���I�I�~XI���=�L��L��E1�H��H�5�]1�����H�;t0D�	L���+���H�uL�����A�EH�,�I��H�}uվ
L������I�L$A�v I�$�|$�
���I9D$�0�|$��af���<n��L�-�P4�HI�}H��PL�0H�;I�����H�|$I�D$8�y���|$M��L��I�D$@���H�EM4H�^�oA�|$AD$�ڪ��M��H�
������I�D$ Ai0�H�5�]���I�}�I�D$(�_���I�D$0I�~�%��M�fA�G4�����L���H�����H�|$ H�GH�@(H�D$H������H�|$H�������O���H�=8]贆������I�>H�T$H��xDH�5\1���H�|$A��1�L�]H�
�^H�'^�
���H�|$������H�5�]1��p���k��H�
��I�>H�T$�8H��TH�51UHD�1��>��觃��H�=@[1�H�-�Z�����k���ff.�f���AWL�=�]AVAUATUSH��H��(dH�%(H��$1�H�L�d$L�l$L�0�D$�����@H��T$�P H�{0H��L���G����{L��L���m��H��H��~,�|$�t�H��x 誑����y�L��L��1��i���H�{0L�gM��ucH�����ej���8u0H��$dH3%(��H��([]A\A]A^A_��H�S@H�5�\L��1���H���s�뱐�u��I�t$�B�| �
tNH��u�H�C0H�xtH�S@H�5kZL��1�����H�S8H�5uZL��1����f�H�{0H;wr7�Au��H����v��H�H��H�BH�;���H�H���������躌��H�{0�证��f.�DAWI��AVI��AUATUH����SH��H���|��H�=�I4H���I���V���H�5�\L���1�蓻��H�����H�=~I4�k8H�s D�k4������H�5E^L��E���1��V���H�{��H�5�\�q���H�=R^�PL��H�=��H��U@������H�w\H��H��������tQL���	t��M��H��I��H�
$^H�5D\1��Vx��H�SXH�CPH��L��[1�]A\A]A^A_��f�H���y����fDH�=�H4H����=���H�5�[L���1��z�����DSH�H�H�{茩��H��tH�PK4H��[H�8H�H�@ ��[�ff.�AUATUH��SH��H��dH�%(H�D$1�H��H�n]HD����H�������I��L�%�VH��uT�H�JH�PH��t_H�H�H�$H�@H�L��H��H��H�4$���L��� ���H���H��t<H�$H�H�HH��u�H���H�PH��u�H9��u�H�H�����H���1��z`��H����>��f�����H�D$dH3%(uH��[]A\A]Ð��������~���AT�I��H�FZU�H��SH��hH��������t2D���E�$H��1�H�
;\�H�5Z蚅��[1�]A\�H���xw��[1�]A\Ð��ATI��USH��H��H��dH�%(H�D$1��s����\H��H�u�H�=udH����€����H�ƹH�=�Y�����unH�}H����.����xZH���H��u�D@L��M��t8L�e�E09��t�\t�H�u0H��������uЀM`L��M��u�@��2�H��h�V�H��XH���~����u,H���dv�������H�T$dH3%(��H��[]A\�f�M��H�
>[�V1�H�5�XH���t��������f�H�}H�����H�}���H���P�����x4H�}H�t$�>�����x"�L$�$H�5WXH�������]���@H��h�I�H�XH���}�����$���M��H�
^Z�I�K����G|���H��(��Mb�oG dH�%(H�D$1����)$H�<$����i��H�H�$)�i��HD$H�D$H=?B~H��H-@BH�$H�D$H�5D4H��踎�����H�H�L$dH3%(uH��(��{��@SH����]��H��H���H��t/����7���I��H�
��6H�5W�����H���[ÐATUH��SH��L�&H����v褚����� ��H�H�CH��t0H�BH�CH��tCH�H�H�CH�M��tA[]A\�@H9��u�H���H�C��f.�H9��u�H�H����H������[H��]A\������UH��SH��H���dH�%(H�D$1�H��H�����H�JH�PH����H�H�H�$H�@H�H�$H����p蛙�����%��H�$H�=XB4H�p �����MbH�=cX���������)�i��)�1����r��H�4$H�
QH��H���,���H�����H���H��t`����m�����uQH���H�$H�H�HH���&���H���H�PH���#���H;���(���H�H�������fDH������H�����H�D$dH3%(uH��[]��(y���AT��UH��I��SH��H���dH�%(H�D$1��D��H��H�$H��tXH��H�����H�$�C`u#H�L$dH3%(H����H��[]A\�H�SXH�5�O1��SPH��1��f����@H��h�x�H�TH���y����t,E��H�
�VH��1��xH�5�S�p���t����H���hq���`����.x��ff.�SH��H�dH�%(H�D$1�H��`H�H�$��x����������xtH�D$dH3%(uPH��[��H����D���H����i��H���Գ��H��h����H��pH��t�H�H��p�P��xw�����ATH��USH��H�� H�6dH�%(H�D$1�H�|$H�����H�=!S�������H�{H����H�t$蛆����xH�l$�H�=�x��xH�H����������	H�=�RH����������H�=�RH��������&H�|$�t�����bDH�T$H��h��H�R�H���w����tWH�5%H������H�
>R��H��I��H�5�Q1���m�������H�\$dH3%(��H�� []A\�fDH���0o���������f��\$H�������H�D$H���6�����H�=�T1��T��H�
�LH�t$H��H���
�H�|$�s�������fDH��h��H�,Q�H���v������H�D$��H��H�
$TH�5�PL���1��m�����������D�t$H������H�D$H�������H�xH�5�P���y���H�=ZR�PH�sH��H��t�>t
H�=�u
�U@���1���H�wPH��H���v������H����m��H�D$H�{1�H�PX�PPH�|$�i����@H���m��������S���fDH�CD�T$H����E1�E1�L�
�Pf�H�ƹL����€�H����LD�A�@I��H�D�H��u�D��H�����H�D$H���k���M��tWL��H�=SP1����L���.���H�
�O��H��1�H�5wO蛶������D��H�����H�D$H������H�
�JH��OH��H���������s��f.���USH��H����X��t0H�5�R��tH�m>4H�8�m]��1�H��H��[]�M�DH��h���H��NH���Xt����t$H�
}R��H��1�H�5�N�j���DH���l���fDUSH��������H���e�����xQ�[����H��:4���H�=!O�o1�������H�{`H��菿��1�H��[]�fD�Z��H��h�8
tW��H��M�H���s����t+L���H�
����1�H�5�MH����i��������H���?k�������당�H��M�H���/s����t�H���H�=�9�؆��H�
�
��I������AUI��H�=CNATA��UA��SE�H���m����H��H�H��PL��H��H��pH���ަ�����1�ǃxH���H�����D	�@���H���X������~���H�5�3H�=��3������BZ���vH�5�L1�H��`�H���H�5Q:4H��hH���µ��H��hH�5yM��x��H��hH���H��H��`H����}��H��ǃ�x]���H��H��[]A\A]�ff.���1���D��H��dH�%(H�D$1�H�H�H��H�$袑��H������H�D$dH3%(uH���� p��������D��AWI��AVI��AUATI��UH��SH��(dH�%(H�D$1����������P���A�Յ��[�T$�X��H��:4�hH�8H��P�T$L��H��H��74�S�oC A�D$�C0A�D$�C8A�D$�C4�AoL$L�{PK<L�sXL���L��藼��H������H��L��L��耜��H���H�CH�H����H�XH���H��h�]H�5�J�B����SH�5�`
H�CH��謸���sH�=�K1��[���H�{H����v��fA�|$ �*A�T$Hf���fA�|$4��A�T$JH�{f�����uH�5J���H�=CN�P���1��wH��IH��I���o������L���ig��H����H�\$�C09��t
��\�������H�5�JH��H�D$H�ߋH8�PD�@41��!���H�D$�H��H�p<�j��H��54H�5�JH��H�1�������C�
H������H�SH�}`H�3�Vk��H�D$dH3%(��H��([]A\A]A^A_�A�����1��wL��H�
JH�5�H����H��������H���}������+������.���H�84H�8�W��L��H�5D1�A���Z���H�5�m
褶��H�{�H���I�|$4���H�{H�5�m
H���;�������fDH�{H�5�m
�`������I�|$ ����H�{H�5Tm
H��������fD�H�5ZIH���|�������H����#���@H�s0H���t�������H�t$H����H�D$1�H�51CH�PX�PPH�|$���e�����k��fD��H����0���AUATUH��SH��L�-�64�EhI�}��tCE1�fDD��H�E`H��H�H�pH��tH��P H�E`I�}H�H�@A��D9ehw�H�u`H��t
H��P I�}H�uH�E`H��t
H��P I�}H�uH�EH��t
H��P I�}H�uH�EH��t
H��P I�}H�u8H�EH��t
H��P I�}H�E8H�H��H�@ H��[]A\A]�����Fh����AUL�-@KATI��U1�SH���f���A9l$hvC��I�D$`H��H؋p���t�H�xu�H�34�8�l����x'I�D$`���DA9l$hw�H��[]A\A]��L��踺����fD�ff.�@S1�H�����{q��H������H�������1�[�f���H�?��d��@U��SH��H�ǰH��������H����3^��H��tmH���B���OQ�����t �� �L��ǃ�H��[]�fD@��t�H�{pu�L�u34I�ٹ�H��M���7���H�Cp뼐H�{p�G���H��14��8H�H���������H��[]�ff.����AUATUH��SH��H���?��uU�F ��u>�u ���9��u,H���H��t�Є�tj��8H�;H��[]A\A]�c���H��[]A\A]�D�u����}I��荼��Hc}I��聼���uM��L��H��H�=�I1�����DH��H��1�[]A\A]�\���ff.����SH��H��dH�%(H�D$1��G!tH��H��t
�xr��������������t`1���8��	�������t_9��tWH�04H�H9��u	@����H�����H�D$dH3%(��H��[Ð�����t����H���謯��H�{p�c���붐��u���fDH�=�K�4������H�=�K+���D$1�覵��H���~i��H�|$��Q�������������H���H��t$�?���H�{p�9���H�{p�ۃ���+���fDH�
�04I�غ�H�5DK���`���H�����f��f����tZAVI��AUI��ATL�%fKU1�S��I�EH���|���t�u�����V��I�E�D������A;.r�[]A\A]A^��ff.�@��H�"K�@���7A�@��tR�F�D�ɨ�D���@��:���tE��t8A��D����DE��tD8�tD���JH�����t�@8�u�ø��D��ATI��USH��dH�%(H�D$1���9�$�G H�������H�=�J�vF��H��t
��8�\H��H����L�@H�-mJ�H��L����€�����H�xPH�t$�0������x�T$H���H�x��h��1�L��H�=�
�]��H���H��H�p��€�����H�P �:t�H��H����������L�@(A�8t�L��H����€�����H�x0�����9�H�=!
�]��H�D$dH3%(��H��[]A\��L���ئ��L��H���m���H���H��H�p��€�������H�P �H��H��������������L�@(�H��L���������������:u?A�8�;���L���U����8��H�������D$��z���fDH��� ����8��H������H�=XH�\D��H��tH��迺��H�5xH�=MH�|�������H�=�+4�d~��H�=�-4訏��H���A���@�sO��L��H�=�

1��[���t���DH������/���H��耙���T���L��H�=�G����P����b��ff.�@��SH�wH��1�H�=�����H��[H�����f.���H�
*4SH��H�wH�=2<H�1�輰��H��[H��鰾����USH��dH�%(H�D$1�H�� tH�D$dH3%(usH��[]�DH��H��H�@`�8t�H�=G��迵��H�=n��D$H��H�P`H�01��/���@��H����`��H�|$H�� �BL����u�����ta��@��������8�����	�@��8���H����@��H����@��U��LSH��8H�T$dH�%(H�D$(1���#�mH�~IH��Hc�H�>��H�@H���SH�SHH�t$�����H�L$(dH3%(�cH��8[]�D��8���f��O ���DH�w8H��tH��+4H�8H��P H�C8H�|$赧��H�C8��8f%��f��8��s���1�H�=�E1�H�l$軄��H������H��H��H�D$��O��H����H�pH�=zE1�舮��H�T$ H�t$H��H���Ӻ�������H�|$�I��H�|$������8�H�C8����f���8������1�����H��*4��H�����H�8���H�CH�H��H�C@�z����T_��H�|$�H��H�t$H�=�D1��`�����USH��H��H��JJ����u�R���H�(4��H��H�蜻����tH�SH�s(�{$�أ���Ņ��H����[]�f���AUATUSH��H�=aDH��(dH�%(H�D$1�裲���;�D$u:H�|$�PI��������H�D$dH3%(�UH��([]A\A]�f��b���@H�l$H�����H��证��H�=DI���P?��H�D$H��t�H��L���F���H��?H��L��H�D$�*���H��H�5�e�+p��H�H��H��txL�l$�Lf�H�PH��H��H�T$�,���H�t$H��H�D$����L��L��H���Ɗ��H�]H��t%�=H���`��H�D$H��u�H�\$����L���ۏ��H�I�|$�����I�<$H�5#e�ȳ��H�=CH��H�D$�d�������]��f.���SH�=�BH��dH�%(H�D$1��>��H��t�8H��u�N��H�D$dH3%(uVH��[�H�=sB贰��1�H�5zBH�߉D$1��-���H�5|dH����n��H��趡��H�|$�<G����u������n\��ff.���H�����9����������H���D������D������D������D������D��H����������)�9������9�v�)Љ�����H��Ð��AWAVAUATUSH��HL�D$dH�%(H�D$81�H�������A��I����I��I��A���@�#_��H�=PA�w<��H�=QAH��ID�H��1��S���D$������t����
����1������H�=$A�<��H����A�?L������E����H�=�@�;���@H��H��H�&4ID�H�8H�T$H��PL��H��A��C$I�H�C(���H�T$H�CH���١��H�CH�D$�8�O�Қ��H�|$1�H��1��p��H�C�k �5@���CP����H�=�@H��D$ǃ������CX�N;��H���v���H�C8H������9E���H��@H�C0H�=�@�;��H��tH�shH���qi�����d���H�=:A�ͭ���D$0�sh����L�d$0L���qD���������9tL���(����������H�=�>�:��H��t�
F��H�=
[�:��H����H�=�Z�y:��H�sH�=J3H��1��R��H�sH�=@1��B|��H�=�H�T94H�e94訖��H�=�?�,:��I��H��t4�p��L��L��H��H�D$(�@�����;���H�|$(蚐��H�|$(�{��E����H�=�>��9��H���!���H���H���3h�����
�����M��H�=�?����9��H�������L��H���h��������t$0������H������H�=d?�h9��H��t#L��H����g����u�D$0��t���fDH�=>?�49��H��tL��H���g����u�D$0��t���f�H�= ?�9��H��tL��H���dg����u�t$0���L@H�=�>��8��H��tL��H���4g����u
�D$0���@��������L�C0H�SM��t�	H�=�=L������������H�L$8dH3%(H����H��H[]A\A]A^A_��胗��H���k������fDH�=4=�$8��H������H�=1=�_Y������f.�H�"4H��E1�H�8H��P�Sh�D$H�C`��u�@A��D;sh�2H�C`D��H�=,=D��H��L�$A�FA�D$1�I�$����H���7��H��t�H���PK��H�8I��H��t��`���M�OI�D$I�GH��u!�@A�D$�D$I��I�H���m����H��H�=_V�������t�H�ƹH�=�<�����u�A�D$볾H���}���H���a��@���0���H���T:�����(���H�=�<�6��H�������8�
���1�H���T��H�� ��@�|$����9D�d$��A	�D��9���fDH�=E;�4����D$������������f�A�?L����A��,��������H�=[;�6���ChH�C0����@H�sH�=�1��~M���u���f�D�c A��
D����D$�4���f�H�=�:�ԛ��H�C8�i���H���`������fT��fD������D���Gh����H����������9wh���H��Hw`H��hH�FH��HD�H���@��H����@��H�G8����H�G0����H�G����H�G����SH��H���H�?�9���Hǃ�[�ff.������8��Ð��1�H�xt�f��G ������@���G t�DUH��SH��H���Q��H�޿H���G��H��H��x'�����H���iQ��H9������H��[]�f��:���8 ����H��[]�ff.���H���������������H��鸂���������@��H��PA�Y1�L�7H�
"<H�N:�vd��fD��AUATI��H���USH��蓚��A��$8umA�D$h��td1�L�-v�@��A;l$hsK��H��I\$`H�{u�{�tހ{u؍}I��M��ZH�}6�����w��H�CA;l$hr�H��[]A\A]���SH��dH�%(H��$�1���9������H����91��j���C H�ٿH�m�����������
2��H�پH�K����1���C �@�&�umH����~����������D$%�=�������H��5�I�ٿL����v��H��1��H�CxH����u1��H���
�����9�C t	�����u4H��謀���C ��t;�tOH��$�dH3%(��H�Ġ[Ã��H���q����C ��u�H�{X�;�������C �u��B����u�H�=[6�K1��H��t�H�=�d�R����H�پ�
H��0���C ����H��� y���C ��1����`�����O��ff.���USH��H��dH�%(H�D$1�H�|$�y���tH�D$dH3%(uzH��[]�fD�l$H���踗����t��uY��8@H������fD�����8���u�I��H�
m����6��H�5�3�ל��H����v����O����H�=M21��V����\������H���$���@��SH���#�����������������9�ts���t	��������9��V����������u$���9���	�H��[�	w��f�H�{xt1H�{`t*H��[�Y~��f��������������9��t�H��[�!~�����SH��H���H��0dH�%(H�D$(1��8���H�|$����x�|$tH�D$(dH3%(uUH��0[�DH�t$������tы����u"��������H�;�H����t���H���}����iM��f����Gh��t=UH��S1�H��f.��߃�H��H}`H���:j��9]hw�H��[]�fD������8�tÃ�SH����8莓��H�shH�{`�Q����+��������u'H���_u��H���H��t[��Y��D[�fDǃ�H���|����ff.����S��uH� tH�[�f���u�H�l4H�H��t�H��0H��H���M����t�H�;�N6���@H�5a,4����f.���SH��H��x�i����:��H���
6�����9��t	��8 t>H���t<H�
�4I�غ�H�5P0�0u�l���H���H���[��[�fDH��[�'t�����S���H���t-�u8�����u���t6H���t,[�f.��>�Y�������H���iv����H�{`���H��譑�����u�H���u�H�shH�{`[�\�ff.����UH��SH��H��H�����H��H��H��[]��Y��fD��AVAUATI��USH��@H�/dH�%(H��$81����������8@��H���H���������H��1�H��Є�tuH�����H�=i4H�޻�]���
��I��]����'I��'�xdH�
��NӻY��H�5�.k�d����
)׺萗��H���H���a����w@H���Є�tዅ����^�H�\$1��H��H�S8H�s�H�A�|$�|$�$���A�ʼnD$�����1��I��A����D�(A��Xt@A���R�A�t$H��$���v�����3���$�%�=��A�D$I�|$��$��D$�D$�e��A�D$����A�D$�t$H�������$���	Ј�$��[���|$H�S:H�s$H�D$�lE���D$0foD$ ��oL$4�|$�D$\�D$DD$L�D$p�D$H)L$`�D$t�`)��H���2��A�|$H��H��u*�u4��H��$8dH3%(uH��@[]A\A]A^�f���*�����H��@���Gh��tUUH��S1�H������9]hv(��H��HE`H�xt�xt�H�x����d��9]hw�H��[]�f��ff.�@��AWAVAUI��ATI�̹USH��H�=�/H��H��dH�%(H�D$1������u[L���L�{�E��L��L��E1�H��I���0����uB�|3	t5H�T$dH3%(D����H��[]A\A]A^A_��E1���H�=>/O�l7����	L��D$�J��H��H��tFL��H���3�����H���y+��H�{L��A���:V����xH�|$�\1�����g������E1����~F��ff.���H��dH�%(H�D$1�H�L$��p��H�L$dH3%(uH����4F��@��H��0�Ph��SH�H���9u
�C!�H��躃��H��蒌��H����q��H�� tH�� �D���H���L8��H�������H�������H������H������H�{x�b��H�{p�b��H�{@t	H�{@�*)��H��t%H����V��H���H��t
H�H����PH�5t%4H��tH�x4H�8H��P H�=����H�M%4H�Z%4�5��H��[�t+��@H�{X�/�����-����f.���SH�����n����d��H���W��H������[��o����SH����H����V��H��[����f���UH��SH��H����*��H��0H��H��[]�6���fDSH���H��H���H��tqH���H���H��tH���H���Hǃ�Hǃ�H����a��H����J���H���H��t>H�H���[H�@��DH���H9�(u�H��(H����z���D[�ff.�SH���o�oOdH�%(H��$�1��oW �o_0�og@�ooP)$�ow`�op)L$�o��H���)T$ )\$0)d$@)l$P)t$`)|$p)�$����H��H���0R��H��$�dH3%(u	H�Ġ[���B��ff.�@��SH��H�����H�=`.H��1�����H��[����DAUA��ATI��UH��S��H���f��;*�����u$��H��L��D����&��H��x�t#H��[]A\A]�f�����H����[]��A\A]��)���h��������AW�I����AVAUL�-v"4ATL��USH��h�/dH�%(H��$X1�H�GL�d$pL��H�D$1��H���L���H���������Hc�H����H��NH��v"H��6H9�!4u��69�!4��H�|$���ɞ��H�=�-H��1��ȑ���w�=�!4PROXu��=�!4Yu�A�G4H���
L���Aog$�Aoo�D$@A�G )d$0�D$`A�G:)l$Pf�D$,A�G8f�D$.�T��H�����x
���H��H�5�HL��L)�I���!����H�=�4H�0H����������L�kM���$	�H�=5L��������U�H�=�4L��������'�H�=�4L���������	I������1�L��H�5� 4���y�����H�H���|I9���H�|$���V���H�=',H��1��U����u.1ۉ�H��$XdH3%(��H��h[]A\A]A^A_ÐH��H�|$����H�=l+H��1��U���D�5 4fA��E��I��I������L��L��������H�H����I9��IfoD$pfo�$�fo�$�fo�$�fo�$�)�4fo�$�)
�4fo�$�fo�$�)|4H��$Pfo�$�fo�$)k4fo�$fo�$ )%b4fo�$0)-b4fo�$@)=r4)5[4)t4)
}4)�4)�4)%�4)-�4H��4�Aow$)t$0A�G4�Ao�D$@A�G )|$P�D$`A�G:f�D$,A�G8f�D$.I���2��4�Ѓ��< ��y4f����L�hM9������^L�l$L9l$�z�L+l$��H�D$1�L�I����P�p����H�p���_I9�s[�����/H�I9��CH�D$M��I)�H�L�I�����P�p����H�p���_I9��������� u�D��f���H�H�@I��E1�H�L$����A�����	�A���@M9��`���L��H�L$L)�J�41H�����VD�V�>��D�D��I��L9���M�@��"u�I�����H��L�$�k��L�$I�Gp�f�I������qk��I�Gh�����A���I������j_��I�Gx�����D$@foD$0�foL$PA���A�G4�D$`AG$A�G �D$,AOfA�G:�D$.fA�G8����@L��H�=�+1��o���H��H�|$�"����74H��H�=�+H��1���������������f.����������D���+��4�у����Q������������ufH��#�{�
fo�4�
fo�4f�D$0��4T$4f��f�T$Pf�D$,��4\$TH�D$4f��f�D$.�
������9H�|$���-����5C4H�=�)H��1�@��@�����������H��H�=^*1��/���H������H�����4��H�D$f�L$0�D$4��4f�t$Pf��f�D$,��4�D$T��4f��f�D$.�G���A�L�sM����H�t$PL���M�������D$PD9���L�sM���KH�t$0L���M�����;�D$0D9��-L�k M����H�t$.L���^������L�k(M����H�t$,L���^^�����xH�[0H���0���H�|$迖��H�߾@��H��蜉��H��H�=�,H��1�訉���W���A�
����D������:���H��H�=�(1�襇��H���1���H�|$������N���H�=%H��1���N�������8��H�|$���&���H�=�$H��1��%�������H�|$������H�=+H��1��������H�|$����@L��H���È��H��H�=�*��H��1��̈���{���H�|$譕���@L��H��荈��H��H�=�)��H��1�薈���E���H�|$���t���H�=)H��1��s����"���H�|$�T����@L��H���4���H��H�=
+��H��1��=������H�|$�����@L��H�����H��H�=|*��H��1��������H�|$�����H�=F)H��1�������H�|$���”��H�=�'H��1�����p���H�|$��蟔���5�4H�=Y&H��1���蔇���C���H�|$���r���L��L��H�=U$H��1��k�������H�|$���I����5^4H�=�#H��1�@��@���9������H�|$������H�=%H��1���������I�����54H�="%H��1�@��@�����H�D$���H�|$��轓��H�=^$H��1�輆���k���H�|$蝓���@L��H���}���H��H�=�&��H��1�膆���5���H�|$���d����5z4H�=�#H��1����Y����������ff.�@��USH��H��dH�%(H��$�1����,��H��$�dH3%(��H�Ĩ[]�D�oH���H���oK�oS )$�o[0�oc@�okP�os`)L$�o{p�o��)T$ )\$0)d$@)l$P)t$`)|$p)�$���H��H���@!���]���H���`��M����4��fD��AWAVL�v<AUATI��UH��SH��HdH�%(H�D$81�H��H�xxH����H�57���F��H�I��H����H�D$L�l$ H�D$�@I��I�H���`H�T$L��H��� ������:���T$L��L���I0����tž�H�=�(�D0����I��H�L��PL����oEH���oMH�oU P �o]0X0�oe@`@�omPhP�ou`p`�o}pxp�o��L�����Hǀ�I��$(H���H��tH���I��$(�}I�ٹ�L�����H��'��[Y��I��H�
���H���I��$H�5y'i������H���H�D$8dH3%(u6H��H[]A\A]A^A_ÐL���X���H�=	'H��1��u��H��L���B�����2��D��ATUSH��H��H��(dH�%(H�D$1�H��tML�d$H�-�&f���D$�5�L��A��1�I��H�
0'H���D��H��(H��u�H�D$dH3%(u	H��[]A\��J2��f.���H�M�3H��H�8��F��f.�AUI��ATI��UH��SH��H��(dH�%(H�D$1��uI��H�T$H��H��H�D$������x4H�|$��H�|$�S���H�L$dH3%(u6H��([]A\A]�H�T$L��H�=�&1��"���H�|$I�$�S��1���{1��ff.���ATI��USH��H��dH�%(H�D$1�H�G�8uH��H�GH�{PH�t$�\|���ń���H�s8�>u9H�s@�>uPH�sH�>uj�H�L$dH3%(����H��[]A\ÐH�)�3L��H�=�%�����u�1���f�H�)�3L��H�=�%�����t�H�sH�>t�L��H�S���H�=�%�g������H�sPH�=�%1��~��I�$�e����`0��AWI��AVAUATI��USH��H���dH�%(H��$�1������{�H�kI��D�0H���1H�T$ H���U�������D$8%�=���=�
H��H�=;%1��W~��H��I�4$1�H�=�(�B~��I�$H�{t7E�uH��$�dH3%(��H���[]A\A]A^A_�f.�A��9t�H��H��H�=�(1���}��I�$��H��H�=��
1��}��H���c����I�4$H�=�'1��}��I�$�b���DH��H�=O$1��}��H���#����L���xN��H�������.��I�G(H�t$H�|$H�H�D$H�D$�G��������A��8���{���{��{�A�G ��H�=1�|��H�����{�TA�G$L�d$�h
��2�������H��H��H���Q���L��H��H��#H��H�D$�2[��H�{(tEH����L��H��H�D$�[��H�s(1�1�H�=�-
�[R���L��H��H�D$��Z��H�M#�L��H��H�D$��Z��I�G8L��H��H�D$�Z��H�{t5H�#�L��H��H�D$�Z��H�CL��H��H�D$�uZ��H�C H��tfH�8t`E1�E1�H�
�"�L��H��H�L$�DZ��H�C L��H��J�0H�D$�'Z��H�S A�EH�
�"I��L�4�H�<�u�A�G!uTH�{�BH�^"�L��H��H�D$��Y��H�E"A��9uH��,�L��H��H�D$�Y���{��H�"�L��H��H�D$�Y��H�D$L��H��H�D$�kY��A�W$I�w(H��H��H���SY���H���^��H�H�}�'��H�EH�8H����5��H�5��
H�=f!�"P�����H�=��q}���y���H�t!�L��H��H�D$��X���:���H�5�@H�=m��O���@���H�=��7~������H�{ ��������H�=-�~�����H�=� �~������AVI��AUI��ATI��USH��H�ndH�%(H��$�1�H���H�*A�\$P���tI�}��A��$9uA��$8xI�}��H�T$H���mP������D$(%�=�t=����H���M#���Å���1������H��$�dH3%(���#H�İ[]A\A]A^ÐA��$8�r���A�D$P�����fDH�=�H�T$�OJ��H�T$�����A���H��1���H��
���H�T$�I��H�T$H�����������XH��H�=�1�������_x��L��L��L��I��^����/����d��H��8
tPH�=��
1��.x��I�I�}���������A��$9��H��H��H�=�"1���w��I�����H�=C&�P>����I)��f���SH��H�=�H��dH�%(H��$�1��2
��H��tH��$�dH3%(u?H�Đ[Ð�C u�H�t$�H��H���H�H�L$H���D$#�u������t��CP��(��fD��AWAVI��AUI��ATI��USH���dH�%(H��$�1�H�\$@H�D$(�-���@H�����H����K���H��H��1��H�H�=�Y	��H��tT�H���Z��H�H�}�U��H�EI�E1�H��$�dH3%(�fH���[]A\A]A^A_�f�A�D$ u�H�D$(A�|$P�H�D$H�D$$A��H�D$H�T$L��H��L���W����D$$�����H�L$(�H�5c��H�L$�N����x_�|$$H�����H�\$8A�|$PL�%��x��H�D$0H������H�D$8H���}�8tx�H��L����€���tpH�D$0��H�t$H�=1��u��H�|$1�A�I�L�H�
	!H���8��E��u���������fDE1�����H�|$0����}���H�x�8.���H��H��H�D$8��S���m����&��f���AWf�AVAUI��ATUH��H�=/SH��H��H�L$dH�%(H�D$x1�H�D$h�D$H�����I��H���H���H����H��tH���j7��H���H��P0H���H������@L�t$P�=I���L��I��H��3L��H�D$P��R���L��L��H���3H�D$P��R����9��I�uH��t.H�>t(E1��L���R��I�EA�VI��H�4�H�>u�I�D$H��H��H��� 	H���I�4$��b���|$HI��H�D$X����KH������"��1�H�D$`��H��H�HUH�L$�L$f��|$)��2��L�|$hL�d$`L����f�L����q��H��uSL�����H����1��2��1��rH��H9D$�H�|$`���H�t$hH�=�1��r��H�\$H���H�=�H�D$ �Ox��H�T$ �D$LH���.���@L��H�����I���G��H�L$pL�
�I��I�L�9$
H�L$ H��u;�@�KI��H�=�H����€���uN�KI��I�H��tm�H��H�=q��€���t�H�ƹL�������u��K���H��H�=e��€�����I���KI�H��u�I�}(��H�|$L���������H�t$`H�|$X���A�ą��J1��;1��E���y���H�|$`����E t
�}P���H�|$HA��1�L��H�
�H�����4��L�d$X��8tL���B�����L�d$XH�M@H����H�A1�H�H�uH������L�l��.f�H�;�=H���E��H���L��H�����I9��|H�3L�������y�L���m��H�3H�=+H��1��p��H�\$H�|$XA�����H��3��H�\$xdH3%(D����H�Ĉ[]A\A]A^A_���H��L����€�����H�pL���)W��H�t$ �L��H�D$p��N��L��!
L�
a����A�D$��uL��H�=��1��o��H�\$1�H��/��H�|$`�U��A��L�X1�A�����H�
9H�|$HH�R��83��H�T$L��H����H�|$X�~2�����f�L�����L��H�=\H��1��to���q����L�d$XH���H�T$pL��������mH�|$X�/��H�H�D$XH��H���zp�E t���%�����zq��H���E1�����D���D�L����R��H�I�|$����I�$H�����@�E �����H�D$hH�\$0�}P�H�D$ H�D$pH�D$(H�D$HH�D$8�D$H�L$H�T$ L��H����A�ljD$H����_H�D$hH�=�H�D$�s�����D$p�x���H�5�I��H���L���H�5�L���L��I�UH��tH�5�L��1��Y��I�E H��t3H�H��t+1�L�5�f�1�L��L���sY��I�E �SH��H��H��u�E!u5I�}����9H��L��H�HH�5XHE�1��%Y��A�}h��I�U(H��tH�5=L��1��Y��I�U0H��tH�5/L��1���X��fA�}8��fA�}L��I�U`H��tH�5L��1��X��L��
��B��I�T$I�4$D���vE��H�|$(A���		��������E����H���H�\$0H������H�=��@���H��H�������H�y�3�L��L��H�D$P�K���Z����H�|$X���H���V%���S����%H�E0���2����H�����H���zq����H���3�H�8��^������I�}�m����D$H�EP���H�t$H�=C1���k��H�\$H�|$81�A�VL�=H�
&H�H�A��'/���|$��H��L��H��A�����������.H�5<L���J������I�}L�z��H�5PL��H��1���V��� ���fDI�}8��y��H�5 L��H��1���V�����fD�D$���I�} �\���������H�\$0�8
�B����K�9���H�t$pH�=R��j������H�|$X�Z��H���#��������f����H��I���
dH�%(H��$�1�L�T$L�L$H�t$L��L���H�I�@H��L��H�D$(H��H����?��H��$�dH3%(uH�Ę�������USH��H��H��H�o���,��Hǃ�H��H��[]�ff.���H��H���*��H�H���@��SH��H���*����9[����H�H��H�D�D��H���b����H���@��H���@	����AWAVAUATUSH��dH�%(H�D$1�H�@��H��H��I��L�t$��H��H��H��H�C@ID�L�(L�`M�M9�u�f.�I��M9�tM�}H�=��Gn���=L���D$�=��H��H��I���tH��H��H��ID�H���3��L��A��������t4E��u�H�T$dH3%(uH��[]A\A]A^A_��1��������"���f.�ATUS�Gx�Ã�t(�����u(��tf�~L��H�G(H����H���[]A\�f�L�F`I��H��H��M��������H�}PH����L���f��H����H�U(H9P8tZH�H�PH����H�QH�PH����H�H�
H�@H�H�U8H�@H�H�U8H��t\H�BH�E8H�P8I�$�N����f�~8������u	H�}XH��u1ۉ�[]A\��H�p8��e���M���f.�H�E0�f.�H;E8�k���H�H�U8�_���f.�H;E0�4���H�U0H�P�'���f���AVI��H�=�AUI���0ATI��US�*����H��H�H��PL��H��H�(H��L�p�dM��L��H��H�C�UM��H�C ����H�CH��[]A\A]A^�ff.�f���AWAVAUATUSH��8dH�%(H�D$(1�H�`H�D$ t.1�H�\$(dH3%(�~H��8[]A\A]A^A_�f�H��H�H�T$ H�t$�
"���������H�D$H��L�%�L�-�H�8H��t����H�}�HI��H��PI��I�H����I�NDH�$I�N,H�L$�I��H��L����€������H��L����€�����I��I�H��t4�
H��H����€���u�I�V@I�vI��H�x
�2e��I�H��u�I�H�E`I�FH��tL�0H�D$L�u`H�xH�PH�T$H����������H�$H�t$H�x��d���g����H�}H�p�sK��I�F�P������D��ATUSH�/H�}@H��tLH�_H�E(H9G8t&��f�H�CH��H�U(H9S8�T���H��H�GH��t
H�H���PH��u�H�]0H��tRL�cH�E(H9C8u#�@I�D$L��H�M(I9L$8�ڼ��I��H�{8�&��H�CH��t
H�H�{�PM��u�H�}P�X��H�}X�X��H�}(t	H�}(�&��H�EH��tH�[H��]A\H�@��[]A\��q���锼��ff.���AWI��AVAUATUSH��H���H�wI�H�T$H�$L�D$dH�%(H��$�1��Gb�����`���H�sI�(�2b���D$(���ͼ��H�$L��H������ń����Ao�AoW�Ao_ �Aog0�Aoo@�AowP)L$@�Ao`L�s`)T$P)\$`)d$p)�$�)�$�)�$�M����I�G8�D$/E1�H�D$ f.�A�V@��tH�|$ I�v������E�A�VD��tI�v,I�L�����DE�M�g`M��tqI�VH��u4�ffDL��H��L�D$��T��L��H���Ud��L�D$����I�PH�׾ H�T$���H�T$H��I��u�H��L���d�����rf�M�vM���C����Ao�AoO L�d$@�AoW0�Ao_@)D$@�AogP�AoG�Aoo`)L$`)D$P)T$p)�$�)�$�)�$�@���PE���'�|$/uHDŽ$�H�$L��H��������t6�H��$�dH3%(�D$(��H���[]A\A]A^A_�L�d$@H�|$tH�T$H�;L���	��H�{H�L$H�T$0L���]6������Cx���D$8�t
�Cx�#�t
�Cx��H�SL���u��1�Cx�
H��$��x�D$8��H�C H9Cp�oH�sh�@H�=RH��HD��
��I��I�E�@L��PL��L�hH��$�H����F��H�E�ot$xI��u ��$��E0�D$8�dH�C(H�E8H�CHH�EH�EH���sH�hH�kHL���O��HCpH��$��xL�cPM���SL��L���8^��H�����H��L��L���!>��L�e8H�$L� �1�����D$/���fDH�{(����H�3L���
(��H�C(����f��$�A�D$\���fDf�D$xA�D$H���f�f�|$x�|����r�����H�=��7��I�������T$8��H�{���҃����	�	ЈCx�!T��H�@hH�C ����@H�uL���D'��H�E8H�C8H�EH�EH���_H�hH�k8L���wN��H;Ch�����HH�Ch�s���fDf�|$x�����L�cXM���>H�] L��H���\��H�������H��H��L���<���s���@H�k0H�EL�mH�MH��tkH�HH�EH����H�MH�H�EH�EH�}�jM��H)CpH�uH��tuH�{P�T.�����ն��H�}8�C ��I�EL��P0�4���@H�K0�f.�H�k@����L���3H�3H�{P1�H�
��3�$���L�cP���f�} t�H�{XH�u ��-����u��T���H�k0����H;k8�3���H�EH�C8�&���L���3H�3H�{X1�H�
*�3���L�cX����D$(�����o���H�D$H�
�	�D$(����H��S���H�D$H�
W	�D$(����H��7�����
��f���AVAUATUSH��dH�%(H��$�1���9����H��I��H��I��M���I$��L��H��M��t]H��1��M��H��M���H�L��L���Bk��$��BhH�ꈄ$��p ��H��$�dH3%(uLH�Đ[]A\A]A^�H�0�H�=�
�����uH��
I�������H��
I�����������ff.����H�������USH��dH�%(H��$�1���9�uH��H�`H����9�NH���6#��H��H����[��H�u�H�=�	H�������u%H��$�dH3%(�H�Ĩ[]�@L�D$1��L���H�H�EHH�D$H�E0H�D$H�E@H�D$(H�EH�D$0H�H�D$HH�BH�D$PH�B(H�D$xH�B H�D$XH�EPH��$�H�BH��t�8tH�D$`H�BH�D$hH�B H�D$pH�EXH�T$H��L��H��$��Ej����$��Ek��$��Eh��$��El��$��Em��$��TN������������Gh�������鷳�����ff.���SH��H��tH�����9�[�f�ATH��1�I��UH��H�zH��SH��H)�H����Hǂ����H�L��H�uH�?��L��H�H�u0��?��L��H�CH�u8���L��H�CH�u���L��H�C H�uX�?��L��H�CxH�uP�?��L��H�Cp�Ek�������El����Em����En���H�u@�l?��H�C[]A\���AW�AVAUATUH��SH��H�7H�=c�����t~�}ht
H�E�8���H�}`H�5,�H�T$f�EmL�%)L�-L�5'���H���H��L�{�M��t L��L�������u,H��L�{��EmM��u�H��[]A\A]A^A_��L��L������t�L��L������u*�En�@H�y	H�H��1�[]A\A]A^A_�DL��H�=�	1��_W��H�L$H�1����H�����H�@H���f.���H�������H����9�j���H���O��H�@H���fD��ATI��UH��SH���z���H�uL������L��H�C(H�u���L��H�C0H�u ���L��H�C8H�u(���H�C@�Eiƃ���������[]A\�ff.���AUI��ATI��UH��H��SH��H��H�����I�4$H���=��H��H�C8I�t$�=��H��H�C@I�t$ �<��H�CHI�t$H��t�>uBI�t$(H����<��H�ChA�Eh��������A�Ej�����H��[]A\A]�@H���<��H��H�CPI�t$�<��H��H�CXI�t$ �~<��H�C`��AWAVE��AUE��ATI��H��UH��SL��H��(H�$H�L$dH�%(H�D$1�E������L�x I��H�D$M���A�G0A9G4�����ͯ��E����H�<$�jH�$H�5�H��H�P(1��@��I�W(H�5zH��1��@��H�D$H�5i
H�ߋ1��t@��H�|$H���'���H�߾
�*��H�|$�/��E���?H�SH���vI�|$`H�3���H�{��H�D$dH3%(�H��([]A\A]A^A_��H�L$A�I��1�L��L�����A�G4���@L�D$I9������A�@4I�H(L�$����1�H�tH�5tH���?��L�$A�@0A�@4M����I�W(H�5ZH��1�E1��i?����@�$��L�x H�D$M���e���H�$H���H�P(H�5H��1��'?��1�H�5H��1��?������H�S�����1�H��H�5�H����>��L�$A�@0A�@4M����I�W(�H�5�H��1�A��>������@1�1�H�5yH���>��H�|$H���@�H�߾
�(��H�|$�-������@1�H������/����1�H�5%H��1��=>������1��i���f�1�H�5�H��1��
>�����������U�,�H��SH��H��H���H��������t/H�
�,H��1�H�5a�2���H��hH��[]�p���H�������fD��AT�UH��SH��H�=nH�� H�6dH�%(H�D$1�������H�EH��t�8urH�D$H��h�f��xH��t���H�|$��H��`��$��H�|$H��`��H�T$dH3%(��H�� []A\���H�}I��H�D$�3��H�T$L��H���z����i���H�|$�$��H�5�
H����X��H�t$H�=�H��1��R�����}������H�D$�I���f�H�8H�D$����ff.�f���USH��H����H��tf��@4H�@H��u�ƃxH���_��H��hH��t%����'H��ptLH��[]�f.�H����'t�H�=��3H����N��)�='�M�H��pu�I�؉�H�
�{H�5��N��H��pH��[]�f.�USH��dH�%(H�D$1�H���3H��pH�(�I���H����I��H�
����8H��hH�5����sN��H��H�$���H��h�;8��H���#��H�����H��ptH��p�B��H��pH��h����H���H��H��h���H�D$dH3%(uH��[]��2��f�ATI�Ժ	UH��H�5ZSH���B-��I�4$H���VO��H�}t�	H���b$��H�EH��H�p�2O��H�߾
[]A\�A$�����H��3ATUSH�H��tAH�{`t:H���@�X��H�UH��I��H���c���I�T$H�{`I�4$[]A\�M���D[]A\���H���3AVAUATUSH�H��t&H�C`H��t�@uI��H����t;��u�G4��u[�]A\A]A^ÐH�w(1�H�=}�M��H�{`H���L���р�xt�H��`H���8����t����W����3I������I��H��tA�M��L��1�H��H�����E1�M��L��L��H��H�����I�UH�{`I�u�L������3������������3�0���H�k`H���s+��H���+��������H������H�H���c�����t=H�{`�f ��H�
f��H��I��H�5�1���������H�{`��.������H���
������D��ATUH��SL�g`L�������xu]��[]A\�f.�H����r�H�r�H�������tDL������H�
��rH��I��H�5E�1�����H��3H�8�U�����[]A\�fDH���`���H���3H�8�1�����ff.�@AUATUH��SH��dH�%(H�D$1��$����tB��z�������t	��o��H�D$dH3%(u|H��[]A\A]�D�@�U��H�|$I���1��I�ŋD$��t"1�@��L���I�t�H�V�:���;\$r�I�T$H�}`I�4$�"�����yu�H���1����t����7���H�u H�=\�1��L���X�����SH��H��p�\D��H��[����H�=D�3ATA��UH��StHH�!�3��H�8H��PH�=�3H��D��zH��H�����H�����H��[]A\��H�5�P3H�=RQ3��H�=���H���3�
9��H�=��������ff.����USH��H�H�H�k`H��t�EtMH��`�a��H���Y�H��p�mC��H�V�3H��H�8H��P H�S�3H�8tEH��[]�fDH����H��t�H��H�5	���H���8��H�{`��'��H������fDH�=A����L�H�=�����H��H�=��3[]�6��f.�@��AVI��AUATL�%\�3USI�<$H��tQI��I�\$1��DH��H�{��H��t0L���8����u�Hc�H��A�D,A�E�[]A\A]A^�fD[1�]A\A]A^�D��AWAVI��AUATUH��SH��H�~dH�%(H�D$1�H��t|H��I��M��H�������uZL�{�M�����tl��u?H�56aL��� ������H�5�L���	������A�1��Af�H��H�{H��u�1�H��H�=��1������fDL��L���.��I�1�H�L$dH3%(�|H��[]A\A]A^A_�D1�H�T$H�59�L����$����u�D$��x
A�1��fD1�L��H�=�1��M���A�1��1�L��H�=��1��-���p��������AWAVAUATUH��SH���H�t$ 1�H�T$XH�L$0L�D$8L�L$dH�%(H��$�1��%9���D$`����	H�|$ H����/�q���D$(H�D$@f�L�|$p)�$�)D$pH��$���P��H�|$`H�����H�D$hH�$����H��H�D$x���D$T�D$,�D$PH�D$HI���H��H����A�G�PA�W�E<	t< u@H���E< t�<	t�<#t���t��u@��teH���"f�@��"t @��#�8H���pH�X@��t>@��'u��KH�C@8�u��D��H��@8�tЄ�tD�@H�x��\u�E����H���:�����H���L�H�P�H�t�� t�	t��DH��t	�>\�EH�$H�x���UH�� u�f���tH����� ����	����=u޹
H��H�=-��A��A��E��E�����	H�=�H��������j��=�M�H�=	�
H���������u����C�L�%�
��{��L�t$@�D$,M��tL��L����������D$(�������D$(H�D$hI�WH�T$HA�W�T$PH���dH�$H�x����1�H���k������fDH���D�H�J�< t�<	t�H�$H��H���m"��� H��������H�D$@�D$(����D�HH�x���I��W@��M�?M���S���H�|$h��H��$�dH3%(��H���[]A\A]A^A_�f�H�߀�/t7I�o�/H���7���H��H��tH�pH����5��1�H��H��1����H��H��$�1ҾH��H�D$��A������~j��������E�������H���H�D$hA�WI�wH��1�H�=t��B��H�T$I�H��V?��M�?H����������D����E1�1�H�T$dH��$�H�T$tifDH��$�M��H�,�f�I�~H��������<M�6M��u�1�H��1��X4���D$d���u/E���AA�EI��H;�$�r�H�|$������fD� ��H��L�8I��M�����H�|$H�����I�F���I�FH���?���D�C�< t<	tI�wH�=q�1��z5������� t	��	���SH�C��� u@H����� t�	t�H���9���H�����H�$H��H��H�����H�����H������H���H�D$h�<���@H���H�D$h�'���H���H�D$h������	�#�� ���H��t DH���< ��<	����u�H���H��H�D$h���������D$,����H���H�D$h���L�c��[��	t�� u�I��A�$�� t�	t�L�����I��H���L�$L��L����I��H����L���]J��L��L��L)�H��I���y���&�C�< tM<	tI�$L��L�k���M�����$L���D�H��H����H��L��L��L)��'��I9�u��H��H�=�������u�H�߾ ��H�{I��H����H���#2��H������H��H��t�H����H��L��H������^���L�����L��L��H�����L����H�ËL$(1���uH�T$8H��H��H�D$X��H�D$h������<���H��H�P��@< uH���< t�<	t�<{����I��H���-���D�D$(���;���D$(H�D$hI�W�l$,H�T$HA�W�T$P�@���H�D$@�D$,�D$TH�D$0�D$(H��tH�L$hH�T$8L��H��Ѓ����D$(�T$PH�D$h������H�������L$PH�T$HH��1�H�=����=��H�D$h���H��H�=f�1���=��H�D$h������"����'�����I�D��8'������I�|$�h���H�����L���X�HD$ H�T$ �������</�����H�D$ H�D$ �/H�����H�D$@����H�|$0�d���H�T$8H�L$h1�1�H�D$0�ЋT$TH�D$h9T$,�����H�������I���9�����I�D��8"�����F���H��H�=��1���<��H�\$H�1��Y����V��H��H����������H��H�=3�1��<��H�D$h���H�؄�����H��������f�AWAVAUI��ATA��UH��SH��8H�$H�t$dH�%(H�D$(1���H�T$ M�I�����I����r�����L�t$ A�I�F�� u�I��H�D$ H���X��� t��t/�B��H�����D<��H����Hc�H�>��DH�|$t�H��H�=��1��;��H�$H�������t�L���h�H�5'w
L��H��H����������H��H�5��L����������H�D$ �8�4�����1�H�L$I��H9��@A��1�E��E�EH�|$(dH3<%(�<H��8[]A\A]A^A_�f.�L��Mi��:	��H�5Z�L��H���/�����w���H� 1�H�L$H�D$ �����I���t����L��Mi��Q�q�H�5�L��H���������'����DL��Mi��A�H�5��L��H�������������{���f�L��L��H��L)�H��H�D$I����H�5_�L��H��H���i������H��H�5D�L���O������H��H�5��L���5����tFH��H�5�L�������t0H��H�5�L���	����tH��H�5�L���������;���H�L$E��u/H��S㥛� H��H��H��H��H��Hi��H9�u~H�T$H��H���
A�H�D$ ���������fDH���
1�H�L$H�D$ �����H�t$����1�H��H�=2�1����H�$H����������1�H��H�=d���H��H�=��'����H����H��H�6H�?�-��H�����fDAWAVI��AUATI��USH��XH�_H��$�H�|$0L�D$H�D$H��$�L�L$H�D$(dH�%(H�D$H1�H�{��H�D$@I�ͽI��H�D$ I���,f.�r��
��w
I�$H���H�� H�{tNL�c�M���u�I�4$H��t��M���s<0��<1�R���H��H�� I�4$H�{u��M��M������H�D$0H�@@H��tH�T$(L��L���Є���H�D$0H�PPH��H��tQH�:tKL�l$0H�l$(1�H�HH�I@H��tH�xH��L��L��ф���I�UP�CH��H�@H��H�8uĽH�T$HdH3%(���sH��X[]A\A]A^A_�f�H�A1�I�t$������H�1��L�|$8L�fI��M��I��H�{�t$ L��L��t$L�L$(L�D$ H�6����ZY9�}H�T$@H�|$(��H�L��M9�tI���DL�|$8�e���fD��0<�����L���H�
��1��H�5��H�=B#����DH�D$H�xutL�L$ L�D$H��L��H�L$H�|$���9�| H�|$����L��H������I�$����f�H�T$@H�s�D$81�H�=N���5��H�T$(�L$8H����D1�H���&�I�4$�y���D������w����	�f�AWAVAUATUSH��HH�L$dH�%(H�D$81���w(I�։�H���Hc�H�>��f�H�|$�&��I��H�\$8dH3%(�H��H[]A\A]A^A_��1���@H�H��t�H�A1�H�vH�ʼnD$,H�H�D$@���Ԑ��I�E��H����I�NH�@1�H��A�Ĩ�����H�D$01�H�D$ ��uB�a����I�VH�t$ H�l$0I�>�*��I�I�VH�t$ H�D$0I�>�����;\$,�$���E����H�L$��H�,�H�L$�CL�<�E��u�H��H�l$H�����H�t$ I�>I�VH�D$0���I�7H�������@�A�������A������H�I������fA������H�6E���\���I�6D���f����I�H�HI9N�Y���H�H�L$E1�H�D$��H�,���A��E9�����H�L$D��H��H�4������u�E9��������D��H�|$H�����H�����I�F�I��?����t�@AWAVAUATUSH��(dH�%(H�D$1�H���AH������I��H�V�H9�����H�H��I��H��PL�;H�D$I���L�t$�fDI�� I���A���
��w�I�_I�tH�H��t�H�A1�H\$H�)H�vH�;�h�����L��H�$H�����H���
��L�$H�CH�E��t�A�B�H�D�H�$I�H�UL��H��H�w H����H�SL��H�D$H�;�|��H;,$u�I�� I��F����H�L$dH3%(H�D$uH��([]A\A]A^A_�@H�D$�����AWAVAUATUSH��8H�t$H�w dH�%(H�D$(1�H���XH������H��H�V�H9������H�EH��A��H��PL�{I��I�tIH�D$ E��H�D$I�_H�D$E��H��A�?L�4L�H��L���V�����uI�H��u:I�� I�u�H�L$(dH3%(L����H��8[]A\A]A^A_�f�H�A1�H��I�vL�1H�������H�D$H���V��L�T$H�CH�E��t�A�B�M��I�D�I��I�0I�D��H��L�D$���H�SH�t$H�D$ H�;����I�GL�D$H�@(H���t	H�T$ L�,I��M9�u��!���E1��!����[�ff.�AWAVAUATUSH��(dH�%(H�D$1�H����H�6H����H������I��H�V�H9������H�H��I��H��PH�I��H�{tBL�l$���w+H�k�H��I�<,L���uI��tH�H��uL@H�� H�{u�H�|$dH3<%(L����H��([]A\A]A^A_����E�E1���H�A1�H�wH�����L��I��H�D��L�$H��H�D$���L�$H�EH�EE���m���L�L$A�B�I�D�H�D$H�{I�L��L�$H�w H�����H�UL��H�D$H�}�

��L�$I��L9L$u���������AWAVAUI��ATI��H��UL��SH��H����,��H��tH��H��H��[]A\A]A^A_�@H�;�NJ��H�{���I�}�8H��PL��L��H��H�CH�EH����H�EH�3L�KL��H+N H�vH�yH;~ �����HH H�MH�{ ��I�11�H�9H�FL�.1�I�q1�I��A��H�GH�qH�D$���D9|$�Ӊ��E��t3H�S I9UtS�1��f.�H�wI;T5�tuH����D9�u�L�)�H�
��1��iH�5��H�=����f�H�H�E f�H��L���+��H���u���H��H��L��������f�H�8H�E D9�r����ff.���SH�H�H�{(�!��H�H��t	H�H��PH�CH��tH�H�{[H�@��[�ff.���H��� �w���H�GH�@ H��Ð��S�G H���xH���i���s ��t.H�K��H��H�|�H�� �H�1H��H��8H�r�H9�u�[�f���H��� �/���H�GH�@(H��Ð��S�G H���xH������s ��t.H�K��H��H�|�H���H�1H��H��8H�r�H9�u�[�f���H�G8����H��1����f���H�Ѻ��ff.�@��AVAUI��ATI��UH��SH�� dH�%(H�D$1�H�T$H�t$�8�����qL�t$A�I�F�� ufDI��H�D$H���X��� t�����H�����B<�H�
:���Hc�H�>��f�H�I�FH�D$�8H���<�A��@��IuH��H�D$A�~D��H��A��Bu
H�PH�T$�H����H�L$H��H����H��I�$1�H�|$dH3<%(��H�� []A\A]A^�fDI�FH�D$A�~uiH�L$뼐I�F�@H�D$�P���DI�F�H�D$�8���DI�F�H�D$� ���DH�D$�8uH�L$��V���1�H��H�=��1��l���I�E������?�������1�H��H�=��1��F���I�E������f.���H�G@����AWAVI��AUI��ATI��UH��SH��(dH�%(H�D$1�H�8tWH�=<��O.��H��L��L���D$A�U8�Ä�u H�|$H���K�������7���fD1�H�|$�,�����I�]H�{t+���
��wH�SL�H�
H��H����H�� H�{u�I�EPH����H�8��1���CH�@H��I�EPH��H�8��H�PH�xH��L��L��>����u�1�H�t$dH34%(��umH��([]A\A]A^A_��H�A1�L�H�v���b�����M��I�D�H�D$H�{I�H��L�������t�I��L;|$u��,���D����������ff.�@���G ��tuAUI��ATI��UH��S1�H���fD��A9] v?��L��H��H��H)�I�UH��H�P H�x�G����u�H��[]A\A]��H���[]A\A]ø�f.���@�w����AWM��AVI��AUI��ATI��UH��H�=�SH��(L�L$H�\$`dH�%(H�D$1��+����D$��0��SH��L��PL�L$L��L��M����ZY����H�|$�HO�H���������Ӄ��H�T$dH3%(��uH��([]A\A]A^A_����fD��H��E1�APE1����H���fD��ATUSH���O dH�%(H�D$1���tII��1�H��D��E1�E1�1�H����H)�I�T$H��1�H�p H�xUj���XZA9\$ w�H�D$dH3%(u	H��[]A\�����fD��AWAVAUATUSH��H�_L�$L�{M��tmI��I��M�����&�r��
��wH�1H��u^H�� L�{M��t9H�K�L�u�H�9H��t��<0��<1�����H�� L�{M��u�1�H��[]A\A]A^A_��H�F1�L�H�q��t���M��I�D�H�D$H�{L�$M��L��I�7��������u�I��L;|$u��U���H��L���H�L$��+��H�L$���2���M�>H�H�4$H��H��d���f���1���DAWAVAUATUSH��(H�GH�|$(L�pH�t$PH�T$H��$�I�FdH�%(H��$1�H����H��$�H��$�H��$�H�L$hH��$�H�L$XfDA�>I�v�W����uH�D$(H�L$E1�H�P H�D$PH�Hp ������A���
����k���I�FI�NH�XH����}���H�|$PH�W H�H�:I����H��$�f�H�w(H�|$()H�)BL�G H�()B H�B0H�T$hH��$�))B)B H�B01�H��$�M�I�AM�!I�s1�I��H�L�H�@H�vA9������M�,H�,I�}��E���$I�$I�MA��1�H�D$0J�48H�AH�	I�u1�H�ljD$H�EH�H�@H�uH�\$`9�����I�\$A�B�L�L$8M��H��H�\$ H�D$pL�t$xf��D$��t}�D$E1�H�L�d$@H�l$HI��L���H�D$�@H�EI��H9l$��H��I�$H��A��L�4�J�48����u�L��H�l$HM��L�d$@D9l$v	�;��H�\$xH�T$H�t$0H�{��I�T$H�t$XH��$�I�<$���H�{H�G(H���tH�L$(H��$�H�I H�H�{H�D$8H�w H��H�L$H���H�UH�t$XH��$�H�}���H�L$ H9L$p�H�\$ I�$1�H�D$8H�H��H�\$ H�D$0J�48H�AH�	I�t$H�ljD$H�EH�H�@H�T$`1�H�u9�������^~���H�D$(I�^HX(H�;u%H�|$1�H������G���H�CH�@I�� I�FH�������1�H��$dH3%(�$H��([]A\A]A^A_�@H�L$PH�Q(�<2t���
t�H�L$(Hq(�>��H��$�t�H��$�H�������DL�d$@H�l$H�6����H�D$0H�T$H�t$hH��$�H��$H�D$8H�H��$I�H��$�H�D$`H�H��$�H��$��H������c������������fD�I�vA�>����H�D$PI�^H�P H�D$(H�HX H�
H��H�������H�A1�H�)H�vH�;H�D$A����H�D$���\�����D�d$L�|$hM��L�l�H�l$ I��H�l$(f.�I�|$H�T$I�6���L��H��$�H�SH�;�7���I�D$H�@(H���tH�u H��$�H�4I��M9�u�H�D$(M��H�l$ I�^D�d$HX(H�;�L�|$E1�I�~J�T�L��I��H�w H���#�H�t$hH��$�H�SH�;���E9�w�I�� I�FH���T�������L�t$xI�� I�FH���2������DE��H�|$L�L$H�����I��L�T$L����I�EH�|$L��H�����I�E�]�L�L$L�T$H�EH�E�����t$H�|$H�����H���&�H�CH��=����t$H�|$H�����H����H�CH�����u��D����r�f���AWAVAUATUSH��dH�%(H�D$x1�H�:��I��H�=f�H��H���"��E1�D$,����H���H���i�H�uI��H�~t'� L������A�t$I��H��HuH�~u�H�E L�`I��H�;��H�CH�T$PI��E1�H�T$H;h0��z��L�@E1�I�xL��tb��oH�t$L��L�$� D�T$)D$P�oHD�L$)L$`Ld$`�p���D�L$L�$D�T$A�AI��H��L�H�xu�I�GH�@ H��H��I�A�BI��H�@L�<�I�?tI�GH;h0�W����z��f�I������I�EH���pH��H�F�L9���y��I�L���PH���H��I�EH!�H����y��I�uH���7�H�EI�D$�L9���y��I�L��L��E1�PL�} H�uH��H�D$L����I�OI��H��H�;tNDI�GH�|$H�$H�pH�P H����I�GH�$H�@ H��H��H�A�EI��H�@L�<�I�?u�H�D$H�E����H���H���:�H�uPI��H��t4H�>t.E1�D�L������A�EH�@I��H�EPH�4�H�>u�H�E L�hI��H�;��H�D$0H��E1�H�D$@H�1�oL��D�D$H�AH�$)T$0H�D$@���H�t$�L��H�D$0L�l$@�N���H�$D�D$H�AH�@ H��H��I�A�@I��H�@H��H�9u�H���������H��I�gH���BH�4@H������H��H�V�H9��}I�L���PH�EPI�OH��H��H��H����H�RH��H����w��I�7�,�L�e H�|$,�.������cw��fDH�D$xdH3%(uH�Ĉ[]A\A]A^A_��9���Uw��@��AWAVI��AUATUH��SH��(H�BL�&H�t$�XL�x0H��P�AoI���AoOH�AoW P �Ao_0X0�Aog@`@I�GPI�EPI�EH�x��E1��	fDE��A�ZI��H��H�|u�H������A�rH��H�V�H9���v��I�D�T$L��D�D$�PI�uH��H����D�D$D�T$I��I�EE���|H�XD��H��I�D8H�D$f�H�H��tRH�x0tKI��XL���PH��o�oJH�oR P �oZ0X0�ob@`@H�RPL�h0H�PPH�H�� H;\$u�1�I�<$�(I��L���PH�L$1�H�H�}u�f.�D��BI��H�@H�|�u�BH�4@H������H��H�N�H9���u��I��T$L���PE��T$H����L�xH�RL�eH�l� �XL��I��I���Aol$�Ao�I�D$�I�G�I��PI�T$��o20�ozx�oj h �or0p0�oz@x@H�RPL�h0H�PPI�G�L9�u�H��(H��L��L��[]A\A]A^A_�|��@�ӍCI�<�H��u�H�������sH��H�~�H9���t��I��T$L���P�T$�������1��	fDH��I��L9�ID�H��H�VH9�u��x����I�� L���PI�E�>���I��L���PH���;�����AVAUATUSH�oPH��tQH�}H��t<I��I��I��1��D�CH��H�@L�t�I�>H��tL�������u�I�~L�[H��]A\A]A^�1���fD��AWAVI��AUATUSH��H��HH�/H��dH�%(H�D$81�H��P�H�=���;���HI��H�L��PL��I��H�L�`A�FA�EA�FA�EA�F0A�E0I�v8�[���I�u1�I�E8I�F@I�E@H�D$ H��H�D$���A�F H�4�A�E H)�H������H��H�V�H9��"s��I�}H��PA�U I�E����I�VH�:�2s��H�z��H9�@��E1�1�@��H�R��A��H�TI�FM�eI�UH�H�p H�xI��8�I�D$ I�FM�eI�MH�H�xH�P(I�H�w H����H�|$ I�D$(I�UH�I^H���/�E9} v9D��I�VH��H)�H��H�H�:�wr��H�z�Dr��I�E�L���f�I�uI�}(1�H�l$(L��3H�
��3H�\$0����I�~(��H��H�D$�BfDH�T$(H�t$ L����I�}H�t$0I�����I�}(L��H��H�D$0�y�H�|$H��H�������u�H�|$����H�|$���L��H�L$8dH3%(uH��H[]A\A]A^A_������nq��D��AVAUATUS�G 9F ��q������I��H��H�H�vH�GH9F��q��H��I��E1��>f�A��E9n vND��H�sH�<�H)�H��H�I~H�GH9F�\q��L��H������y�[�����]A\A]A^�fD[1�]A\A]A^�ff.�f���������� AVAUATUS1�<<��H�� f�D�sJ�,7L���M���a�� ��<w�H��s�I��H������I�|���L��L��H��I������uH�-��@��u=�w@�� ��@��,���H�5��L�����CA�4H��@��t<@��/tr~�@��=��@��\uxH�5���L���L��CA�4H��@��u�[L��]A\A]A^�L���@H�� E1�H��H��������f��H��L������c���L��� ��S����H�5�L������7�����H�5��L���������[H��]A\A]A^�H����AWAVAUATUSH��H���H�vdH�%(H��$�1�H��tSI��I��H�z H�S ��L�{I�t5H�D$`H�D$H�D$PH�D$A���	�b��tm��t8I�� I�u�H��$�dH3%(��H���[]A\A]A^A_�@I�_I] H�H��t�I�>1�H�5��1����H���I�wI�] H�D$XH�H�H���x���H�A1�I�m(L�!H�sI��H���H�H�}��n���HI�>H�D$H�����H��H��H�$�p�L�D$H�$H�EH�EI�>H��L�$H������B�H�|$�H�CH�1�L�$�H�I�O�o)D$`�oI)L$p�oQ )�$��oY0)�$��oa@)�$�H�APH��$�E�������A�@�L�,$I�D�H�D$8H�D$XH�D$0H�D$LH�D$(H�=���/��H��$�I�>H�������D$LH�F�H9���m��H��PH�SH�t$H�D$PH�;��H�$H�x(tHH���Hm��H��$�I�>H������H�F�H9���l��H��PH�UH�t$0H�D$XH�}���I�$H�D$xH�<�X���I�>�8H�D$H��PI��H�$H�xH���!H�
2�I�WE1�1�H�����I�>H�T$1�H��1�赣��H��I�EH�$H��H�L$ I�EI�GI�]I�EH�D$PI�m0I�E H�D$XI�E(M�F(L��L�D$�;��H���)l��L�D$H�L$ L��H��L����I�$L��L��H�t$H�D$p�a���H�|$(�g������Dl��I��L9d$8�U���L�,$����I�_I] �:H�+H�����H�������I�>H��H������H��q���f�I�1�H�5�1���������HH���)�������ff.�@��AWAVAUATUSH������k��I��H��H�=��A�ԾA���ٸ���HI��H�L��PL�)�31�L��L�hH��H�x(H�
��3L�8D�p�.���D��H�}D�e H�4�H)�H�H���PA�T$�E1�H�EL�l��*H�UH�3H��L����H��I��8L9���H�EH�J�T H�r H��t�L�}H�F�H�}H������M�H9���j��H��PI�G A��t�H�H�UH������H�}H�p L�H�F�H9���j��H�H�T$�PH�T$H�B(�T���@H�}H��PH��H��[]A\A]A^A_�ff.����H���ѺH�t$H�t$�R���H���ff.�f�ATI������UH��SH�FH��H�?H�p H�F�L9��Qj��H��PH�C �EuTH�sH��H�����H�CH�s H�PH�8�!�H�CH�@(H���tH�H��tH�J H�S H�[]A\�f.�H�CH�}H�p H�F�L9���i��H��PH�s(H�C(H�C0H�PH�8���p���@AUI��H��ATI��UH��SH��H��H�(���H��tYH�H9u)H�SH9PuM��tA�}u1�H��[]A\A]�fDI�|$1�H��1�H��萟��I�D$8�������@I�|$�8H��PfoH��I��foKHfoS P H�C0I�mI�E0I�\$(H�����H����h��L��H��H�����I�EH�x �W���L��L���7����G���f�AWI��AVI��AUM��L���ATI��USH��H��hdH�%(H�D$X1�I�~H��$�L��$�u	M9���H�9�M��t
I�?�@f�H�l$ L�T$ )D$0L�t$()E H�L$8L�|$PM9���H�5��L��L�5�����H�I��H��t=�9t)H�{E1�L��L��1��'���H��L��H��H��������xbI��I�H��u�1�H�T$XdH3%(��H��h[]A\A]A^A_ÐH�{L��L�$��H��L��H��H�����L�$���O���������f�H�;�(L�D$H�����H�L$L�L$L�$�f��H�L$L�D$L�L$L�$H�H�A���H�;�(L�D$H�����H�L$L�L$L�$���L�D$H�L$I�GL�L$L�$I��s���職��L���H�
+�1��HH�5��H�=��
�y���f���AWAVAUATUH��SH��H��hH�$L�t$@L�l$8L�d$4M��L��L��dH�%(H�D$X1�H�G8H�G@�D$4�_���'L�d$L�T$@H�T$8I�JH�����:
u(H�AH9�u�#�H9��
f��H�� �:
t�H�K@M�z M���WH�JM�b(�I�M���'Ĩ�
wH�5��Hc�H�>��H�<$H�5��ޛ������H�<$H�5���ƛ������H�4$�H�=�]
�������H�<$H�5��菛�����A�M��tA�$H�T$M��L��H��H���@��������H�{1�H��H�5�1��)���H�C81�H�|$XdH3<%(��H��h[]A\A]A^A_�L�d$H�\$H�l$ L�l$(H�4$H�;���I��h������
�a���H�5��Hc�H�>��L��H��H�T$L�T$����L�T$H�T$M�z ���H�<$H�T$PL��轜��������H�{H�t$P�W�H�C8���8����{H�e\
H�5�H�$HE�H�;1�1��2���I����I�BH�@H���5d��L�M��� ���L�d$L�$$H�\$L��H�l$ L�l$(�7�I��L��H��I)�L��贝����uC�<,����H��H��������:H���[���H��H��u�I��H�4$L�d$L��H�\$H�l$ L�l$(����������H�{H�$1�1�H�5N��`���H�C8���1���@H�JL��H��I��H�K@ATAWL�L$�1���^_���������������H��1�I��L��H�C@H��H��jAWL�L$���ZY���|�����f.�H�$�80�WL��H���������P���L�<$L��蔸��H�{L��H�5E�H��1�茜��H�C8�l���H�<$H�T$PL���������������f�H�<$H�T$PL�������������f�H�<$L���T��������L�<$L������H�{L��H�5��H��1�����H�C8�����@H�<$L�������������H�{H�$H�5��1��Λ��H�C8�����f�H�4$H�;��I��V���H�<$L��������B����fDH�<$L��������&����K����H�y�H9���a��H��/L�T$�~���H�4$H�;H�h�>�L�T$1�H�D$PM�rI�H�AL�!I�vA�Ņ�t]E1�H��L�$D��I������A9�v5��H��I�<��z����u�H�T$P�sL���V�������A��c���L�$L��H�;H��L�$��L�$H�t$HH�D$HI�BH�PH�8�O��L�$H�t$PI�BH�PH�8�6����Y���H�<$H�t$P莯����x4H�D$PA�����ذ��H�{H�$H�5I�1��2���H�C8������H�{H�$1�1�H�5�����H�C8�����_��AWAVAUATUSH��H��XD�"D�o H�|$H�T$H�L$ L�D$(dH�%(H�L$H1�D�d$E9���D��L�wH�,�H)�H��I�D.L�xI�H��u�l@I�� I�H��t[H�������u�H�D$A��D� H�D$ L�8H�D$HhH�D$(H�(�H�T$HdH3%(��H��X[]A\A]A^A_�f�A��H��8E9��o���D;l$��D�|$H�D$�/H��A��D�8����H��H����H��H�����H��H�D$H��H�x(���H����H�L$(H���H�H�@H9�tfH�XH��H�{H��u�i�H�� H�{H��tUH�������u�H�L$ H�����H�D$@H�xH��tH��������tZ1����H�D$ H������1�1��H�|$H�L$8H�T$4H��L�D$@�D$4����t�H�D$8H��t��8u�L�t$H���H��L��������~�I�~(H�����H��������(^���7������H��(dH�%(H�D$1�H�T$H�L$�D$L�D$�l���H�T$dH3%(uH��(����f���SH��H�� dH�%(H�D$1�H�L$H�T$�D$L�D$��������H�T$H��t^�:
u8H�D$H�@H�@H9�u�]��f.�H9��{]��H�� H�T$�:
t�H�BH�t$dH34%(u1H�� [��H�L$H��H���H9Qt��Z]��fD1������ff.�@��SH��H�� dH�%(H�D$1�H�L$H�T$�D$L�D$�8�����tDH�T$H�B H��tH�D$H��t��H�@HB H�\$dH3%(uH�� [�f.�1����w������H��(dH�%(H�D$1�H�L$H�T$�D$L�D$�����t#H�D$H�@(H��t*H�T$H��t H�R�<��H�L$dH3%(u	H��(�1���������USH��H��H��(dH�%(H�D$1�H�L$H�T$�D$L�D$�$�����tH�D$H�T$H��t!�8t4H�D$dH3%(u\H��([]�DH���H9Bt���[��fDH�hHj H�UH��t����0<w"H��1�H�5�R
H��1�趐��H�E��+���L�ԷH�
=�1���H�52�H�=��
�#�����ATUSH��H�H��t$I��H���H��L��H��葠��H�H��u�[]A\�@��ATI��UH���=SH��H��dH�%(H�D$1����H��ttH��H9�tYH�=��x���H��H��D$���H�SL��H������H�|$����������Z��H�L$dH3%(��u/H��[]A\�H�$������I�D$8��H��������I�D$8�������AWAVL�5��AUATI��USH��H���odH�%(H�D$1�L�l$��fDL������I��H����A�?���C0���C0��u�L��H�=-��������L���n����L���D$荬��H��t+L������I�DŽ�tfD��u�
H�����u�L��H��蒗��L��A���ד������Y��E��x	A	��A���H�K8�S0H�5��1�H�{�X���H�C8�����H�T$dH3%(u;H��[]A\A]A^A_ø��f�1���H�{I�w���H�C8������菨��ff.�@��AUATI��UH��SH���f.�t$H���V����Å�~(H��L�������Å�y߻����H����[]A\A]�D���ts��t���t2�H�=1��9���f�H�����[]A\A]�fDA�T$0I�|$H�5��1�������;���I�D$8H����[]A\A]�f�I�|$8�e����EH��u,H�}uX�n��I�|$H�5��H��1����I�D$8�4�������H��I���>��I�|$L��H�5{�
H��1�赐��I�D$8�������I�|$H�5��H��1�萐��I�D$8����fD��ATI��UH��SH��1�H��H�� dH�%(H�D$1����D$��xQH�|$L���̔��H��H��H�D$�\���H�t$H���?���H�|$��裈��H�L$dH3%(��u)H�� []A\�H�}H��H�5&�1�������ޏ��H�E8���c�����AWI��AVI��AUI��ATI��USH��(dH�%(H�D$1�H�\$H���U������3W���(���Ń����V������H��A��H�{1�L��H�
$����H��H��������L��H��H�D$�`���H�t$L���C���H�|$����1�H�t$��������V���T$����V��H�L$dH3%(��uvH��([]A\A]A^A_�@1�H��A�zL�%nt3L�j�H�
��L�=it3H�,�L�5kt3�6����|$�訧������U��H�=)t3H�5"t3�ͮ��������AWAVAUATI��USH��XdH�%(H�D$H1�����H�(H����H��o3�H�����H�8���H�D$8H�D$0H�}H��t4H��1���H�|$0H�T$8����CH�t�H��H�>u�H�D$0H�5���1�H��H�D$���H�L$01�H�AH�	H�t$8H�L$H�L$,H�L$A�Ņ���H�L$��H�,�H�}�=����I��H����H�='�����L���D$,H�}1��5�H��譿��I�WL��H��I���;�����xoH�|$�]�������T����D9�s	��t������H�|$�*���H�L$HdH3%(��udH��X[]A\A]A^A_�f���H��A9��C���1��@I�L$8I�|$L��1�H�5�������舌��I�D$8�g���fD1�����f.�D��USH��dH�%(H�D$1��=/�3�2T��H�-n3H�=*�3H��H�}��H��X�P�o�
��3H��H�$�oKH���3H�=�3H�oS P �o[0X0�oc@H�HP`@����S��3H�$H�T$dH3%(u=H��[]��H������@���H�}H�}�3H�n�3�L�����@��SH�H�H�=J�3H�H�WH�H9�t!H;��H���
DH;t#H��H9�u�CH�=��ɘ��f�H)�H����H���3H�����H��tH��l3H��H�8H��P H�Ȃ31�H�@H�5Â3��t[�DH�=��3������3[�1������u�3�s�3�ff.���SH���s���H������H�H�H9��SR��H�H��H��[H�R��ff.������3�a������H��3ATU1�SH�L�`I�L9�tH�H���P�I9�u��[]A\����H�Ձ3AVAUATUSH�L�hI�L9�t:A��1���H����L9�t&L�3A�V�D9�v�D��[I�F)�]A\A]A^���Q���Q��f.���AWAVAUATUSH��H�W�3H�|$L�8L�`M�M9�tOI����1��f.�I����M9�t6M�7A�V�9�v�I�vP��I�F H�|$H��)�L�[]A\A]A^A_���Q���Q��f.���AWAVAUATUSH��H�ǀ3L�(L�pM�M9�tXH�L$I��H���H�<$E1��I�EH�L$H�xPI�<H�t=H<$�P(��AD�I��M9�u�H����[]A\A]A^A_����f���AUATUSH��H�;�3H�H�hH�H9�t&I��I��fDH�H��H�xPI�4<L�P0H9�u�H��[]A\A]�ff.���AUI��ATI��USH��H��3H�H�hH�H9�u�4@H��H9�t'H�H�xPI�4<L�P8��t�H��[]A\A]��H��1�[]A\A]���AWAVAUATUSH��H�g3H�L�hI�L9�t<I��I��f�H�+H��L�}L���-���L��L��H�P����H�uPL��L��U@I9�u�H��[]A\A]A^A_�ff.�f���AWAVAUATI��H��USH��H��H��8��~3H�L$L�D$dH�%(H�D$(1����H����H�D$ H�D$f.�H��1�L��賰��I��H����H��~3H�(L�pI�L9�u�w�H��L9�tgL�}L��I�?�����u�I�mH�L$L�D$H��IOPH�T$H��L)�H)�H��A�WH��tAH�D$ H9��JN��L�dH)��b�����L��H�=��1���H�T$H�1�H�T$(dH3%(u(H��8[]A\A]A^A_�fDH�D$H���H�1����0�����H�FPH��@���z}31��_���f.�DUSH���_��t1�H����[]��H��H��1�����E�����M���H����[]���UH��� SH��H��f3H�8H��PH���H�����H��H�C�q���H��H��[]���������USH��H�����&M�����t
H��[]�H�H�sH�{A�@L�̭H�
ŮH�ѭ�	���H�-2f3H�sH�}H��t
H��P H�}H�CH�H��H�@ H��[]����UH��SH��H��H��e3H�8������uc�{���H�uH��w^H��{H�u���1�H;Et:H�����������tb�� ��L���{�	������~L���C���������H����[]�@�=�{3u��H�=�1������{3H�u�v���@H�-Qb3H�EH9C}�H�s1�H�="��u��H�E�����H��H�C�f�H��������v����{������K��H�sH�=�1�����9���f.�������AW�F�I��AVH�@I��AUL�l�ATUSH��H��(L�L$�{�CM�<8M�$>I�,:��tv��uWL��H��L�D$L�T$�L���H��H����H��4�ׂ�CL�T$L�D$H��H��H��?H��H)�I�Hi�@BH)�I�OH��L9�u���ef.��C��uA�$�U9�w])�A���fD����I�$H�UH9�w
H)�I��f�H�3H�=X�1���H�t$H�1�H��([]A\A]A^A_�fDH�3H�=�1����H�t$H�H��(1�[]A\A]A^A_�fDH�3M�$H�=�1�E�L$�MH�U��H�t$H�H��(1�[]A\A]A^A_øþMH�=ë���ff.�@����tr��H�GH�4vL�L� �7fDA��u"L�LL�H�vHwH��@BPH�w@H��I9�t)�0D�@H�<2H�E��u�D�@A��uH���67I9�u��DA��uH�6H7�f�H��@BI��H�wL��P��H�=���:���f.����FH‹F��t'��u�JH�H�5�1����fD���F��t ��u+H�H�5�>1�����f.��H�5��1�����P��H�=r�讍��f.�@ATUSH�/L�gL9�sUH���(��uH�H��Dqt<��0H�M�SH�I9�v*�}H�0�D~t���TWЉSH�UH�I9�v�}:t�����[]A\ÐH�UH�L9�s��uH�H��Dqt؃�0H�M�SH�I9�v��}H�0�D~t����TWЉSH�UH�I9�v��}:u�H�UH�L9�s��uH�H��Dq�{�����0H�M�SH�I9��e����uH��Dp�S������DFЉCH�EH���=�����AWf�H�AVAUATUSH��hdH�%(H�D$X1�H��)D$H�<$)E )E0)E@H�t$H9�v%H��I�����I��H��DPu2f.�1�H�L$XdH3%(��
H��h[]A\A]A^A_��	A���H��H�$H���0���H�$H��H�$f.�H9D$vI�I�H��DPt9H�����H�$H�BH�$A��u�H;D$s�RI��DP�V���fDH�{vAL�-2�2M�}8fDH���P���I�}H��������I��M9�u�����fDL�-1�2M�}8DH������I�}H��贬����tI��M9�u�����f�H�$H�T$H9��������� �*��,�����H�HH�$H9�������x �����H�HH�$H9��}����pI�>H��Dw�h�����0H�p�L$H�4$H9��P���D�@B�DG�?�����A�LHЉL$H�HH�$H9��"����x ����H�HH�$H9������@�DG������A���H��H�$H���0����H�$H��H�$��A�H;D$sC�I�H��DPt3H���۶��H�$H�BH�$A��u�H;D$s�RI��DP�p���E1�H�{L�=��2�[���H���p���K�<�H����������I��I��u��-���DH�$H�T$H9������8,�
���H�HH�$H9�������x ��H�HH�$H9�����pI�>H��Dw������0H�p�L$H�4$H9������D�@B�DG�������A�LHЉL$H�HH�$H9�������x-�|���H�HH�$H9��k����@�DG�\����A���H��H�$H���0�z���H�$H��H�$�
@A�H9D$vK�I�H��DPt;H���C���H�$H�BH�$A��u�H;D$s�RI��DP�����E1�H�{L�=1�2�����H���Ѓ��K�<�H���t������I��I��u����DH�HH�$H9��w����PI��DP�e����A��%�H��H�$H���0胴��H�$H��H�$�DA�H9D$vC�I�H��DPt3H���K���H�$H�BH�$A��u�H;D$s�RI��DP���E1�H�{L�=A�2����H�����K�<�H��脨������I��I��u����DH�$H�L$D�l$ H9�������8-�x���H�PH�$H9��g����pI�>H��Dw�R�����0H�p�T$$H�4$H9��:���D�@B�DG�)����<�A��H�p�zH�4$�zЉ|$$��E��4�T$$H9�������x ��H��H��H�$�A���������H�T$H�$H9������8 �����H�HH�$H9�������PI��DP��������\�I��H�$L���0躲��H�$H��H�$�	@�H;D$sB�I�H��DPt2L��脲��H�$H�BH�$��u�H;D$s�RI��DP����L���2����H�5�H���������H�D$H9$���H�}�D$0�����T���H�������I�$����H�L$H�$D�l$ H9�������8 �����H�PH�$H9�������P�� ��H�PH�$H9��m����xI�6H���D~�X�����0H���T$H�$H9��@����8 �7���H��H��H�$���������H�t$H�$H9��
����: ����H�BH�$H9����JM�H��A�DH������0H�J�D$$H�BH�$H9�������8H��A�Dx������|$$H��H�$�<��z�zЉ|$$H9�uǁ�k��������T$$���fDH�t$H�$D�l$ H9��Y����8 �P���H�PH�$H9��?����HM�H��A�DI�)�����0H�H�T$$H�PH�$�@H��H9������:H��A�Dy���|$$�<��<xH�BD�G�H�$D�D$$H9�u�A��k�������|$$H9�������z �����H��H��H�$��������H�T$H�$H9��~����8 �u���H�HH�$H9��d����PI��DP�R����A���H��H�$H���0�p���H�$H��H�$�A�H9D$vC�I��DJt6��H���=���H�$H�BH�$A��u�H;D$s�RI��DP����H����}��H�=��H��苣������������fDI�6���D~�������0H�x�T$H�<$H9�����D�@B�DF�n�����H��A�TP�H�$�T$����� �����ATUH��SH��dH�%(H�D$1�I��L��趦���Ä�t*L������oE�oHM�oP U H�@0H�E0H�L$dH3%(��u	H��[]A\�覉��fD��H��LcGH�5��2HcOH�"�2�GJ�4�D�H�ʋWAPD�GAPD�OD��l1�H�=������H���ff.���H��H�|$H�|$����H���1��H���f.�f�SH���FPu&H�5˝�k��H�ߺH�5[����DH�5���tk����f�AVAUATUSH��H��PL�g@dH�%(H�D$H1�H�l$H�$H�D$H���������H�T$H��t]�:tX����M��t=H�;H�UL�������D$8H�4$fA�D$ H�;赽��H�t$I�D$(H�;製��I�D$0���H���H�C1�H�L$HdH3%(��H��P[]A\A]A^�f�H���H�CD1���@L�l$H�$H�D$M���I����C8tþ:L���֊��H��I��H��t;H��L��H���m�����t�1�H�L$I�vH���V����������1��T����1�L��H���3���������1��1����?���ff.�@UH��SH��H��H��t�>uZ�/H���}���H�}t6�?H���i���H�mH���M���H��H��H��H��[]�	���f�H��[]�f�H��H�5��
�1����ff.�@AWAVAUATUSH��H��HL�g@L�oHdH�%(H�D$81�H�D$ �G8�H�C�1�H�S H9�v	�8/���CTtA@����H�!�H�C1�H�L$8dH3%(��H��H[]A\A]A^A_��@��u�tM���M�����KTH�T$(H��L�k@L�{HH�t$�k��A����nE1�M��t
����I��CT�'H�D$(H�0H����L�t$0�1�L��H���S������@���M��t(�/L���ɩ��L�|$0L��謃��L��L��H���n���H�D$(H�pH�PH�T$(H��u�M���L��A��`x��H�;H���u���I�E8L��H��L�k@L�{H�������M��t�����CT�L��H��L�k@L�{H����������C8�M��tH�t$0H�;����I�EHH�C H9C�7���@���G����CP���9���@H�t$ �������H�l$ H������H�5
�H���i����u%M�������A�L$P�H�C1����fDH�5͘H���i����������CT�wH���H�C1����D1����f�@�����CT�����H�pH9�������x/�����fDH��H��H�C�����������H����t$���t$����M�w8M�������L��諁��A�>/I�H�J���5���t$DI9�����fDH��I9����9/u��H��H���t$��fDH�;L��L���z��A�E fA�D$ A�D$PA�UP���	�A�D$PI�u(H�;�Cr��I�D$(I�u0H�;�2r��I�D$0����H�C1�H�C�#���@H�������tH�C H9C��H�A�H�C1��!���@L�t$0�CT�8���M���/���I�w8H�;蔷��I�E8����H�HH9������x/�q�������@H�t$0H�;�[���I�E@����f�H�ݖH�C1����fDA�����I�w@H�;�"���I�E@����f��CP��d����H���H�C1��K���fDH�CH��H�C�����t
H�C H9Ct�H�C@��CP����f��������L��t$���A�����DM���h���I9��_���L��L)�L������H�D$(H�0H���Q���L�t$0���DM���1����CT�'���A������I�wHH�;����I�EH����fDL�t$0�_���聀�����AWI��I��AVM��AUM��ATA��UH��SH��hdH�%(H�D$X1�H��t	����H��1��L��H��H���H�H�����D��H��X�����D$0����	ЈD$0H�E�PH��L�|$HH�D$@D�d$8�A�����t-H�D$@I�1�H�L$XdH3%(u#H��h[]A\A]A^A_�@H�D$I�E����������L��H�
����H�5��H�=�
�b��D��AWM��AVI��AUM��ATUH�͹SH��dH�%(H��$�1�L��$�L���H�H��t	�>�H����H�BP�o�oJ�oR �oZ0�ob@H��$�)�$�)�$�)�$�)�$�)�$�A�>*uA�~�H��1��L��H��H���H�H���w}��H�EH��X�PH�߀L$TH�D$@�D$PL�d$H�D$8������H�D$@I�G�D$PA�1�H��$�dH3%(�,H��[]A\A]A^A_�fDH��H��H��H���H�H����|��H�t$`H���O�������H�D$ H9D$u{H�|$`us�ol$h�ot$x��$�)�$�)�$�f��$�����f�H�E�XH��PL��H��H��H���0u����$�f�C 1�I�_A�����f�H��I�E���������H�D$I�E�������H���I�E���������H�t$H�=n�1����I�E������|��ff.�@��H�H��H�1�H�GHH��H��H)���X���H��o�oNJ�F f�B �FP�����BP��	ȈBP���I��H�~H��UH��S1�H��H)�H��X��H��H�H�FP�H�L���s���E f�C �EP�����CP��	ЈCPH��[]�f���ATI��XUSH�H���PL��H��H��H���v��H��[]A\�ff.���ATI��UH��SH���J��I�t$8H���-���H��H�C8I�t$@����H��H�C@I�t$H����H�CH[]A\�f���ATI��UH��SH���z���I�t$(H���ݰ��H��H�C(I�t$0�̰��H�C0[]A\���ATI��XUSH�H���PL��H��H��H���&���H��[]A\�ff.���ATI��XUSH�H���PL��H��H��H���։��H��[]A\�ff.���USH���H�����H��H��H����H��H������s H����a��H�s8H�S@H���T�H�{Ht'�#H�����H�[HH����x��H��H��H��膧��H��H��[]�m�����UH���SH���)��H��H��H����H��H������u H���4a��H��H��[]�Fm��fD��UH���SH������H��H��H���;���u H����`��H��H��[]�m�����UH���SH�����H�u8H�U@H��H���V�H��H��[]��l�����H��H�5�����ff.�f���H��H�5Ɏ���f.���H�7H�wH�H�w�ff.�f���H�GH�OH9�s1��� t��	u$H��fDH�GH9�t�H���� t�	t��ff.�f���H�WH�O1�H9�s]H�5�@3D�B�tKH�BH�GH9�v/�B�t%H�B�fD�H���tH��H�GH9�u��f��ff.�@��ATI��USH��H�o�y�����~H�sH��H)����I�$�[]A\����UH��SH��H���-fDH��� ���H�CH;Cs6�8,u1H��H��H�C����H��H���f�����~�H���[]�fDH��1�[]����H�W1�H;Ws�:"t�f.�AUH��ATI��USH��H��H�W��N��H�sH���H�{H9�s:L�-�?3�A�DX��H�F��
H��A�D
Xt!H��H�CH9�u����H��[]A\A]�DH)�H���
���H�C���"t?��\u�H�PH�SH;Ss��@H��A�DGt�H������H�CH�pH�s�V���1��H��H��H�C��i��I�$��|���@��H�GH;Gs�8"t�����1��D�����ATI��USH����P��L��H���H�4vH��H���y���H�EH�EH��[]A\�D��AWI��AVI��AUATI��UH��SH��H�H���Z��I�t$H��I���7���I�T$1�H��H�����L��L���
���H�kH�uH�H������H9��7(��I�EL��PH��L��H������H�CH��H��[]A\A]A^A_�ff.���AVAUATUSH�H�L�`I�L9�tRI���������H��I���	H��I9�t7H�;H���Z����u�I�}H��I�UH��H+7H��A��H���e���I9�u�[]A\A]A^����H������ATUSH�H�H�hH�H9�t&I���
�H��H9�tH�;L���Z����u�H��[]A\�1�H��[]A\�fD��H���Z��H��tH�@H���D��AVI��AUATUSH�H�L�`I�L9�tUI��1�f.�H�;L���Y����uH��u$H��H��I9�u�1�H����[I�.]A\A]A^�@[�����]A\A]A^�1�1���@��AVA��AUI��ATI��xUH�-�>3SH�}H��PH��L�(M��t�Ao$@I�D$H�CH�{uH�C����H�{uH�C�����C��u�C����D�s H�}�����H�}�H�C`�׍��H�ChH��[]A\A]A^����SH�H�H�{h�V��H�{`�_���H��tH�#>3H��[H�8H�H�@ ��[�ff.����GpH�G(H�G0�G8�ff.�f���AWAVL�w@AUI��ATL�%&�USH��HH�_H�oH�t$H�T$ H�L$(L�D$dH�%(H�D$81�H�D$0I�H�D$H�T$I�}1�L�����A�ǃ����$������I�E(H9��yI�U0H9���H��H)�H�D$0H9�sH�L$0H��H��H)�H9�sH���HE�H�D$0I�u@H�A�}pI�uHI�EP�m$��A�UpIc�L�>��fD��
�€�
��!ʄ���H9���H��<3H�=�93D��D���H�N�@D�
H��F���H��I�MHH9�u�H)�H��I�}h�K���A�E �`I�uHI�EPH9�v`H�\<3�H�=J93D���D��Q�����
tB��
t=H�V�"�D�
L��F��/���H��A��
tA��
tH��I�UHH9�u�H9���A�Ep�<
�G<
�?A�EpI9uP���<
��H��A�EpI�uHI;uP���< t<	��I�}h� 蛔��A�EpI�uHI�EPH9��b���	t�� u&H�V�H��I�UHH9��@�
H���� t�	t�A�EpH9��]���fDI�}h1����A�E �����f�I�EPI�uHH9�����E1��_�A�EpI�MPH9���H��63L�
�73D��E���H�F�fD�:H��E�9�H��I�EHH9�u�H)�H��I�}`�T���I�uHI;uP�w���I�E`H�x��A�Ep�<:�I�E`H��I�uHH�x��A�E8��A�E8A;E�2I�EPA�EpH9������H9�����A�Ep����f.�I�}h1��y��I�}`H���I�EH�H�ƀ�
�c��
����A�Ep���
��H�pA�I�uHI�}I+u@�\��I�UHI+U@IU(IU0A������A�}pI�E0�I�EhH�HH�L$0H�H��t5H�A��L��� t��	u"fDH�D$0H��tH����� t�	t�I�}`�`��H�|$H�H�D$ H�H�D$0H�\$(H�A�EpfDH�\$8dH3%(D���H��H[]A\A]A^A_�f.�H)��$����H��I�uH���H)�����H�?�I�EXH�\$A�����H��DI�uPH��A�EpI�EHH9�������?���fD1���w���V���@1����I�EH�f����A�EpA��e���D��� <^�8H�=�41�����H��I�}`�_���@H��裼��H��H�=y�H��1��ߺ��I�EX�1���fDI�}`�_���@H���j���H��I�EH�0��� <^�=H�=�41�蕺��H��H��H�=�1�聺��I�EX������� <^��H�=O41��\���H��I�}`�_���@H����H��H�=Y�H��1��/���I�EX���H��I�EX�q���H�D$H���A�����H����H�D$H���A�����H�����H�=�31��Թ��H�����������I�}�G �*���G����H�D$H�|�
H����H�=b31�苹��H���*���H�D$H�H�D$ H��V���H�=/31��X���H�������� ��^vKH�=*31��7���H��H�=��1��&���I�EX�x����8O��H�=�
H��1�����H�\$H����H�=�21������Uj��DL��xH���I9���H�Z13L�
�23D�A�E�tvI�B���
H��E�	t;H��H��xH9�u��D)���1����H9�t��������D)ҋ��у��������L��1��1�����SH���H��tH������H��[�	J��f���USH��H�����ti��u`H���H����j��H��w!H��贚����x`H���H���j��H��v;�H�5,�H�����H��xBH���"����H��H��[]�c���1�H��[]���������f�H������������Ӑ������t@��u�H����<���@�����u�H�������@��u
H����H���H��������AWAVAUATI��USH��H���H�GH�������H��A�����H�H����1�E��t!A�W�H�E1�H��H�Tf�HH��H9�u�I��$��Wi��H���fH��1��
�L��H��L�Gu�H��H9��>H)�H���1H9�H��HF�I��$�H���|E���sH�UH��H9��D1������xH)�D�pD�hA9�vH��tA��I��J�TH9�r�I��D�xI��L�l$L��I��H�=[�1�H�$蛵��L��I����a��L��L�(I���Re��I�L��H��I�G菆��L�l$H�$��H��{
I��$�L��M�K�L7I�EI�E�i���H��~lI��$�I�OH�IMH9��*��I�$�H��H��[]A\A]A^A_�fD1�H��[]A\A]A^A_��t�L��H�$袐��H�$��@����L��芐��H������H�D$ A�A�0����H��A��H�D$ A�0������AWI��AVI����� AUATUH�-_�SH��HdH�%(H�D$81�������{��u6A��� H�����H��H�\$8dH3%(��	H��H[]A\A]A^A_Ð���I���I;���]����I���I��L�d$(�u���I���L���6}��I��H�D$(H����I���H�\$0L��I+��H9�H��HG�H�t$(�;E������H�T$0H9T$(L��HFT$(I��xI�HH�T$(�X���I���H�t$(�S��I���H�\$(H�I���I;������uALJ�I�xH������A�������f�M���M��pH�\$0H��1�L��L��轷���ƒ���������RI��pH�L$0H�A���I��xI�������A���HcT�H�>��DALJ�H�pI��xI;���uL���M�������ALJ�I��x�8=��ALJ��8;t�ALJ�
���
����
��I���H�pL���I��xI+�p����A����Q��A������e���I�$I���I���I���I��I���H�������H9��y���H�59�L��1�H���+���ALJ�Z�$������
�]H��I��xILJ�ILJ�ILJ�I��xH9��0I����E���0H�H��H��H�I���H9���H��A���I��xH9���H����x�@��	v��x�@������7H��f�ALJ�H��I��xI;�����8"�ALJ�L���a�������I��x�#���D��=���ALJ����
����H�pI��xH9��5�PH�����f�H9������\��ALJ�H��I��xH9���I��xL�c)3�H��Hc���E�8H�=T,3D��ALJ�I;�����H��I�����"�m���ALJ�H��I��xH9��nH���'���fDA������ILJ�I��x���f.��x�@��wǃ�WH�����DH�5a|L��1�觥��ALJ�H��������I���H����L�d$(H�\$0L�t$ L�l$�f.�H�|$�TI���M��H��L��L������Ņ���1��2���f�I���H�pALJ�I��xH9�s^�P��"����H�
(3H�=�'3D���D�u� �����H��D�����H��I��xH9�u�H��H��f.�I+�pL���M�����@I�������H��H��� H�������I���H� H�PL!�H9����@A����f���fDH�T$ L��1�Hc�H�5|z����ALJ������ALJ����H�pI��xI;���8����PH���	���@ALJ������I���1�1��Ѐ��H��I��������I��x�A���@I��x���H�5QxL��1��c���ALJ����I���L����u��I��H�D$(H������������&���I���H����� H� H#AH9����AA���Hc������� <^voH�=�%1����H��H�5FyL��1�财��������� ��^��H�=�%1�貫��H��H�5PzL��1��~���������I��x����H�=P%1��y���H���t�H�5�y1��D�������� �΀�^��H�=6%1��C���H��H�5IyL��1������c������ ��^��H�=%1��
���H��H�5syL��1��١���-���H�=�$1����H���/������ ��^��H�=�$1����H��H�5�xL��1�荡�����H�5Yx1��z�������H������r���H�=R$1��{���H���3���H�50vL��1��T$�>����T$ALJ��?���H�=$1��<����*���H�=$1��)����c����[��ff.�@��H��&3ATI���UH��SH�8H��PH��L���H��H�EH��XH��XH���H�C(H�L���H�CH����ƒ������U��	Ј���Os��H��H��1�[��]A\�܁��ff.����UH���SH��H�&3H�8H��PH��H�d�H���H�6�H�CPH���H�C H�EH�����H��HD�1�H���f�H��H��H�Ju�H��H��H��H)�H9�HC�H����c���H��H��H�߉�[]�C��H��H��$3H�
v"3�0�@�4����GH�W��t+<=t'@�4u�FfD<=t@�4����H�����u�t<=t�"D<=����H�����u�H��������q��fDU1�SH��H�H9�svH�
9$3L��!3D��E�t[L�KL�I9����CH��E�tHH�C�f�D�H��L��G�t/I��H�H9�u�H)�H��H��H���è��H�E�H��[]�I�A��=t�4DH���x�=uH��H�H9�r��f�H��H)�몾�L��H)��f�AWf�AVI��AUATE1�UH��SH��8L�odH�%(H�D$(1�H�D$)D$H�D$L��L���ǜ������L��M�~�y��I�FI;Fs�8=t4M�n1�E����H�L$(dH3%(��H��8[]A\A]A^A_�DH��L��I�F�Py��H�D$L��H�p�ߚ����~nL��H��H)�荧��H�}H�D$H��toH�UH�t$A�����M�n���;,�8���H��I�^L����x��I�^I;^r�L�����������M�n���1���������/�����\���@H��H����z��H�E�H��H�E�`����6W��fDH�H���dH�A1�H�vH����OAU��ATH��L�bUL�lH��SH��f�I�\$�H���CU��H��H��H�������=H���8{��I�$���t-H��3H�53�
�tWH���f��tKH�����u�H��I����T��H��H��H��覃��M9����H�5��
H��艃���d���@�"H���z��I�4$1��H��u�C�H�����t1<\t<"u�H��H��H)��?����\H���rz��H��H�����u�H)�H��H��I�������"H���Ez��M9��_���H��[]A\A]Ð�ff.�@AVAUATI��UH���@SH��H��H�� dH�%(H�D$1���x��H�EH�EH�H�L�pI�L9�tLI��fDf�L��H��A)EH�s�觊��L��H�$H�s�藊��H�UH�}L��H�D$�B���I9�u�H�D$dH3%(u
H�� []A\A]A^���T��ff.���AUATI��H��H��USH��XdH�%(H�D$H1�H��H���x��H�D$H9D$w�"H��H��H�D$��u��H�D$H;D$s�8,t�H�l$ L�mDf�H��H��)E)E�	������'H�D$H�T$H9����8 ��H�HH�L$H9�v#�x uH���
H���x� u
H�D$H9�u�L��H���9�����~MI�<$H��tlI�T$H�������D�8,�_���H��H�D$H���t��H�D$H;D$r��=���DuH�t$H�UH�{����y�������Df��X����H���H����v��� I�D$ H��I�$�c����H�L$HdH3%(u#H��X[]A\A]�u�H�D$H9D$�����D����
S��ff.�f���USH��H��H��H��(dH�%(H�D$1�H��H����v��f�H��H��C�l~����~hH�D$H�T$H9�si�8 udH�HH�L$H9�v*�x u$H���f.�H���x� u
H�D$H9�u�H�sH�������~<H�D$H9D$t������f��H�L$dH3%(u%H��([]�@u�H�t$H�SH�}�l�����y���R�����ATUH��SL�&H��L���GP��H��L��H���	��H�{H��t0���� H���.v��H�[H���P��H��H��[H��]A\��~��H�� �v��H�sH��[]A\�S�����AU1�ATUSH��H�H�AH�H�v��tB��H��L�-��
H��L�d �fD�L��H���`~��H��H��H�� �F��L9�u�H��[]A\A]Ð��ATUH��SL�&H��L���WO��H��L��H���~��H�{H��t0���� H���>u��H�[H���"O��H��H��[H��]A\��}��H�� �u��H�sH��[]A\�c�����ATI��UH��SH�2H�����H�EH�sH��tL���҅��H�E[]A\�f�H�{t�H�SH�u[L��]A\���D��ATI�� USH�H���PL��H��H��H���a��H��[]A\�ff.���ATI��UH��SH�2H���G���H�EH�sH��tL���2���H�E[]A\�f�H�{t�H�SH�u[L��]A\���D��ATI�� USH�H���PL��H��H��H��薭��H��[]A\�ff.���Uf�SH��(dH�%(H�D$1�H�BnGH�GH�H��t_H��H�*nH��H��H�D$H�$�V��H�D$�S���H��H���Dr��H�C�H��H�CH����{��H�D$dH3%(uH��([]��N��ff.����AUATUSH��XdH�%(H�D$H1�H�������>H������H���:H��I���zQ��H�����@�7���1�L��H��I��H�5�1�H���r��H��I���pL��f�1�M��D$H�S3L��H���C<CC,H�$H���D$H�D$��������L��H���^{��H��lf�L��H�EH�EE��@��H�EH�D$HdH3%(uH��X[]A\A]��wM������f���S�H������H�GHH;G���H��1�����H�SH�sH�=�nH3H��[1�鶛��fD��AUI��ATE��UH��SH��H����H��H�G�HLJ�H��)����1����H�H�3H���^u��H��t�oECH�EH�CL�k D�c(H��[]A\A]�D��SH�XH��t	H�X��r��H�CpH��t
H�H�{p�PH�{`�l.��H��[�c.����ATUSH�`�0��H��H�XI��H��tn�yO��H�EpH�]pH��t	H�H��PH�{H�Ep1�H��H�CPH)��KX���H�M��tL�epI�$L��PHDž�����[]A\�f.��U(H�}H�u���]n��H�EX�{���@��H�GpH��t�f�S�H��H�=�k�G��H�Cp[�D��S1�H��H�_8H�W@�GPH�GHH)�H��v�;HTTPt�GPH�RkH�GH�����H��[À{/u�H�|$���KH�|$H�H��DJt��{.u��K�DJt���0H���Gx�C�H�_8��0�G|��f.���AUATUH��SH��(dH�%(H�D$1��GPH�GHH�`H����L�l$L�d$1�L��L�������Ã���|����~H�}`H�t$��8��H�}`��f�t>H�}`�G��tc��Ztn��t}�EP��.��H�=�kH��1�謘��H�EH�H�T$dH3%(��ueH��([]A\A]����f�H�}`��2����H��i�EPH�EH��EP�`.��H�=�iH��1��/���H�EH��I��@��AWAVAUATUH��SH��dH�%(H��$�1�H�D$X�GPH�D$H�D$`H�D$ H�D$HH�D$H�D$PH�D$H�D$pH�GHH�D$8@H�}XL�D$H�L$ H�T$H�t$�#�������H�\$PH���%H��L�l$`L�d$H�K5��H���H���KL��L��H���}2��I�����C<1w�H�
yk��Hc�H�>��@H�5@H���.�����a���H����4��H���H�D$hI����H��$�L��L�|$xL��H���4l��H�D$hH�D$(�C�H���hi��H��$�H;�$����8,�~H��H��H��$��5i��H�t$(H���s����~�H���H����Qz��H���1�H��I���
S��H�t$hL��� }��H�l$0H�l$8I�E�=I�u�z��I�U1�H��I����R��H�t$pL����|��L��I�$H�t$x��|��I�D$H���h��H��$�H;�$����8;��H��H��H��$��hh��H��H����r������H���Mh��H��$�H;�$��W�8=�^H��H��H��$��h��L��H��诉�����wI�}H������� L��H���j��I�E�H��I�E���f.�H�5RgH���,�����I���I�FH����9���f�H�5�fH����+��������H����t
�E(��H���L��L����b��������E(���H��f�EP�����H�EH��DH�51fH���a+������H�5?fH���J+�������������OI�~H�����J�����o����a����H�Ǿ �cU��H��H������@H�l$0�&���fDH��$�H��$�H�l$0H9���H���1�H�@H������������H��H��$��p1��L��L��H��I��E1�L�l$x��h���5DH����Tw��H���1�H��I���P��H�t$xL���#z��I�L��H���5w����~iH�|$xH�5��A���*����u���H���H��u�� L��H�������g���HDž�H��H����f����H��$�H9�$�r	E�������H�yd�EP�����H�EH�@����H��$�dH3%(����H�Ĩ[]A\A]A^A_�DH���00��H���� H�}xt{��@H�l$0�d���fDH�l$0H��e�EP�����H�EH�w����H����� H�EH�P��H�+d�EPH�EH�A���f������v��������H���H���]���H�L�`L�-GcI�L9�u�B���DH��I9��0���H�;L���`(����u䀥������H����`H���f��HDž�H����3����H���uR��H��������EPH�t$XH�=Vc1����H�EH�^���H�/d�EP�����H�EH�B���H��b�EP�����H�EH�&���H��b�EP�����H�EH�
����A��ff.�f���AVAUATUSH��dH�%(H�D$1�H�`� ���H���H��A���GPH�GHH���H�(L�pI�L9���E1��Q�D�CPE���H�MH���H�qH�}1�A�H��H������H��I9�tOH�}H�57b�&����t�E�����{P��u��CPH�u1�H��H�=b膏��H�CHI9�u�DE����E����H�;H������u��H�C`�����KP1��������,�H���H�������u	E����1�H�T$dH3%(�ZH��[]A\A]A^�A��
���DH9��r���H��CPH�=VbH�UH�01�谎��H�CH�����H�s H�;��H�C`�8���H�G H��t	H9���H�;��t��H���H�`�H��H��H�$�0��H��H�C`�!�����H���H�5`�6���sP1�����������@H�?H������it���SPH�C`1����������@H��a�CPH�CH���������H��a�CPH�CH��������H�E_�GPH�GH������	?��f���H�G@H��tSATUH��SH�L�`I�L9�u�+H��L9�tH�;H���T$����u�[�]A\�fD[1�]A\�f�1��ff.�f���H�8H��tH���`��fDH�����AWI���AVA��AUI��H�=�bATI��USH��(dH�%(H�D$1��1:���H��H�H��PH��H���M��tL��H������H���M�����AoL$I�D$ H���I�T$)$I�L$H�t$H�D$uHǃ� H����H��to��tKH�ɸE��H��HD�H��A��L����F��H��H�|$dH3<%(��H��([]A\A]A^A_�@�D$2�fDH�$ 1�1�@H�D$ ��u��ѐH���f�H�D$)$H��u�Hǃ� 1�1�H�$ H���D������<��ff.����SH�H�H���YQ��H���H��tH�H���[H�@��@[�fD��H�`H��t����fD1��D��ATI��UH��SH��LJ��H�GHH��K����x[]A\�f��KP�Q������H�
�b��A�$H�SH[H�U]A\�fD��AWAVI��AUATI��H��UH��L��SH��H�L$(L�D$ dH�%(H�D$x1���E�����A���	��H�L$`I�>1�H�bH�L$H�L$XH�$H�T$H�4$H���������
H�T$XI�V8I�V0HT$`A���I��I�V@���A���Hc�H�>���Adž�	I�>H+t$X�)��I���H�EI���H�EA�Fx�E A�F|�E!L����r�����Lt2A�NP�Q����n�H�
{a��H�L$(�H�L$ I�VHH�DH�L$xdH3%(��
H�Ĉ[]A\A]A^A_�f.�M�n8A�} ��Adž�I��M�n8M;n@�*L���e������I�v8M�n@Adž�L9����>
�/Adž��>
�OH��I�v8A������Adž�L��L���o*��M�n8Idž�Idž�Adž�M;n@��A�E<
��<
��I�V@A���Adž�I9��,H��3H�5�3M��A�}��>u��A�?�>�#I��I9�u�M��M)�I�� �I�>L��H+t$X�'��I�>��k��I�>H����}�����M�F8L9��A�8 M��w�DA�} ��I��M9�u�M��M)�M9����H�2^Adž�I�FHI���H�EI���H�EA�Fx�E A�F|�E!A���H�L$(�H�L$ I�FHH���������M�~8A�? ��Adž�M�GM�~@M�F8M9��7���M�����f�M�n8A�E<
�l���A����?Adž���A��I�v8M�n@�>
��Adž�I9�������>
�����Adž��6�F�<^��H��[@��
tH�5�
@��
tH�=r�
1�����H��H�=a]1����I�FH����M�n8I�V@I9���������M��L���#��I�v8L��H��诎��M�~8I���Adž�M9~@�����M�������I�v8�����M���L���H#��I�v8L��H���I���M�n8I���Adž�M9n@����A�} �-���Adž�A�u�F�<^��H��Z@��
tH��
@��
tH�=R�
1����H��H�=�[1��ڄ��I�FH����L��L)�I;���M����o����L��L)�H�� ����H�9[Adž�I�FH�R���DH��I�v8�
���E1�I�>��}��L9�����M9~@�^M�n8���@t�H�[Adž�I�FH����L���9������Adž�1�A�~xuA�v|����H�}H��1�H�EH��H�EPH)���X���H�L���!��I���L�EH��I���L�L$8H��� ^�����/I����M��H�L� H�HL�H�L$I9���H�D$PH�D$�DI��L9d$��I�<$H�5�Y�A����u�I�T$I�t$H�\$`E1�H���X��H�D$@H�$H�D$XH�D$H�4$H���$`������L�|$@H�5�gA��L���������\�MPH���U��H�D$hH;D$p���8=���H���XU��H�D$hH;D$p�P�8;�GH��H��H�D$h�.U��H�t$H���_������H���U��H�D$hH;D$p���8=��H��H��H�D$h��T��H�t$H���zv�����zA������c���H�T$PH�t$@H�=�Y1�Adž���I�FH�7����H��H��H�D$h�T��H�t$HH���v�����A����������H�t$@H�=/Y1�Adž�荁��I�FH����@A����������Adž�L��H�=�W1��U���I�FH�t���@H����S��H�D$hH;D$ps$�8,��H��H��H�D$h��S������DA����������E�������H�yWAdž�I�FH������I���H�EI���H�EA�Fx�E A�F|�E!I���H�E(I�F`H�E8I���H�E0�EP�Ao����E@A�����	ЈEP�Idž�Idž��
���f.�Adž�A�7�F�<^�FH��U@��
tH�(�
@��
tH�=e�
1����H��H�=�V1�����I�FH���@������uKI���H�EI���H�EA�Fx�E A�F|�E!1��h����H�=�
1�������DI��@ tA�����t�H��QAdž�I�FH�&���f�H�UAdž�I�FH����DH�=��
1��"���2���DI���H�T$0H�5U�Pn������H�D$0H�X���f.�H�=4�
1���~������DH��TAdž�I�FH�z���DH�UAdž�I�FH����A�FP�������H��V���a���H�D$(H�T$8H�=�T�I���1��D~��H�L$ H����������/��H�D$(�H�D$ uH�
 TH������H�
"TH�����M������f.�D��H�GI��H�
H�G>D��H��)��HP1����H��I�PfA�H�m�2H�A�pI�@Ð��H�G8H��tSATUH��SH�L�`I�L9�u�+H��L9�tH�;H���T����u�[�]A\�fD[1�]A\�f�1��ff.�f���H�0H��tH���P��fDH���AUATI��USH��� H���F���L�+M;,$��H��1�1��'����H���R���I����M;,$sN��tIA�u�V�^v̄�ux@��
��@��
��@��1�H�5Dž
H���h��I��1���M;,$r���t
�'H���R��H��H��[]A\A]�� ��D�`H���Q��A�u�Y�����'H����Q��A�u@��
�v����H�5�QH���Z��1��.���f��H�5ڄ
H���\Z��1��
���D��AUA��ATI���UH��SH��H�=�2H�8H��PE��L��H��H��A��1�H���J6��H��H��[]A\A]�ff.����SH�H�H���IA��H��tH��2H��[H�8H�H�@ ��D[�fD��H����@��AWf�I��AVI��AUATUH�����SH��H��H�t$dH�%(H�D$81�BB B0B@H�l$ �i;������A������2����H�L$(I�?1�L�l$0H�L$H�-^TH�t$H��L���n�����vL�d$(H�T$0A���I�4M�g8M�g0I�w@���A���HcD�H�>��@I9��1�hL������I�w8L��H�����I�w@M�g8I���ALJ�L9��.A�<$
��ALJ�A�<$
�%I�t$I�?ALJ�I�w8H+t$(�}��L���b������A����U���c���������0���L$��t������8�����c��1�L���.�����.A������ALJ�I�H�I���L��� U������ALJ�M�g8M;g@�.A�<$ ��I�w@I��ALJ�M�g8I9��H��L)�H����H�t$�ʆ��A�$L�H��A�DQ�SA�|$H��A�Dy�>E�T$C�DQ�,��0������k�d�PB�D�A�����d=��H�t$I��ALJ�M�g8I9�tdA�<$ ��I�w@I��ALJ�M�g8I9�s=H���2H�=��2�A�$�L��u�D�B���H��H9�u�L��H+t$(I�?���I�?��[��I�?H�����������H������1���f�1�L���V��A���ALJ�ILJ�I�������������@H��OI�GHH�¸����DI�H�L$8dH3%(�H��H[]A\A]A^A_�f����������I�WH�f�I������A�<$
��ALJ�L9��������@I���H���m�������c�������H�T$ ALJ��CI���H�CA�Gx�A�G|�CI���H�CI���H�S H�CI�G`H�C0I���H�C(�Ao��K8A��������CH��	ЈCH�����DI��M�g8����I���H�5TN�M0��I��H����H�t$0H��I����}_������H�����H�T$0H�A��������uI�w8H+t$(���I�w@I�8�S���H�=NH��1��2u��H��I�GH����fD�����f�I�?�G tWA�����uLI�WH1�����L���$��H�T$ L��H���C��H�T$ �[���fDH�FMI�GHH�¸���������
��H�=�|
H��1��t��H��I�GH��������I�w@I�8���H�=�MH��1��kt��H��I�GH�M���I�w@I�8�b���H�=�MH��1��At��H��I�GH�#���I�w@I�8�8���H�=!MH��1��t��H��I�GH�����H�=�M1��s��I������I�GHI��������L%��f.�f�AWAVAUATU�SH��L���I�F@M�n8H�$L	�uH�����������H�����(��L�@L���C��H��I�����H��H�;���<H�����Hǃ�H�����H���Z��H�K0�SM��H���H�;H�5/S1���
��H�;L��H�C��Y��H�C8H������������A�����tqH�n�2��Mb�o��A���������H��i��H���)�i��H��H���H=?B~H��H-@BH���H���H���L���h��H��ǃǃ�H��H��[]A\A]A^A_�h���L���H�����H����X��H�K0�SM��H���H�;H�5R1����H�C����������ƒ���	Ј��������� ���@L�c8L��H�D$�$��1�H��L��1��pG��H�L$H�;I��H�����F��������H��2H�H���;���f.�H�;L���X��H�C8���-������S���DH��[]A\A]A^A_�f�H���2��Mb�o�����H�������H��*����1�H���@������DH����g������t1A�~nu*����u��L������6���f�M��tL�������Hǃ�H�4$H�������@��SH���H����>��H��[�A��ff.�@ATUSH���H��H��tO������H���t6����w.��!��H�@XH���H�H9��{��H)�H���H����[H�5�O�f>��H���H��H��t�0ua���H�=�t
�UH���H�=�O�PH���H�=�O�PHH���H�=�O�PHH���[H�=}O]H�@HA\���H��@L�`@��}��H�=4OH��A���@H�@`H���H�H9�����H)�H����,���f.�H9��������ff.�SH��@��t-H��H��t!H��tH�� H97t�Gt�*c��H��(�^�����1�[�H�TI[H�������f�H�����H��tm��x)��H�����H�H#�0H9�tZÐH�O H�W(H��t[H�Q(H�W(H��tH�O H�J H�G(H�G ��0�DH��������H����H������@H9�(u�H��(H�W(�f�H����AWI��H��AVAUATUH��SH��(L�D$H�L$H�T$���M�'H��I�GH�$I���f�M)�M��L��
L���2��H��t_L�xM��M)�L9�s�H��H��L���8B����u�A�<:u�A�| u�L�<$H�L$H�T$M)�I�DL�9H�L�H�D$M�L��H��([]A\A]A^A_��1��ff.�f�AUA��ATI��UH��SH��H��(dH�%(H�D$1��������t	���jH�5�LH���M��H������H�5�2
L����M��H���������A<4w:H��Q��Hc�H�>��fDH�5�LH��������u
��fDH��H����H�L$H��L�D$H���;�����t'E��uBH�D$dH3%(��H��([]A\A]�H��L��H��H�50L�'W����DL��H�\$�3��H��L��I��H�D$H��H�P�H)���m���H�5=H���1�����!���=���DH�5+=H���	�����!���������DH�5;AH������������������DH�5�@H������������� ����DH�5.KH���������������@H�5��H���q������������}���DH�5�JH���I�����a�����@�U���DH���2�H�8�<B��H��H���=���DH�5�;H�������������Z��L�EH�
�U1���H�5�IH�=�V
�R���f�ATUSH���H������H����H��(H��t-H;}`t�'��A�ą���H��(�t��Hǃ(H�E`H���H�H9��=��H)�H�������t���o��ǃH��������!�H���1��-H�IH�������tJ���-H��A�H�./
L��ILE�H�
�IH�5�H1��\��D��[]A\�fDH��A��B��D��[]A\�f.�uVH���1��H��HH���!����t%H�
vD�H��1�H�5hH�\���fDH�������}���H��A������	���g���DAWI��AVI���AUI��ATUH��H�=�HSH���u��� I��H�L��PL��L��H��L� H����@���2���C���2�N��L����yH�5�GL��H�C0Hǃ����H����>B��H�����
��H���H�YHH���<���Et������ǃ���H��H��[]A\A]A^A_�ff.���H�GH��t�f�USH��H�@H��H�o��*��H�K0�SH�5�GH�;I��I��1����H�CH��[]ÐSH��H�W0H�5�GH����N��H�S@H���H�5�G�N�����H���H�5�G��<�C`�f��f�»f��E����a��H�S8H��tH���H�5|G�JN��H����`���H����g��H�=bGH��1��$f��H���[H�����@��ATI��L��UH��L��S����L��H�8H����L��H�C@H�&,H��tH�;H���L��H�C8H����H��[]A\�f.���UH��H��L��SH���x���H��H�8H�p@H���v`��H���!��H�;H���SL��H�C8H�u(H��t.�>t)H�}0t"H�;�2L��H�;H���H�u0�L��H���H���`���H��H��[]�fD��ATI��H�5QFU��H��L��S���L��H�8H����K����H��H�C@f�k`H�C8����H��[]A\���AVAUATUSf�>���I��H��H���I��M���ds����M��L��L��H���U���o@H�S�PX[]A\A]A^�f���UH��SH��H���H���4?��H��H�5XD�?��H���H���H������#���~��H���H�EH���89��H��H��[]�*���f.���H���G���h�����GH���f���ATUSH��CH���������H��k�2L���H���B1��/H��CL���,�����D��0H�
�DL��1��/H�5hC�W��H�������H���H��tH���l��H��H��tH����HǃH�����H��t=H�����H�H#�0H9���H���tH���H���dR��H��1��&���H��(���H���~J��H����r=��H�H��t	H�H��P��[]A\�f.��[��]A\�@L���������1��,H�UBL��������t�H�
g>�,L��1�H�51B�YV������@H�������"���ff.�@��ATUSH��H�dH�%(H�D$1�H���H�L���H���#1��XH��AL���M������L���-����w
ǃH���Hǃ�H��tH���;j��H��tH���tH���H����P��H��Hǃ�H��tHǃH����H���H��tH���^E��H��H�$��H�������tHǃ�H�D$dH3%(u{H��[]A\�f�D��0H�
7BL��1��XH�5�@��T���
����1��UH��@L���*��������H�
�<�UL��1�H�5m@�T���������ff.���H�������-��f�w`H�����H��H�5^2�L[��ff.����H������������������	�@���H���ff.�f���H������������ H���ff.������@������f���1����D��SH��H�� dH�%(H�D$1��������t��uYH��H�L$H��L�D$���uH�D$dH3%(u'H�� [��H�4$H�T$H��H)���K�����I��L�
:H�
�J1��H�5�>H�=�K
�A���SH��H�� H��dH�%(H�D$1�H��H�L$L�D$���1���t H�D$H�|$H�p�H��H)�H8�c_��H�\$dH3%(uH�� [�������H����������H��H���ff.���AUATUSH����������H��H���v��H��H��A����7��H���H��H���*1����~VH�UH��H9�����H)�H��H�EH�� ��u
H��tE��t���H��[]A\A]�uHǃ���H���R�H��I���w/��L��H�=]q
H��1���^�����ATUSH��dH�%(H�D$1�H��uH�D$dH3%(uoH��[]A\�fDH������H��H��H�?H�R�H9�����H�I��H��PH��L��H���-��H��H���k`��H��1�H��H�$���H��������
��ff.������@��H���������d�����H���ff.�f���H���������\���oLJ���H���ff.���H���������D�����H���ff.�f���H���������<�����H���ff.�f���SH��H�?�.��H���[����UH��SH��H��H�?�(B��H�;H��H����B��H���H��[]����S����������H��H�?�@�Hǃ�H���[�ff.����S����������H��H�?�A��Hǃ�H���[�ff.����H��0HLJ8�f���H�%�2�o�0H�0�f���H��2��Mb�o����0L��0����i��L�H��0)�i��H�8H��8H=?B~H��H-@BH��0H��8�ff.���H��H���H�N H������1�H���tOH�5��2H�6H9�@�����u��Mb��������)�Ƹ����9�wH��0�HLJ8H������H�G0����H�G8����H�G@�������D������D��f�AVAUATUSH���F��@u	[]A\A]A^�L�-��2I��H��E1�H��@L���!����AH�A�$H��P~H��PL�������AH�A�D$H��`~H��`L���������H�A�D$H���tCH�:�2H���H�H9��������A��Mb)‰�A���A�T$H��t	��4uN��H���H9��u��)й�Mb�������A�T$���A�D$���A�D$[]A\A]A^ÐH���H���=L��H���H9�����)Ѝ����A��A�D$��A�T$9��G��)�A�D$�a���ff.�@��USH��H��8dH�%(H�D$(1���@�vH���.5���$��MbH��H�5
9����i��)�1���B���T$����t$��ur�H�59H���5���L$�����L$��MbH�5 9H�߉���i��)�1��iB���L$����H�D$(dH3%(�H��8[]�f�D�D$��MbH��D����щ�H�5K4��i��A)�1��B���|$�g����L$H�5e8H�߉���i��)�1���A���L$���C����Ⱥ�MbH�5L8H����i��)�1��A������H�5�7H��1��A���t$���K�������fD�H�5�7H���\4���
������H�58H����i��)�1��@A���������fD��L�G0�H�=�7�L����€���t �H�=�6L����������������USH��H�������H���2H���o�@�.�H���&�H�����@H�C H��(H�S(H��tH�Z ��01���H��(H���H��4���H���J����t6H���H��H�
7��H�5�4D��0H��1�[]�H��DH��H��[]��f���H���f�H���H�F FH��t�H�F����uM�BPtw���������oRV�B�F H�H�F�BP�R ��<�f%��f�f��E�f�F$�f���oJN�B�F �B ��f��D�f�F$����oZ^�B�F �f���USH��H�7dH�%(H�D$1�H�4$H������H�����������Hdž�dž��u
dž�(#������tH��tH���J�H�4$H���H��t	�[��H�4$��t%H���H�������H���H����������H���+��H�D$dH3%(��H��[]Ë����t�dž���Hdž����N����7���fDH���0�H�=�4�P���1��vH�%2H��H�������t+H�52H�
6`
H��1��v�&F��H�4$���DH���p���H�4$�����2��f���SH����H�|$���W���F�����H�=,4�P���1���H��1H��H�������uxH������H�t$H���Hdž�džH��t
�Z��H�t$��t%H���H���s���H���H����������H�|$���H��[�f�H�
k
��H��1�H�5�0�E���n���ff.���SH�� H�|$dH�%(H�D$1����i���H���1��H��0H���(����utH������H�|$H�T$�����x|H�t$Hdž�H���dždž�dž��j�H�D$dH3%(uYH�� [�@H�
�2�H��1�H�5�/�#D���r���fDH�t$H�=�21���O��H�|$�(#H��������ff.����ATUSH��`H���D���dH�%(H�D$X1�LJ�FHLJ�����H��tg�o�oNH���oV �o^0�of@)$)L$)T$ )\$0)d$@E��t	��t]H��H���D9��t0H���H���i<��1�H�T$XdH3%(uuH��`[]A\�fDH���,����DH��@H�=R�2�����MbH�t$H�=�,A����ы����i��A)�1��lN��H�D$�U�������ff.�f�AVAUATUSH��H��`H���D��dH�%(H�D$X1�D���LJHLJ�H��tBI��L���'�H��L���D9��uzA��tH��tH���6�fD��u'�H�L$XdH3%(uMH��`[]A\A]A^�DH���H���|���H�������DH���H����:��1�������SH��dH�%(H�D$1�H������H�$H����:���H�Hǀ�ǀ�H��tT��tPH�����H�4$��H���H��t�U����uH�D$dH3%(uH��[��H���H��������L��/H�
�41��1H�5�,H�=v9
�	�f�AWAVAUATUH��SH��(H�?dH�%(H�D$1�H���H���H�<$H�D$H���Ȼ�������������H���Z���I��I��H��tH����$��H�<$�2��L�$$A��$��A��$M����L��L���O��H�5�.I��$H�$H����L�$$A��$A��$IDŽ$��A��$���K���bI��$���H��L��L�d$��:��H�|$�!:���@A��$IDŽ$��u�L���W�L�$$A��$A��$�k���DH���@ �sH���K��H�$Hǀ��4�M����L�����H������H�{H��t�.�H�|$���H�|$�J��L�$$1�A��$��r���v1ۃ�u�����A��$�H�����uH�EH�|$t
H�|$�2����H�\$dH3%(�!H��([]A\A]A^A_�DH�9�2L�(�I�H��H�D$�,��H�{I��H��t�k�H�<$��4L�5�)���D�1�H�
�,L��L���l��=��H�$��tXH�|$�2��H�<$����������������L���1��lL��L��������u�L�����H�$��u�H��(��A���L�����L�$$A��$����L�������G����f���fD��SH��dH�%(H�D$1�H�H�$H�������H��H���L�����x(u6H�<$�o���H�L$dH3%(u)H��[�DH����H������������ff.�f���H��1�1�dH�%(H�D$1�H�H�H��H�$������:�����H�L$dH3%(uH����y���f���ATUSH��dH�%(H�D$1�H�H����H�$���,�������������H�lj�I��ǀ���H�=5*�P���1��HH��'H��H���%�����uqH���	�H�$H���H��tH���1P��H�$H���t��@tj��taL���H���������|H�D$dH3%(uyH��[]A\�M��A��H�
a*H�ߺHH�5�&1��;���o����H�;L���-��H�4$H������H����?���fDH���8���w������ff.���UH��H��L��SH��(dH�%(H�D$1��8��1�L�L$H��H�$H�L�D$�H���������H�|$�oC@�oOKP�oW S`�o_0[p�og@��H�GPH����)��H�;H���,��H�C8H�D$H�p(H��t�>u'H������H�L$dH3%(H����H��([]ÐH�x0t�H�;�q,��H�;H���H�D$H�p0�Y,��H����H�K0�SI��1�H�;H�5�%�5�H�t$H�=�(H�C1��>E��H��)#H�����H���V���b������ff.����AWAVAUATUSH��(H�|$dH�%(H�D$1�H���H�D$���H���׵��H��(H�������H��pH���A��H�RL�jH���H�D$� H��H��L�0�8��H�D$H��H���D���H�����H�߉����H�D$H��L92��L���1���H�<$L��������u%L���������H��*Hc�H�>��H���0�H�
	#��L��I��H�D$H�5�#H��L�1�M)��7���@����H�L$dH3%(�!H��([]A\A]A^A_�H�D$H�����H��H�D$H�����H��H�=�/
H��1��WC��H�|$�.#H�!S
H�����H�|$H���!��������t����H�|$��!E����H�D$1��H�#H���H��������11��H��H�
�R
H�5�"�7��1��
���DH�\$��!E���L�L$I�}L�c���H��"I���;��H�������f.�H�|$�����������@H�|$���u'H��H�� L��H�H��H)�L9�����Q���E�������H�|$��!���H�D$H���1�H���%�����4����H����D$�;��D$���f�H���H�1�����H�����H�\$���fD�s���s������H�����H��M��H��H��H�=� 1��WA��H�=��H��H��1��C��H�|$H��������{���ff.���AWAVAUA��ATUSH��H�=�$H��xdH�%(H�D$h1��\F���L���L����D$�@K��H��H�����!����H��(�8���L�s0L���o�L��H��H���1���H�5�
H�����L�s8L���A�L��H��H������H�5z$H��������� ����x�u\H���H��tPH���H��tDL�t$L������H�5?$H�����L��H���"���H�5W
H���|��@L�s@L9��tRI�wHH��tII�WPH��t@L�|$L���|��H�5�#H���8��L��H���!���H�5�
H��������@u(H���H�R0H��t1�H�5�#H���*������VH��������������T���LI�|$`�b0��1�H��(H���C�����u
L;����H�EH�D$0H�EH�D$8H��H����H�H�T$@H�@H�D$HH�
���H�D$PH�����H#�H�D$XH��H��PH��H��2u�o�P�o�`�B��H���H��2H�H���H���H���2��H���I�|$`�f ��I�D$`H�t$0�H�H���I�|$`�,��H����H���1���H��H���m���m1���H��H�
h"H�5���1��H��(�X���uA��H���Q��Ņ��BI�D$`H��t:H���H�H9������H)�H���I�\$`H������H���{������H�|$�I�����Ʈ��H�L$hdH3%(����H��x[]A\A]A^A_�@��������H�5,!H���g�����f���tLI�|$`H��(�k����������H���k��������f�H��1�H�5� H���(��H��t��@H�����H��(�����ǃE���A��$!�����@H���1���H�H��������H���{�A��$!��a�����H�5�XH���L��H���F��H��I���e�L��H��H���'���H�5�
H��������/�����H�5�H������L���L���
�L��H��H�������H�5�
H������������H�D$HH�H
H�D$@�H���fDH�
���H��1�H�5��/�����fD�H�5(H���L������H�������p����L�{0H�5e)
L���u��������H�5�L���^�������������H�5�H�������^���L�����������������������ԫ�����AUATUSH��8H�|$dH�%(H�D$(1�H�������H������������I�ԉ�H�l$ ���1�1�I��L�D$H��L���#
������H�|$H������;Bp�����������rp9�v@���@H�|$H���,#���H�D$(dH3%(�TH��8[]A\A]�1���/H��@���|������H�|$�J���H�T$I��H�D$H�8H�p@�a&��H�l$L��H�}���H�|$H�E8HLJ�H��@��H�|$I�����H�=��P���1���H��H��H���=�����H����H�l$1�L��H�5�H�U0L�E8H�}�;����/H�\$H�E��ǃH���d�������H�=(1��8��H�|$�,#H���h�����H����M��M��H�D$H�
�H�5�H��P1��
,��XZ�I���fDH�t$ H�=�1��7��H�|$�,#H������D���fDH�t$ H�=�1��}7��H�|$�(#H����������fDH�k0H�5�H���M���������H�5B&
H���6�������H�;H�5(&
���H�C0H�D$H���z��H�\$HǃHǃ ����U�D������t����t1���u����P1�;��r
�f�USH��H��������H�=��P���1��;H��H��H������u/H����H����tH�߈D$�#���D$H��[]�D���H�
�H��1��;H�5$�L*���f.���H��(H���H�|$H��t�xmtH�|$�7��H��(�f�H�T$�t$�2��t$H�T$��t�H��(���H��H���ff.�f���H��dH�%(H�D$1�H�����H�$��H���H���H�D$dH3%(uH�����f.�@��USH��H��pH���H�h�����H��H����.�����1�H��`��H�"H������uNH���n��H��1�H�H�@H�����9���H���H�{`H��t;H���[]���H�
q%��H��1�H�5�!�(���f�H��[]�f�USH��H��L��pH��xI�x8H�H�WH�H9�t$H;��H���
�H9tCH��H9�u�H��t+H�}hH�H�WH�H9�tH9tUH���H9t+H��H9�u�H��[]�H)�H����I�P@H��� ���H)�H����H�UpH��[]H��� ��1���1���ff.��SH��H����0-��L��p�� �I�xHH�H�WH�H9�tH;t1H���
DH9tH��H9�u�[�H)�H����I�PP[H��� ��1���DUSH��H��H��xdH�%(H�D$1�H�<$H������?��L�$I�xXH�H�WH�H9�t)H;�|H���f�H9��H��H9�u�L�pZH�
@.1���H�5�H�=s
���fDH)�H����I�PpH���Z��H��`1�Hǃx��H�wH���������H�5`H�
�H��1����M&���� @����H������H�D$dH3%(��H��[]�f�H)�H����I�P`H�����L�$I�xhH�H�WH�H9��E���H9t_H���DH9����H��H9�u�����f�H������� @���[���@��H�<$���G���F���1��t���1�������ff.�@�� ��AT1��H�@USL��`H���� �H��pL�������)L���q���� H����ྃ�@�� �R4��H���H��tH�5?(�
��Hǃ�H���tH����Y8��H����?��H������H����*��H����
*��H����*��H����)��H�}(H�H�WH�H9�t$H;��H���
@H9��H��H9�u�H�}8H�H�WH�H9�t!H9��H���
DH9tSH��H9�u�H�����H��[]A\�6���fDH�
�L��1�H�5���#�����fD��H)�H����H�U@H���j����H)�H����H�U0H���J���G���1���1���ff.�f�AWAVI��AUATUSH��H��H�|$�� �
H��pH��xH�}H����L�` I��H����ܡ��A�D$P���H�E(1�H�@H�u01�I��H�EHH�@H�uPI������E���w���A�UA9���������ڡ��E���������D9���D9���A�T$Pf�f���H*‰�D)��H*��^�f(�f��H*��Y��H,�A�ă�1��A�2�fDH�GHL�` ����H��`1���H�(H������uH���w��H��[]A\A]A^A_��M��H��H�
=1���H�5���!��H��[]A\A]A^A_ÐE�d$PH�{HI�ٹ�D��L��H���'��H���A�����H�D$1���H��H��`H��������tRE��M��H�
]H�ߺ�H�5S1��O!��H�D$H�t$�� H�UPH�}H���H��[]A\A]A^A_�f�H���x����fDH�\$H��`1���H��H���[����t�M��H�
nH��1���H�5��� ���s���f�E1�H�{HI�ٹ�D��L��H���{&��H������ff.�@��AUI��ATUSH��H��dH�%(H�D$1�H��pH�HH��xH����L�` I��H�qH���H������Ņ���I�D$�����H��`1���H��H���]����u1H��1��?��H�L$dH3%(����H��[]A\A]�fDL�$H�
�Z
H��1���H�5�1�����H�AHL�` �J���H��`1���H�hH��������t'H�
�S
��H��1�H�5D�B���^���DH������L���H�$�����I�E�7����A�����AUATUH��SH��H��(dH�%(H�D$1�H��pH�@�PL�`H����f�x
D�h,H�x�=�89��D��H�=K�H��1��d*��I��H���Hǃ��u�����H�U��'#v|L��H�=01��#*���� H��xH��I�����L��H������H�D$dH3%(��H��([]A\A]Ã���H�pH�=�1���)��I���\���DH�=&
1��)��H���n���f�H��H������L�D$L��H��H��`H�L$H���I��$�J7��I�t$H���}��H�}�ļ��H�}�K���G���fD�7��D��H�=H��1��')��I����������H�=����f�ATU��SH��pH��H�@L�`HH���2�o��������x=��u	[]A\�@I�|$I�ى�qL��7H�����H���[]A\�f����H��`1��e�H��H�������tRH�
P
�eH��1�H�5����H�{HI��L�w1��hH�f�D"��H���[]A\��H������fDAUATUH��SH��H��dH�%(H�D$1�H����1�����H��H��L�gI�L9���H�H�$��@�����I��H;����Hǀ�H���;����tH���(#L���û��H��I9�t*H�H�$��@�B���H;��t��\����H��1���H���H��t,H�$H���H;���"���Hǀ������u"H�D$dH3%(u(H��[]A\A]��H��H��(#����������̚�����H��1�H�@H�����!u
H���t�P���ff.�f����� ����ff.�@���� ��t��!u
H���t�@H��1�H��t�H�B1�H����������USH��H��H��xH��t�� �u�u H��[]�� ����H��[]�@�����u�H���H�E �������4uH��H��H�5�[]�?����H���������f.���U�5H�|SH��1�H��H��`H�|$H����������H�
��5H��1�H�5>�<��H�|$H��pH9C8�_����a�H�|$H��xH9�uH��uH��H�L$H�t$H��xH�C �����������!���	Ј�!H�S`H�{X�#��H��[]�@H������o���ff.���H���tÐSH��H��H���ݘ��H�qH��1�H��H�������H9��	���H�H������t>H���H��t[����fDH�{HI��L�2
�aH���
��H���[����H���H��t�{������H����P��SH��H����@��H�����H��1�H��H�@H����t
[�G����[�j�f.���H�5�+2H�=~ �ɽ��f���AWI��AVAUATUSH��(L�oH�o8dH�%(H�D$1�H���
L�w A�}M�eHH�D$w(A�EH�
}Hc�H�>��H��H�D$@A����D$��uA����D$H�?�2�(H�8H��PǀhH��H��pL��xH�D$A�����������!���	Ј�!A�}t5H��2��H�����H�8���HǃH��H�\$I�|$H�54���=0��L��H��H�EH�@HH�PH�D$H������I��$H�t$H����L�t$I���I��`A�E���a���0I�UI��$L���D��I�t$H�|$����t$H�|$�W���H�\$H�U@H�}8H�����H�U0H�}(H������I�WpI�hH������I�W`I�XH�����H�����H�D$1��
H�4H��`H��������PH�D$H�
$�H�5
H��H���H��HE�H�E(1�H��H�@H�u0QL�D$�
H�
SA��1�����XZH�L$dH3%(H�D$�GH��([]A\A]A^A_��E�E,I�M1�L��I��$���������I��pA�U,I�uM��H�
F���H�@H�XHI��xH�x H���2�oA������I���H����I����0���L$���m���H�{�t$M��L�mH�����I����>���DH���(�����H�CH�D$����H�%H�D$����H�H�D$����H��
H�D$�w������f���H����h����������hH���ff.����USH��H�dH�%(H�D$1�H��pH�$��h���Ȕ��H���h�P����h��tH�L$dH3%(�H��[]�H��`1��[H��H���������H�
�H
�[H��1�H�5��~��H����H���.���H����ޓ��H��������H����"���H����<���H����V���H����p���H��tH�����H������H���P���H������H�M�2H��H�8H��P H���Y��1����f�H������5�������ff.�USH��(H�|$H�4$dH�%(H�D$1���!�ē��H��������H����X���H��pH��H�h���H�<$H�D$H����)���H����"�H�<$LJH�C0H��tI���H����'��H�T$H�5QH�C0H��H���H�$���H�|$��H�|$��H�<$H�D$H�ހ�!���H�T$�� ����!�����H�{0H�<$�NLJH�C0H�C0H���H�|$H�D$肯��H�|$H���tH�Xt�g���H�|$H���thH�|$���1�H�L$dH3%(�?H��([]ÐH�<$���H;���ݑ��HLJ�H���T���H�|$��1��fDH�Xt�H�P��H�|$�d��f�H�{0t3H���H�5�趴��H�D$H���襮��H�|$�k���H�T$H�$H9���K���Hǀ�H������H�|$����������H�$H���H9L$����Hǀ�H�����H�|$��������H�T$H�<$���D�}� ����A�������@��H��H�|$�� t*��!�=���H�5�	�!�H�|$�7�H���f�H�|$�6�H��Ð��SH��H�?�� � ���f�H�FH�GXH�FH�G`H�F�G<��G@�F�� H�GX��H�G`��@H�G<������ �)��H��[��D��AT1��xH��UH��SH�L��`L���5����tAH�
��xL��1�H�5��
��H���<�H���T�[H��]A\�H��L��������fDAWAVI��AUATI��USH��H��@�t$�{#��H��H��1�H��H�OH��H������H9�����L�?H�5@H���f���H��I�?�{�H�=d�2H��������MbH�57H�����i��)�1��3��H���;���L��H�=��
H��1��g��H��`1��H��I��H��������H������H����H����H��`1���H�IH��������<H�
���H��1�H�5!���H��1��!�H��H��L�wI�L9�u�cf�H��I9�tJL�mI;���Ǝ��IDž�H���C�����t�A��wŋt$L��L��H�����I9�u�H��1����H��L��[]A\A]A^A_���f�M��H�
�	H��1��H�5R�P�������H�5rH�����H�CxH���,���H���2H�5[H��H�)�1��z���
���DH���X���������H��H�GXH�o�0#H�|$H�|$�@n�R���H���ff.�f�AW1���H��AVI��AUATUSH��L�'I��$`M��$xH����������H�
���H��1�H�5S�Q
��I��$1��R�I��$H��L�oI�L9�u�[f�H��I9�tAH�+L;������HDž�H���t�����tЃ�w�H��H�����I9�u�I��$1����M��t
I�G ��4u-H��L��[]A\A]A^A_�?���H�����:���H��������f.�AVAUATUSH��pL��pH��xH�|$M�l$dH�%(H�D$h1�H��H���0H�M H�YL��`1���H�L���{������H�
���L��1�H�5�����H�|$�� ��ы����H���G`H���2H�H�G@�2��H�|$�� ��H������I�|$`H��tH�t$H�V`H��X��A�}H�l$�}H�}X1�H�sx���1�H���H�D$H�x`����H�T$H�5��2H�z`�R��H�D$hdH3%(��H��p[]A\A]A^ÐL���h�������I�]HH�� ����H��x1����H��tUH�|$f�H�T$H��H�
�X
)D$�� )D$ )D$0)D$@)D$P�D$�H�L$���\���fDH�D$1���H�rH��`H��������uH��躽��H�|$��������H�
���H��1�H�5-�+�����T��@��S1���H�
H��H��`H�|$H���e����tAH�
���H��1�H�5�
����H�D$�� ���H�|$�X��H��[�f�H��������fD��AUATUSH��H��dH�%(H��$�1�H��pH�<$L�`H��xH���
H�h H��@��u]H�s H�=�?
1����H�<$H�ŀ� H��x���H��H����H��$�dH3%(�kH�Ĩ[]A\A]ÐH�Y�2L��`1��H��
�oL�����1����t}H�
��L��1�H�5��
����{@����H���H���H���H����A�D$H�$����v2H������?���DI�D$HH�h ��f�L��蘻���fDH��pH��xH�hH���uH�R H��L�`XM���i���H�B�o)L$�oP)T$ �oX )\$0�o`0)d$@�oh@)l$P�opP)t$`�ox`)|$p�oHp)�$�H���H��$�H�B���uƄ$�L��`1���H�n�
L���������H�
�8
��L��1�H�5F�
�D��H���l��H�uH�KXL��H�T$H��L���H�D$L�C`P�	��ZY����H������H���H��H�5o��j���H����~��H������������`���H�{`H�5/�2H���������f.�H�MHH�Q ����{<�������
��������{@�0������鲆��L��踹������H�s H�T$H�=�=
1����H��H�$1��.H�$�
H��`H�������tTI��H�
hH��1��.H�5��
����H�<$�� H��x�M��H��H���b�H���j�����DH�����������H�s H�=~=
H��1��\��H���[���迿��ff.�@��USH��H��pH�|$H�@�P����f�x
�X,H�x�������H�=�wH��1���
��H��H�D$H�=��2H����4����MbH��H�=������i��)�1��
��1���H��
H��H�D$H��`H���:�����ufH������H�|$�� H��x���H��H���+�H�|$�1��H��[]�f.���ucH�pH�=�
1��)
��H���5����I��H�
^fH��1���H�5B�
�@���}��������H�=�
H��1�����H�������H�=��
�g������SH��H�|$H����f��H�\$輥��1����H�߉�*���H�|$�`��H��[�f.�AW��I��H���
AVAUI��1�ATUSH��H�/dH�%(H�D$1�H��`H���ܾ������M��H�
E�
H��1���H�5F�
�D��H��1��F�H��H��L�gI�L9���H�H�$��@�����I��H;�������Hǀ�H���e�����tL��/#L����H��I9�t8H�H�$��@�d���H;��t��Q���fDH������O���H��1����L�����H�D$dH3%(uH��[]A\A]A^A_�膼��fD��ATL�%F�
UH��SH�H��tH�=,'
1���
��I��H���H��t1�4��H��tH��L��H�=�5
1��
��I��H����\�����uPH�{X1�H��tH�?t/��H��-#���� ���	�L�∃ []A\�<�@��H������[L��H��]A\����f���USH��H�_`H�|$�C�� tE��ht@H������H��H�����H��H�=<�	H��1��	��H�|$H����H��[]�DH�|$H�5�7
��H��[]����SH��H��xH�|$H����H�X H����!���� ��f�� ���\�9CX��H�D$H��H����H�
�2H�	H9���H��H�xX蛝��H���H�D$H�xXu|�G�����,���H��H�D$H�xX�K��H��H�=��	H��1�����H�|$H����������1�H��[��H��pH�@H�XHH�� ��������H��tH�D$�H�xX胨��H���[�H�č�G �����b���f���ATUSH���H���-���H��H9���Ȁ��H��������H�{P�׀��L��`1��H�G�
L��貺������L��蒲���{<��U���H�CXH���H�H9�����H)�H���H���H���H;�������Hǀ��Y�����uu�� Hǃ�yqH���	�����E[]A\�H�=�2H��p���H�
��
�L��A��H�5��
1��}����F����H��x[]A\���H������~���H�{HI��L�"1��8H�1�
���H����b�����ATUSH��dH�%(H�D$1�H9������H��H��H9��t H�D$dH3%(��H��[]A\�L��`1��IH���
L��������uWL�����H���H�<$H��t��J�H�����H���H�<$H��t�H�5���薟��H������q���f�H�
�
�IL��1�H�55�
�3�����\���ff.����AVAUATUSH��H�� L��xdH�%(H�D$1�H��pH�D$L�`�-�������H��1�A�H�@H�����sD��L���H���H�D$H���:����~��H������H�D$���A��$�t��H��H��H�t$��H�|$H����1~��H����0��H��`1���H��
H��胷�����3H�|$�q���H�
[�
��H��I��H�5��
1����H��H�\$�t��H�|$D�������uH�{`H��t
��~���H�|$�d��<�l���dH�D$��t�� �����H�L$dH3%(���1H�� []A\A]A^�f.�E1�H���A���y���@��u�H��`1���H��
H���w�������H�
>�
��H��1�H�5��
����p���DH���0������A��$��L���E����|����tdH�����|��H�{HI��L�����H�|�
����@�H������@1����f�H��設������H��u��|��@���������Q������AVAUATUSH��H�� H�o`dH�%(H�D$1�����H����������!��|��H���H��t��������H��1�H�\$H�AH��I�ą������!��H��@�A�L�,�A����A����A��y�A��tBH��H�\$����L��D���ʭ��H�|$���������:<�2H�|$��!tpH�t$dH34%(���H�� []A\A]A^�D��t�H��������f.�E1�H���A���C���@H����t��.{��@�ۭ����~�H�D$H��x����q����H��`1��8H�X�
H�����tOH�
��
�8H��1�H�54�
�2���A��t<H�D$�����H�x`�i��H�D$��!�����H���X�����fDH�|$�����職������������������ff.�f���AWAVAUATUSH��dH�%(H��$�1�H��xH���H�|$0H�D$8H�D$(H��pH�@H�D$ �?{��H��y2H��H�H�GxH���H��t������fH�\$0�� ��H����D$tH���:���D$H�\$0H�����H�L$01�H��H�FH��H�ʼnÅ��H���H�D$8�oz����!��H�D$PH�D$H�D$HH�D$H���H�T$��H�L$����o
H�l$8H�D$0H����
H��x2�o�pH����f���H�L$8H���H���H�����y��H�|$0H�GXH�H9���y��H)�H���H����~���L�l$8�D$TA�����d��c��A�����D$��A����I���H�-����������M���H��H�PI�H����L��E1�I��H��H�|$xH����H��H�$趸��H�$H��I��tiM��H��)
�H��H�5>jHE����1�H��1�H�=��
����I���L��H�����H��L��H��H�5��
1��\�L�}I���A�D$H��I��H���\���L��H���H���8���H��H�D$01���H���
H��`H���������sH�|$8H��@H��`���H�|$8A��H��`H��p�x���H�|$8L�d$XA�����AV��H��AUI��1�H�
�
UH�5#�
ATD�D$t��H�� H�T$8H�D$0���H��H��1���H�D$8��H�D$@H���H9L$0��v��Hǀ�H�|$@�3�����������v��H�|$0��$�H�D$8��!����	Ј�!�D$��!uaH��1�H�AH��H�Ņ��BH�H�8H�|$8���H�L$0���!������������H�D$8���t���H�|$0�N�H��$�dH3%(��H�ĸ[]A\A]A^A_�DH�D$0H�xX���Ņ�	�����H�D$0H�������t�H�D$0����H�xX�W�����u��H�-������H�xX�y��H�s H��H�=31
H��1�����H�|$0H��H�D$H�� H��x���H��H�����H�D$01���H��
H��`H���t������L�D$H��H��1�H�
�SH�5��
���H�|$0�p�������H�H�8H�|$8�(��H�L$0���!���������H�D$8�������|���@H����H�\$0�J���fD��d�x���H�T$0A����H�L$ 1�����$�������dA��H��`H��
H���|������TH�
-�
�dH��1�H�5��
���H�D$8H�T$0����H�z`H�������艟�����@H�|$0��$���!����	Ј�!�������|$t�D$T-���c�H�D$8����������H�T$H��������7���H�|$0����D$�f���fDH���p������H�D$8�ھ��H�L$0��!���1��J����������H��`1���H���
H���&�������H�
@�
��H��1�H�5��
��H�D$0��!�����T$T����HH����yl���������c����0�����H�|$`���H�t$H����������H�|$8H�T$`�t$T�`�H�|$0���fDA���:���H�D$01��H���
H��`H���@�������H�
A�
�H��1�H�5��
��H�D$0H�x`����H�D$0��!L�l$8�D$����f����-����T$T������������!�H�L$ H�ǀ���u���������H�D$8H�|$0���fD�������f�H�D$01��tH���
H��`H���^�����toD�D$T�tH��1�H�
,�
H�5��
���H�L$0�'���fD�)H���K�����fDH��`1��[H���
H��������H���Ӡ��H�L$0����f������H�|$p������H�t$H�������������H�|$8�Y������������@H�D$0����H�xX�W�~����H���P�������H����,������������������o���H�������"���H���������H�
��
�[H��1�H�5��
��H�L$0���@�S���H��H�D$0��fD����
���H���|���H�|$0��!�������H�D$8���fDH����l�������������H����� H�T$0H�zXH�O�������D$������H�D$ H�\$(���H�������H�������������H���%�������|$T�H��`��1��@H�z�
H��������u���L�L$XD�D$TH��1�H�
�
�@H�5H�
�F��g���H��`1��hH�)�
H��蔦�����$���H�
e�
�hH��1�H�5�
��� ���H���R����B����WH��x��������H��H�=(�	H��1���H�|$0H���E�����1��;H���
H���
����������L�D$X�;H��1�H�
�
H�5r�
�p����H�|$8H���
�/#�u����v����+���H��H�D$0H�xX�_���H�t$HH�|$0�{��(����Q������H��H�|$��!u
�E�H���H�|$�F��H��Ð��USH��H��dH�%(H�D$1���XH�<$��������H����!H���H�=l2趶����MbH�s H�=��
�����i��)�1��0�H��H�$1���H�X�
H��`H��輤�����I��H�
BKH��1���H�5&�
�$�H�<$�� H��x�}���H��H�����H��蚨��H�D$dH3%(��H��[]���� uH�wXH��tH��螇��H��H���C��뷐H��H��t�H�@1�H����t��l��fDH���H�=�j2蕵����MbH�s H�=�
�����i��)�1���H�������H��蘛�������^���ff.���LJX����ff.�f���USH��H��H��pH�@H�@HH�hH�����H���tH���H��菢��H���H���tH���H���_��H���H���tH���H���?��H���H���tH���H�����H���H���tH���H�����H���H���tH���H������H���H���H��tH����H��H����H��H��[]��ATH�wxUSH��H��H�=:i2��������9�|qL�c81���H���
L��������uL��D$����D$H��[]A\ÐA��L��D+��1�H�
��
��H�5U�
�Y�H��1�[]A\�fDL�c8)ƹ�H�-�
��1�L��蚡����uFL���~���H�CHI�ى�L����H���
H�x����H���H���[]A\�@A��H�
.�
L��1���H�5��
���ff.�AWI��AVAUATE1�U1�SH��H�L�odH�%(H�D$1�I�L9�t&L�t$fDH�;L��H�����Dd$�I9�u�E�'��H�T$dH3%(uH��[]A\A]A^A_��\���ff.������t�@��AV1��{AUH���
ATUSH�o@H��L�w L�o���H���J�������H�
��
�{H��1�H�5��
��H�CX1�H�@H�s`H���o�����H�����H��H���'��H�sXH�K`1�I��H�FH��H����h����H��L��1�L��1�����I�,$I�D$H�I��H9�t@H�}H������I9�u�H�CX1�H�@H�s`���H�{h1��5���H�{x�|�H�C(H����H�S0H�P0H�C0H��tH�S(H�P(H�C0H�SH�CH�C(H����H�BH�CH��tH�SH�PH�CH�CA�mpH�{HH�/L�gI�L9�t!�H�}H��H����I9�u�H�{H[1�]A\A]A^�x����H��蘖���~���H�C0I9� �<���I�� H�C0�,����I9]h�Q���I�EhH�C�D����Kg��ff.����USH�����w<H�
X�
��H��Hc�H�>��f�H�H��t���f�}u1�E$�H����[]�f.�H��g�H���X��[]�H�}�O������ff.����;tvd��fDUH��SH��H����w/f�tf�~ua�E$f9C$u?�����v1�H��[]�@��uNH�uH�{H��[]��������f.��w�H�������[]�DH�vH�������t�뢾\H�=��
��@���Gpu��f��������USH��H�H������e�����tH��[]�@H�k81��]H�%�
H��薜������H�
G�
�]H��1�H�5��
���H�{`��e��H�CHH�sH��肺������e��H�SPH�CXH����H�BXH�CXH��tH�SPH�PPH�CXH�CPH�����H�{8�/��H�-�e2H�s0H�}H��t
H��P H�}H�s@H�C0H��t
H��P H�}H�C@H�H��H�@ H��[]��@H��萓���*���H�SHH9��V���H��H�CX�F������USH��H�dH�%(H�D$1�H�CH�H�$�Cpu�����d�����tH�D$dH3%(�@H��[]�f�H�k 1���H���
H���������H���֒��H�CH�Kp1�H�@H�sP����d��H�C(1�H�@H�s0���Sd��H�{H�}��H�{8�}��H�{(�}��H�CH����H�SH�PH�CH��tH�SH�PH�CH�CH�{ ���H�-Ud2H�s`H�}H��t
H��P H�}H�C`H�H��P H�������H�
�
��H��1�H�5��
�������fDH�$H�CH9Z`�d���H�B`H�C�W���蔘��@��AVAUI��ATUSH��H�/dH�%(H�D$1�H�����H�E(1�H�@H�u0H�������H�����H��H��褻��H�u(H�M01�I��H�FH��H����c����H��L��1�L��1��}�I�$I�D$H�I��H9�t!I��fDH�L��H��H�$�]���I9�u�H�EH1�H�@H�uP���/c��H�E81�H�@H�u@����b��H�E(1�H�@H�u0����b��L���ޠ��H�D$dH3%(u
H��[]A\A]A^��\���ff.����ATI��USH��H�dH�%(H�D$1�H������H�[`H�$H��tH��fDH�[H����H�$H��u�L������H�D$dH3%(u	H��[]A\��Ֆ��D��H�G@H��t�f�USH��H���G��tO����f�{
�o,H�������H�=�NH��1���H������H�C@H��[]��f�{
�o,H�tY��H�=�N��H��1����H��1�H�5|�
1��V���H�C@H��[]���uXH�w1�H�=~�
�����C�H�=\�
��H��1��p�H����#��H�=:�
H��1��P��@�����H�=/�
�ڌ��f.���H���t"SH��H������H���[�f��ff.�@��H�WhH��tAH�B �Hd�����9�t01���H�J ��֋Id9�vH�R�H��u��D������1��ff.�@�������USH��(H�dH�%(H�D$1�H�C8H�D$H�CH�H�D$����Z`���P�����t"H�\$dH3%(�H��([]��H�k@1���H�5�
H��覕������H�
W�
��H��1�H�5
�
���H�����H�CH1�H�@H�sP����_��H�{@芽��H�{X�w��H�{h�w��H�{H�w��H�8_2H��H�8H��P H�T$H�BhH��t8fDH�H �q|;��s������;��v���H�@H��u�H�|$���H�|$���1����H��谌���:����v���fD��AT1���H�#�
USH�/H��L�e@L��舔����t4H�
��
��L��1�H�5��
���H�����H��[]A\���L���8�����fD��AWAVAUI��ATI��USH��(H�_dH�%(H�D$1�H����H���H�X81��xH��H�q�
H���������H���‹��H���J���H�]hH�l$H��tL;c u�Y�L9c �NH�[H��u�L�5�]2��I�>H��P�GH�5�
�H��L�` H�hI��$��n���H��H�C@�b���H�=��
H��1���H�{@H������I�>��H������N���H�CPI�>H�����H�CH���+���H�C`I�>H�����H�CX������H�CpH�ChH�C(I��$ H�C0H��tH�X(I��$ H�CH�EhH�CH��tH�X�EpH��H�]h���I�D$XM��$�H�D$�E����w	M���JL�m`M��u��f.�M�mM����M;}Xu�I�}`H�t$�����u�M�u 1���H���
L���������vH�
g�
��L��1�H�5h�
�l��L������L�k8H�}hA�D$|��;��s���A��$�;��v���H�k@1��fH��
H��肑������H�
��
�fH��1�H�5��
����DH�|$�|��H��H�L$dH3%(�$H��([]A\A]A^A_��H�
p�
�xH��1�H�5��
����,���fDH��Z2��H�8H��P�H��H�XH�AoE@�AoMHI�E H�E(A�}w1A�EH���
Hc�H�>��f�}�u[��I�}���H�E0H�EH�{�:H�5��
�}���H��H�E8�q���H�=��
H��1����H�}8H���$���H��H�uH���A���H�EPH��H�EXH��tH�hP���H��1��JH���
������H�]8���H���܏����t(H�
�
�JH��1�H�5G�
�K�����fDH��蘇������f�}�����MZ��H���x����+���L���k������fDI�>�xH��P�mH�5��
I���H�hH�EHH�x�L���H��I�E �@���H�=��
H��1��o��I�} H����H��苺��I�>��H������$���I�E0I�>H�����I�E(������I�E@I�>H�����I�E8���ް��I�EPI�EHI�EH�E`I�EH��tL�hL�m`H�|$M�}X���M�u 1��~I�E`H���
L���Y�����t5H�
��
�~L��1�H�5��
�����_������A��$��~���L�������?����Ό��L��
H�
��
1���H�5y�
H�=3�	��o��fD��H�w81�H�FHH�@H�vP���u8H�GXH�H�HH�H9�t#H��� t�H��� uH��H9�u�1����fD�������H�xt�@SH�G H��L��I�ٹ�H���
1�H������H�Cx[�ff.���H�WHH�H�JH�H��H9�tH;0u��H90tH��H9�u�1�����f.���USH��H��H�t$�y����t
H��[]�fDH�SPH�{HH�t$膸��H�k@1���H��
H���|�����tHH�CH1�H��H�
��
H�5��
H�@H�sP��A��H�D$L�@ 1�����H��[]�f.�H������H��[]��AUATUSH��H�GHH�L�`I�L9�tGI��@���fDH��L9�t/I�EH�;��H�p�u}��H��t�L���H��[]A\A]�fDH��1�[]A\A]�ff.���AW1���H��
AVAUATUH��SH��H�_@L�g8H���m�������H�Eh1�H�
��
H��H�5��
H�@H�up1�I��H�EXH�@H�u`��A��1����I�\$ 1���H���
H���������CI�D$81�H��H�
z�
H�5r�
H�@I�t$@1�I��I�D$(H�@I�t$0��A��1��P��I�|$H�GxH�LjH�G��G���I�D$81�H�@I�t$@��u|I�D$H�XhH��tnL�5��
�
DL��M��tXL�kL;c8u�����t��L�{@1�����L��L���,�������L������H��L���!l��M��u�@H�EHH�L�`I�L9�tDH�;H��H���a���I9�u�H��H��[]A\A]A^A_��k��fDH��訁����H��蘁���}���H�Ch1�H�
[�
L��L��H�@H�sp1�I��H�CXH�@H�s`�A��1�����D�������AW1�AVAUATA��U1�SH��H��H�w8H�NHH�AL�9H�vP�D$���iL�-��
�Q�H�Ch1�H�
S�
L��L����H�@H�sp1�I��H�CXH�@H�s`�A��1��b��;l$s>A9�v9��H��I�<�詃��L�s@1��L��L��裈����u�L����脀��;l$r�A�A9���L�5��
�RfDH�Ch1�L��E��A��H�
��
L��H�@H�sp1�PH�CXH�@H�s`�!P1�����XH��Z�ɵ��A9�v2L�k@�!L��1���L��������u�L������H��藵��A9�w�E��uH��[]A\A]A^A_�fDH��H��[]A\A]A^A_题��f���E1��1�����USH��dH�%(H�D$1�H�����R��H�o8H��1���H���
H���k�������H���K��H����_��H�{hH��tVH���������H�$H�߀���H��t3H�_H�<$���t�H�GH1�H�@H�wP��u�H�����H��H��u�H�D$dH3%(u2H��[]�f�H�
u�
��H��1�H�5?�
�C���S����i���f���AW��H��
AVAUI��1�ATUH��SH��L�g@H�_8L���j�������H�Eh1�H�
-�
L��H�5��
H�@H�up1�I��H�EXH�@H�u`��A��1����L�c 1��H���
L���	������QH�C81�H�
�
L��H�5q�
H�@H�s@1�I��H�C(H�@H�s0�A��1��R��H�sH�N`H����1��H�A81�H�@H�q@H�I�H��u�H��L2�oFx����H�C81�H�@H�s@��uH�CL�xhM�������H��[]A\A]A^A_��M�g@1��H���
L����������L���|��I�GHA���1�H�@I�wPI���P���D��H�����H��H������I�wHI�OP1�I��H�FH��H����O����H��L��1�L��1�����M�4$I�D$L�I��I9�t@I�>L��L��I���6��M9�u�L�|$M���
���I�GH�D$I;_8u�����fDI�GX1�H��M��H�
��
H�5��
L��H�@I�w`1�I��I�GhH�@I�wp�P1����XZ���DH��J2�oNx������u������9�B‰���H���L���{�����L���{�������AUATUSH��dH�%(H�D$1������H��A��@��t7H�GH�_J2����o�	@x��u������9�Bщ��H�{HH�t$��L�k@1��>H���
��L���	�������H�Ch1�L��!L��H�@H�sp1�H��H�CXH�@H�s`1�H��H�CHH�@H�sP�T$RUVQE��H�
e�
�>H�50�
A��H�?�LD�1��$��H�� ���u8H���d��H�D$dH3%(uiH��[]A\A]�@L���Hz�����t�H�[@1��CH���
H���5�����t!H�
Z�
�CH��1�H�5��
����f�H���y���������ATU1�SH�GXH�L�`I�L9�tH�;舯��<��H��L9�u��[]A\�AUATUH��SH��H�H��L�c�4�����uhI��$�tH��[]A\A]�f.�I�|$x��H�[@1���H���
H���Z�����unH���>y��H��H��[]A\A]�,���@H�[@1���A��H���
H��������tWH��E��H�ߺ�[H�
`�
]1�A\H�5{�
A]�}��DH�
��
��H��1�H�5W�
�[���x���fDH��H��[]A\A]�x��fDL���P�����$���H�k@1���H�
�
H���~�����t2H�
�
��H��1�H�5��
���H��H��[]A\A]�[b��H���0x����ff.�U1�SH��(H�wXH�|$H�ndH�%(H�D$1�H���D$H�w`��t8H�H�H9�tDH�;H���̚��H9�u�H�D$dH3%(u4H��([]�H�HH�t$�����tH�D$H�pXH�n�H�|$������N~��ff.���L�GHI�I�PH�H9���H;1��H����H90tH��H9�u�ÐH)�H����ATUH��SH�WPH��L��H��H���j���L�e@1���H���
L�������tLH�EH1�L�C L��H�
��
H�5h�
H�@H�uP��A��1��Z���H�EH1�H�@H�uP��t[]A\�L���v����fD[H��]A\�d���1��V����ff.����AWAVAUATUSH��H��xH��xdH�%(H�D$h1��b��H�=�
���H�{H1�H�K�D$8H�GH�\$@H�L$(H�sP����H�CX1�H�@H�s`��uH����>H�[@1���H�s�
H����}�����LH����u��H�\$@1��UH�H�
H�k@H���}������H�
��
�UH��1�H�5�
� ���H�CX1�H�@H�s`H���ڀ����H�����H��H��蒟��H�sXH�K`1�I��H�FH��H����H����H��L��1�L��1�L�l$P�f��I�,$I�D$H�I��H9�u�,H��I9�t#H�}H�|$P詪����u�L��H������I9�u�H�Ch1�H�@H�sp���H��H�|$8�Df�����CH��H�D$hdH3%(�TH��x[]A\A]A^A_�f�H�L$@1�H�5	�
H��H�AhH�@H�qp1�I��H�AXH�@H�q`H�
C�
��A��1��ܽ���s����H�D$<H��H�D$����Å���H�|$@�z��H�t$@1�H�FX���H�@H�v`H���X����H��H��H������H�D$XH��H�D$PH�D$PH�D$ D1��y���H�L$@H�AXH�(H�@H�TH�T$H9���E1�E1��&fDA�� ��@<A��H��H9l$��L�mL���<u����xnt�L��莟��H�|$P1�A��H�GH�t$XA����uTH�|$ D���G��A��L�(A��D�x�fDH�D$@H�t$H�xH�����Å���@���:H�|$P� ���1��D$�u���H�t$PD�D$H�VH�H9�t�D9xwf�H��H9��o���D;xs�H+H��A���Z���fDH�L$@1�H�AXH�@H�q`D)�D$E����H�yHH�t$�7���Å���H�D$@1��H���
H�X@H���.z�����6H���r��H�|$@���H�D$@H�|$HH�D$H�0������*���H�D$@���������H����q���C���H�i@1���H�E�
H���y������H���q��H�|$P1��:���I��H�D$PL�hM�M9��2A�w���&1��:f�A�G�D$<��t���D$<��I�����=���M9��4���A�O���(���I�?A���l�����I���f.�D9�E��E��H��DF�H��1�H�D$XH�
��
H�5n�
H�@H�t$`��P1��a���_AX�#���f�H�|$@�������H�D$@H�|$HH�D$H�̮��������H�L$@����E���0H�Ah1ҋt$H�@A��H�qpH�T$(A)�H��H�A H�zx�@d����9��
A9���H�D$(�D$E1���7�H�|$P1�褛��H��H�D$PL�xI�L9�tnE1���E��A��E��H��I9�t;H�}H��t�D�mE��tE9��NE���j�����H�EH��E��I9�u�Dt$;\$<v	E���r���H�D$@1��~H���
H�X@H���cw������D�D$E��~H��H�
4�
H�5��
1��Ƹ���c�����t$<B�.9���9�����)�A��H�Y@1��MH���
H���v�����kAV�M1�E��UE��H�
2�
H��H�5W�
�[���XZH�\$@H�{H����9�������fD1�E1�E1�H�q`H�D$�%���f.�H�D$@1���H���
H�X@H���av����t]H�L$@1�H�5��
H��H�AhH�@H�qp1�I��H�AXH�@H�q`H�
��
��A��1�詷��H�|$@�����<���f.�H����m����fDH�L$@1�H�5i�
H��H�AhH�@H�qp1�I��H�AXH�@H�q`H�
��
�A��1��<�������9��[���;l$���މ�+T$)�9�F�A��E���6����[���fDE������H���Hm�����H�L$@���fDH�Y@1���H���
H���&u����t�H�L$@1�A��H��H�5��
H�AXH�@H�q`H�
+�
��A��1��|��������H�Y@1��ZH�U�
H����t�����^���H�
w�
�ZH��1�H�5-�
�1����������t���E1��A���
���H���nl�����H�xD��H��������
����t�����s���?��f.���H�Gh1�H�@H�wp�ff.�f���H�xtSH��H�x�X���H�Cx[�f��f.�DH��H�G�0H��H(��?���W`9���?���wd9��\?��H�D�@xA��v�D;Gxv�B1��9���H���f�ATUSH��H��L�'H�4$H�5w:2H��H�T$�Z���H���H���k��������MbI�ى�I��$���L������H�G�
)ι�����H���H��[]A\�ff.�@��H�6H�?H��0H��0���AWAVAUATUSH��H�>��>��H��H���H���ƹ��L�s(1��H���
L���r����uHL���j��H�I��H��L���H���
H����p��H���H��[]A\A]A^A_�f�H�
I92H�=��
I��S㥛� H�QH�1H��H��I��H��I������H�UH�uH�=M�
I��H��H��I��H��I�����AU�M��AWI��H�
E�
1�H�5��
L���\���XZ�5���D��AW1���H���
AVAUI��ATUSH��XH�o(dH�%(H�D$H1�H�D$0H�D$8H���oq������H�
`82H�=��
H��S㥛� H�QH�1H��H��H��H��H���"���I�ٺ�H��I��H�
p�
H�52�
1�蟲��I�������I���1�H�AH�I���I�ƉŅ��=���:t��D��E1�H�����H��H�����I��H�;H���~ H�5�72H�ǀ���cn������H�޺L��A���g���H��A9�u��@�$���H�5�
H��H���=���I�D$L�}I�$H������<����H�L$(L�5A�
H�D�H�L$H�D$L���s�H���b��H�|$(H�D$���L�L$L��L��I��H�
|�
��1��h���H��H����a��H�=��
H��1�����H�|$�0#H���YQ��H;\$tZH�EH�;H�|$(I9�r1H��虄��M�e(1���L��L���so�����[���L���Sg��뉐H��L���y��H�|$(�fDH�|$0(H�D$HdH3%(��H��X[]A\A]A^A_�DI�](1��H�"�
H���n����uJH����f��H�t$0L�������H����f������E9��Y���H��o��)D$0�D���f�H�
�
�H��1�H�5��
�#�����Lm��ff.��SH��dH�%(H�D$1��0�;��H���H��H��tH�pH�H�T$H�������u(H�C`H�D$dH3%(uH��[�f.��D$�Cd�C`���l��ff.�@��UH��SH��H��H�?H�6H���H���uQ�H��tH��[]��H��@H��@蝲����u�H�EH����+��H��[]��H��t#H�ƀH�ǀ�`�����t��f.�������f�AWI��AVI��1�AUATU��SH��(�t$dH�%(H�D$1�H���H�@H���H���Zp����H�����H��H������I���I���1�I��H�FH��H����9����H��1�1�L��L������I�$M�l$I�L9���H�H�|$��E1�H�|$H�D$����u6�F9��f�@��t(H��A��I9�t5H�H�D$��������uӋt$H�|$L��H����M��I9�u�I���1�H�@I���1�H��I���H�@I���1��I���H�@I���1��I���A�H�@I���A9���8��H�D$dH3%(uH��([]A\A]A^A_�E1��v����Jj���b8��DAW1�AVAUATUSH��(dH�%(H�D$1�H���H�@H���1�H��H���H�@H�����_L�gH�H��L��H�D$�8��������"�C0����L�5�~L���L�c0H�D$M���ZH���1�H�@H������@8��I�EL��H�p讨������H��L������H�D$Hǃ�H���L�k(1��iH���
L���hj�������C0����f�{@
H�{@D�{T���K��D��H�=^!H��1��w���I��H���i1�M��UH�
6�
H�5#�
L��菫��XZH�|$H���ph��H�|$�K��H�|$��W�����|H���1�L�wL��H�����tVH�/I�L9�tDfDL�mL9l$t#I�EL��H�x荧�����/7��H��L�����H��L9�u�H���1��#s��H�|$H����bK��H�D$�}I�$�S`;Q(��6��H�y0H����H���oC@�R�SP������H�s8H������H�=��
1��G���I������H���`����C0�������f�1�H�L$dH3%(��H��([]A\A]A^A_�L���V�����@H���H�D$���H�;L���E���H�D$���L���P`���^���H���H�(L�hI�L9�u��DH��L9���L�}L��I�GH�x������u�L9|$�:5���{0�����H�D$H�ߋ����������<�����H����{���H�D$I�ٹ���L��H���
H�������H����F�������`H�s8H�=��
1��Ŵ��I���I���DH�k(1���H�r�
H���Ng�������C0�������
H�s8H�=^�
1��o���I��M��H�
��
H��1���H�5�
茨��H���H���H�t$�Ԓ���Cx�P�Sx������H��-2�oKh����H���^���fDf�{@
H�{@D�cT�&���D��H�=�H��1��˳��I���W���H����t���1����DL�c(1��SH�b�
L���>f�������C0����f�{@
D�kTH�{@���!��D��H�=4H��1��M���I��H��H�
߽
M��1�UH�5��
�SL���e���Y^H�����G��H����������D��H�=٠
H��1����I���s�����ukH�s8H�=��
1���I���~���L���`]����y���D��H�=��
H��1�襲��I���1����X���D��H�=n�
H��1�脲��I���2�����c����H�=[�
�[��fD��AVI��AUATI��USH��dH�%(H�D$1�H�G0H�L�hI�L9�u�MDH��I9�t?H�+L��H�}0踢����u�H��t'H�L$dH3%(H���uH��[]A\A]A^�H�-�.2I���H�}L�hH��PH��H�$I�FL�sH��Ao$C0�AoL$K@I�D$ H�CPA�<$�2��A�$H�e�
Hc�H�>��A�T$$L��H�=��
1��х��H�C H�$H�C8H��YH�5��
H�������H�C(H�$H�x ���H�=��
H��1����H�$H��H�z(�j��H�$H�}H������@�C`謅��H�}��Hǃ�H���H�$H������~���H�}��Hǃ�H���H�$H������P���H�}��Hǃ�H���H�$H������"���H�}� Hǃ�H���H�$H�������H��Hǃ�H���I�V8I�~0蒎��H�,$���f�A�T$$L��H�=@�
1��I���H�C I�|$H�$�w���H�CXH�$H�CXH�C8�a���f�A�T$$L��H�=�
�3���I�t$H�=d�
1�������`��ff.���AT1��yH��
UH��SH�_(H����a������H�
��	�yH��1�H�5�
�V���H���H��tHDž�H���'���H���1�H�@H���H����d����H�����H��H��裃��H���H���1�I��H�FH��H���2/����H��L��1�L��1��v���I�$I�D$H�I��H9�tf�H�;H��H��葵��I9�u�H����pC���(#�H��H�}�	��H����KC��H����?C��H����3C��H����'C��H���軧��H���诧��H�}(�ƈ��H��*2H�uXH�;H��t	H��P H�;H�u H�EXH��t	H��P H�;H�E H�H��[]H�@ A\���H���(X���m����������AVAUATUSH�G�0H��h(��-��H��H�������H�������!�C0L�c(������1��L��L�k8H�պ
�_������M����L��H�=.�
1����I�ŋC0��������H�s8H�=��
1�踬��I��M��H�
#�
L��1��H�5f�
�ՠ���C`1�H�߃����S`[]A\A]A^�����1��H�.�
L���
_����tV�C0L�-�r���p���f�{@
D�sTH�{@tC���D��H�=H��1�����I���]���f�[]A\A]A^��L���V���^���諺��D��H�=��
H��1��׫��I��������H�=��
�^T��ff.�ATUH��SH���H�� H�t$dH�%(H�D$1��� H���Hdž0Hdž8HE�H���u7H�SH�;H�t$���H���ΰ��H�D$dH3%(u^H�� []A\�DH��H�5�$2H�ǀ�jo����~�L�d$H�L$H��L��H����yA��H�K�t$L��H�;H����g����;\��ff.���AWAVAUI��H���ATUSH���_�����D��I���1�H�GH�/I������)D�x�1�L�5:�
�k@H�}H��
L�
�p�� LE�L�L$��L�L$L��L��I��H�
�
�w1��`���H�uL��H���`����CH�SL9�tTH��H�EH�5�#2��H��0�eZ����aM�e(1��wL��L���{\�����[���L���[T���f���I���I���H��1�[]A\A]A^A_銖��f.�H�EL��H��8H��0��I���I���H���1��ff.���H��1ɾ*#��ff.�f���AUI��ATUH��SH��H�H�H�xP���ExH���觢��H���1�L�gL��H�����t!H�I�L9�u2�1��)e��H����k)��H��[]A\A]�H��H���į��L9�t&H�;I9�u�H����a)��H��L���L9�u�H���렃}0�\���H�FH�UdH�p�o�����C����Ed�7������AWI��AVI��AUE1�ATUSH��H��HH�L�fH�D$(A�D$����wM�l$I�GI�o(1��H���
H�H��@(�D$8I���H�D$I���H�@H�D$I���H�D$I���H�@H�$�EZ�����I���1�L�
�mH�@I���H�D$ M��tL��H�=��
1��W���I��A�D$���6����I�t$H�=�
1�L�L$0�%���L�L$0I��H��1�H�5ܴ
H��H�D$H�t$1�H��H�D$ H�t$��Q�D$0H�
ٲ
P1�AV����H�� L��H�����I���I���1�H�wH��H���&I���H9�t	H���FILJ�L���>�����I���1�H�@I�������A�G`1҃��t$8H�D$(A�WdA�W`�@x��t
A;Gx��I�_(1��MH��
H����X������H�
��
�MH��1�H�5��
�0���A�xv@H�=�2I�wh�9j����MbL��H�=��
A�����A�Wx��i��A)�1�謥��I��A�GxH��HL��L��1�[�+#]A\A]A^A_����I�����&��L�I�0I9�t(I9��L����H9��H��H9�u�L��
H�
�
1��(H�5�
H�=�	�9��fDA�T$,I�|$L�L$0fA�|$
�T$<�/誳���T$<H�=�H��1��դ��L�L$0I������A�G`1҃��t$8A�W`L�����H9�t"H��HL��H��[]A\A]A^A_鹫��f�H��H[]A\A]A^A_ÐH���O�����L)�H����H��H���K���I���1�H�@I�����u#I������A�0������v����I�_(1��+H�ʱ
H���V����tbH��HH��H�
d�
1�[�+H�5��
]A\A]A^A_������{����T$<H�=��
H��1�覣��L�L$0I���|���f�H��HH��[]A\A]A^A_�N��f.�H���N���s���1��	�����H�=@�
��K��L���
H�
�
1��H�5��
H�= �	�7����H9��tSL���I�I�PH�H9�tH;1tDH���H90tH��H9�u�ÐH)�H����H���L��H���ď��@HLJ��1�����AT��H�j�
UH��SH��1�H��L�g(L���4U�����\H���$���H�
=�
��L��I��H�5'�
1�蔖���� ��H���1�1�H�GH���I���yx��E��t3H9��A�L$��H���H�VH9\��iH��H9�u�H��0~VH���1�1�H�GH���I���x��E��t3H;��A�L$��H���H�VH9\���H��H9�u�H���1�1�H�GH���I����w��E��t1H;tYA�L$��H���f�H�VH9\�tH��H9�u�L�<Y
H�
��
1���H�5�
H�=�	�5��DH���t>H���H�D$赚��A��H�D$t"H�@H���~H���H����D1�Hǃ�H���H���H��褍��H���1�H�@H�����t|H��[]A\�H���1�1�H�GH���I���v��E���h���H;��A�L$��H���H�VH9\���H��H9�u��3���@L���J�����H�}H��[]A\�ߋ��H���tDH���H�D$褙��A��H�D$t(H�@H��0�� ��H��0H��8H������1�H���H���H��蘌������1��H���H���H���y������1�f�H���H���H���Y����c���@��AVAUATUSH��H�� H���H�t$dH�%(H�D$1�H��t
���H�t$H��0H���H���~	H����H����H�l$H���H���H���m}��H�t$H��0~/�	9��H�D$��H�5X2H��0�O������H�t$H�����H�D$dH3%(�uH�� []A\A]A^�fDH���H��0��H����N����H�D$�xH���H���@����H�l$H�L$H���H���H���4��H����t$H��H���H����Z���t$���	���H�D$H��H��������DL�c(1���H�r�
L���NP�����vH�D$H�5:2L�-�
H��0��a��H�|$L�
�cA��� MD�����H��L���AVI��H�
��
M��H�5�
1��o���ZYH�L$H���H��H�����3��H����t$H��H���H����Y���D$���a���H�D$H��H��0H��8�����A����H�i21���Hǀ0Hǀ8�oH�]�
��H�k(H���.O����tjH�|$L�
�bL�%��
�� MD�����H�
��
��H��I��M��H�5�
1��t���H�D$H����2���L���F�����H���F��H�D$�����iM��f���AWAVAUATUSH����uH���1�H�H�@H�����uH���1�H�H�@H������@L�!H��H��A��$ ��H���H���1��s���H�[(1��H�-�
H���	N������A��$ H��aL�-ѩ
L��LD��ޕ��I�ƋE����f�}
D�}$H�}���Ʃ��D��H�=�H��1���I��H���1�M��AUH�
x�
H�5��
H���	���XZH��L��[]A\A]A^A_�DH���H���1�蛇���#���fD��uTH�uH�=h�
1��y���I���@H���E���fDE1������D��H�=)�
H��1��?���I���H�����H�=�
��B��fD��H���1�H�@H���H��H��t�H���1�H�@H��������U1�SH��H���v��H�߉�������uH����[]�DH���8���H����[]�ff.�@��H���1�H�@H�������SH���H��tH����R���H���H���tH����5���H���H���tH�������H���[�f.�DAVAUATUSL�o���L��L�g H��I����1��fH�=�
L���zK������L���ZC����H�s0L�$��C(I��H��H�N2H��H�8H�H����L��P(H��H�{0L��L���k(�i��H�2�oC8A����������Ⱥ�Mb�����i��HC8H�C8)�i��HK@H�K@H��?B~H��H��@BH�C8H�K@[]A\A]A^ÐA��H�
��	L��1��fH�5P�
� ����!���L��PH���H���f.��G`�uH�Xt�AVI��AUATUSH�oHH��tG@H�E0E1�H�L�hI�L9�tf�H�;H���tk��A�I9�u�E����H�mH��u�A�F`����d�d�uI�~8~H�5�2I�~8�[����dM؉�I�F�޹CM��H�v�
L��H�x�~��I�^ 1��EI�FXH�P�
H���I����tIA��H��H�
d�
[�E]H�5)�
A\1�A]A^���[]A\A]A^���d�d�q����H��[]A\A]A^� A��AV�NI��H�ڧ
AUATUH��1�SH�_ H���I������I��H�
ܧ
H��1��NH�5��
�p���I�vH��H�=Χ
1�����M�nHI��M��t<�I�E0H�H�hH�H9�tDH�;L��H���1\��H9�u�M�mM��u�[L��]A\A]A^����H���[@���f���AVAUATUSH��H�FP������WH�wH�����H�kHH��tI�H�E0L�uE1�H�L�hI�L9�t6fDH�;H���dS��A�I9�u�E��tH�mH��u�[]A\A]A^�DA��4t�I����A�����H�wH��[]A\A]A^�l���ff.��AU1��uH�;�
ATUSH��H�/L�mL�eH�I�] H���ZG�����R�u1�H��H�
Z�
H�5��
�ň��H�UH�EH���=H�BH�EH��tH�UH�PH�EH�U H�E(H�EH���H�B(H�E(H��tH�U H�P H�E(H�E0H�E 1�H�@H�u8H���J����H�����H��H����h��H�u0H�M81�I��H�FH��H���}����H��L��1�L��1�褞��H�}01��P��I�$I�D$H�I��H9�tDH�;H���2��I9�u�H�}0�(��H�2H��H�8H�H�@ H��[]A\A]��fDH����=��H�UH�EH������I9mH�����I�EHH�E���I9�$����I��$H�E(�����H��2ATI��hUH��SH�8H��PL��H�hH��蒋����H�51�
H�CH�}�ym��L��H�=��
H�C 1�褒��H�{ H���(L��H�H��0H�CH��tH�H��0H��[]A\�ff.�@��AVAUATUSH��H�dH�%(H�D$1��C`�t%H�D$dH3%(��H��[]A\A]A^�@��L�s I��1��H�kL�k�C`H�X�
L���D�����H�
��
�L��1�H�50�
����H�{X�w���H�H���H�SH�PH�CH��tH�H�H�CH�H9�(��H�� L���Ib�����9��H�{Pt	H�{P�A<��H�CHH��H��tDH��H�$�T���H�CHH��u�H�{ �l��H�-�
2H�s0H�}H��t
H��P H�}H�sH�C0H��t
H��P H�}H�CH�H��P I�$���L���`;�����HDž(�G����H�CH9�0��H��0H�C�����A��f.���S1��"H�ȡ
H��H�_ H�|$H���B����t4H��H�
/�
�"1�H�5��
�g���H�|$蝁��H��[��H���:��H�|$�~���H��[����SH��H�PH��tH�CH���tH�{Xt
H�{X���H�CX[��2������AUATUH��SH��(H�_dH�%(H�D$1�H���RL�.�oF�FH�� L��)$�D$� ���I��H����I�\$HH��t%H;ku���H9k��H�[H��u�L�-�2�@I�}H��P� H�����L� I�}H��H�h��c��H�C8H�C0H�CI�D$HH�CH��tH�XI�\$HH�C H��H�C(H��tH�X H��I�l$ 1��eH���
H���4A������H�
��
�eH��1�H�5ϟ
蟂���H�L$dH3%(H���bH��([]A\A]�fDL��(M������H�5"�
H������H�=�
I���†��A�L$`1���I�D$H�T�
L��(I�\$ H���@����t"H�
ڟ
��H��1�H�5$�
���[���H���G8���N���f�L��H�����H�� H�pH��I���?l��f�<$uRI�|$H���R����tAI�\$ 1��H���
H���?����t�H�
c�
�H��1�H�5��
�k�������H��	2�A�D$(H�8H��Pfo$I�D$0�T$�PA�L$`�H���7������J>��f.���SH�H����H��[�����ATUSH��H��H��PL���H�t$H�l$ dH�%(H�D$H1�H���H���4���D$ ����vBH��H�����H�t$H�����H�;H��X���H�D$HdH3%(u@H��P[]A\�DI��$�u�H�t$L���h�����y�H�T$H�|$�+#�P ����Y=��f���H�?��@��ATUSH��@H�dH�%(H�D$81��C`t#1�H�L$8dH3%(��H��@[]A\�@H�{Pt�������f.��s(����H�k 1���H���
H���=������H����5���C`�g
��H�{P�4
��H�kH�����L�c 1���H�m�
L���=������L���5��H�sH���L�CPH��H�!����|�����H�5i2H�{8�`����������H�k 1���H��
H���>=�����C���H�
?�
��H��1�H�5ٛ
�~���)���@H����������*��L�c 1���H���
L����<�����H�
�	��L��1�H�5u�
�E~��H�t$f�L�CPH��D$H�9��FH���H�D$����D$H�EH�D$ H�C H�D$(H�{�1s��H�{P�%����S(�����������H�
͛
��H��1�H�5�
�}���3���fDH�
Q�	��L��1�H�5��
�}���\���H�{H�T$H�t$�sn����u,�T$H�t$H�����h���f�L���3��������/��H��H���q��;����W:�����AUATUSH��H�/�E(��tHI��I��1��fD��9](v0��L��H��H�E0H�<��#����t�A�]H��[]A\A]��H��1�[]A\A]���USH��H�G0H�H�hH�H9�tH�;H���X��H9�u�H��[]��H��L�G H�w(�W0���L���D���H�����������������LJ�'���5
��H��H����A�'�]�H��t~�H ��t;��s���9��v����E��u
���A��H���H��tlL���H�����������u�ɉ�AD�M��u�H�HH���H��u�H�HH����r���D������;����k	��DA��H�H���)�����AUI��H��ATUSH��dH�%(H�D$1�胀��I��H�H�oH�H9�tBH�I��H�$�xt�	���H�H�$�xu?L��H���Wu��H9�u�I��1���B��H�D$dH3%(uH��[]A\A]��7������ff.�@����0�D��SH��dH�%(H�D$1�H���t1�H�L$dH3%(uZH��[�DH�G(H��H��t2H���H��H���2K����y�H�4$H�=s�	1�謅��H�������H��
H��������6��ff.����SH��H��H��H�t$t%H��H��H�t$��c��H��[��H���I�ٹ�1�L�8���H���
�<��H�����L��L��1�I�BM�I��t)I;0t;�H��H���H�PI9t�t
H��H9�u��@I��H��L��L���q��1���f.���ATUH��SH�H�=5�
H�H���H�� ��1���8I��H�L��P��H�5�
H��L� �@H�z2H�H�CH�����^��H�582H�CH���lz�����H�{�'��H�{H�5��
�=��H�EL��H�C H�u��$���@wL��H�C(�E��D‰C0H�u ��$��L��H�C@H�uH�$��H�ChH�uH��tL�����H�C8H�u(H��t	�>��H�u0H����L����3��H�CPH�u8H��t	�>��H�E0H��t$H�p(L���M$��L��H�CXH�E0H�p0�j��H�C`�EP��Cp�EX��D‰Cx�ET��Dºd�Ct�Ed����Eh����El��Dº`�����Ep��D‰���E\�C|�E]�C}�E^�C~�E`����oEx��H���H��������������D‰��������������������H���H���H���H�������������H�-�11�L�}�1H��H�
��1H�� H�u���H�u1�L�"�1H�
C�1H�����H��[]A\��H�u8H��������>�����L���"��L��H�CXH�u@�h��H�C`�l����L���xh��H�CH����ff.�@���G����AVAUATI��USH���XH�~H����� H�=*�
�.���8I��H�L��P�2L�(H��H�L�1H�H���M����L�cL���`���5�2H�=��
1����I��H�����H�5V�
H�����}[��H�5�2H���H���v�����H����s��#��H���L���
:���AoD$ C�AoL$0K �AoT$@S0�Ao\$P[@�Aod$`cP�Aol$pk`�Ao�$�sp�Ao�$����Ao�$����Ao�$����Ao�$����Ao�$���I��$�H���H�EL��H�CH�u� ��H�C�E�C H�u H��t	�>�~H�uHH��t	�>��H�uH��tL���s{��H�C(H�u(H��t	�>�]H�u0H����L���/��H�C8H�C@H�u8H��t	�>��H�E0H��tH�p(H��t	�>�_�EP��t�C`�ET��t�Cd�EX��t�Ch�Ed��t�Ct�Eh��t�Cx�El��t�C|�Ep��t����Cl��u�E\�Cl�Cm��u�E]�Cm�Cn��u�E^�Cn�E`��t�Cp�����t��������t��������t��������t���H���H��tH���H���H��tH��������t��������u������H���1�H�����H�8��R��HǃH��Hǃ�I��$H���H��tH���I��$L���k���H��[]A\A]A^���H�=h�
�*���8I��H�L��P�W2L�(H��H���1H�H���M���>���H��L�5��
�@���I��H�C�F���@M����A��$��{���f��H�=�
�o*���8H��H�H��P��2H�(H��H��1H�H���M���,L�cL���\���5�2H�=l�
1��|��I�|$H��H���V�AY����H�5�
H���-W��H�5v�1H���H���r��H���A��$��B��H���H����5���Aod$ c�Aol$0k �Aot$@s0�Ao|$P{@�Aod$`cP�Aol$pk`�Ao�$�sp�Ao�$����Ao�$����Ao�$����Ao�$����Ao�$���I��$�H����y���f.�H�u8H���T����>�K���L���R��L��H�CHH�u@�"b��H�CP�*���f���H�5��
1����D1����H���L���4��fo$% cfo,%0k fo4%@s0fo<%P{@fo%`CPfo%pK`fo%�Spfo%���fo$%���fo,%���fo4%���fo<%���H�%�H����}���I�|$H��tn��V����H�5��
H���[���DL�����H�C0�q����L����`��H�C@H�C8����L������H�CX�K������H�5G�
1���DL�����L��H�CHH�E0H�p0�t`��H�CP�|����4���fD��H��1��R+��f���USH��(H�dH�%(H�D$1�H��C���������C��H��0H�l$H��t@H��H�D$�j��H��0H��u�H�� H�l$�m���@H��H�D$�;��H�|$����H��H��u�H���m��H���Sf��H�{�S��H�H��t	H�H��PH�D$dH3%(uH��([]���)��ff.�f���H��H�=��x��H�=U2H���<��ff.����UH��SH��H�d�1H�H�GH��H�H��tfDH�����H�[H��u�H��H��tH���	��H�[XH��u�H��0H��tH���(u��H�[H��u�H��[]����ATUSH�� H�/dH�%(H�D$1�H�I��H��(H�$H��t�H�[(L���C��H�$H��u닅0����H�� H�\$H��t@H��H�D$��G��H�� H��u�H��H�\$H��tfDH��H�D$���H��H��u�H�����H���p��H���tH�����
��H���H�]H���H����H���H���H��tH���H���HDž�HDž�H���7�H���1H�CL�"L9�t	H;��tkH�}�2��H����Q��H�EH��t	H�H��PH�D$dH3%(uaH�� []A\�H;��c���H��H����P����H��H��t�H�����+��H���0)��L���+���h����'������f���H���1ATUSH�H��H�� L���H���H��t�H���x��H�m0H��u�H��H��tH���O��H�m(H��u�H��tH���)h��H��H�{�(��L��[]A\Ð��AVAUATUSH����0dH�%(H�D$1���u&H�D$dH3%(�xH��[]A\A]A^�DH���1H��L�0���H��H�$��6��H�{I��H��t�!��H�<$� �������4L�%��
�3D��0L��H��1�H�
b�
�W�h��H�<$�W]����0��t-H���1��WL��H����&����u�H�������fD��4�H���1��\H��
H���&����tX1��\H��H�
��
H�5[�
�h��M��tCL���)��H���5��H�{H��t�8��H�<$�)��H���W7�����f�H���(��M��u�L���{)���f�H�<$�A�������������$��D��ATUSH�� H�=2dH�%(H�D$1�H������H�U�1H��H�8t8H��t#H�D$dH3%(��H�� []A\�fDH���P&����fDH���E���H��L�d$H�(H��tH�l$H�mL���)��H��u�H��0H�l$H��t�H��H�D$�d��H��0H��u�H��L�d$H���W���f�L��H�D$�5��H��H��u��7����#��ff.�f���H���dH�%(H��$�1�H�2H��tH��$�dH34%(uNH����H��H���H�H����w���	H�=V���H��2�Z��H�=c����<��H��2��#����SH����0��H��[H���g#�����H��H���dH�%(H�D$1�H�<$��_��H����U��H�D$dH3%(uH����"��fD��H��H���H����������H������H���f���AT1���H�T�
USH��H��L���H���dH�%(H�D$1�L���]#����ty1���L��H�
��
H�5	�
��d������ud�����H�����H�EpH�EH��H�5��
H�$�_��H�D$dH3%(u1H��[]A\��L����������t�H����1����z!��f.���AT1���H�d�
USL���H��H���L���"����t]H�
�
��L��1�H�5-�
��c������u"�����H�����H����r��H�EpH���[]A\���L������fD��USH��H���H����������H���1��RH���
H����!����uH�����H��H��[]�Br��f�H��H�
n�
�R1�H�5`�
�#c��H��H��[]�r��D�����u#H��H����g�H���H���]����ff.�@��ATUSH��dH�%(H�D$1�H����l�H������4�H���I��H���p��H���H��t	�s����u'L��H���\��H�L$dH3%(u0H��[]A\�H���H��H�H�P8H�@8H�$�V����O��ff.�@�����u;H��H������H���@��u
H���|W��@H���O#����������u#H��H������H���H���!Q����ff.�@�����H����uH��t!�uH����w�@H�����o��PL���
1�H�
��
�_H�5_�
H�=�Y	�k��ff.������u#H��H����/�H���H���qc����ff.�@�����t�f�H��H���H����H����vH���H�����ff.�@��H��H���H���������H�phH���>O��ff.������t�y��fDH��H���H�����H�����
�H����x��ff.����C�����AUATUSH��H�p���H�0�1H��A��I����H�8H��PH��H�EpH����
��H�EA��L��H��H���H���H���H�����H��H��H��H�D���H��H�����H��H�����H�� H�j���H��(H����H��0H�>���H��8H�@���H��@H���H��XH�����H��`H�����H��hH�MH��[]A\A]��	��ff.����U1��*H�Հ
SH��H��H���H�������t2H��H�
��
�*1�H�5��
�e^��H��H��[]�<���H�����H��H��[]�<��f.���USH��H���H���l�H�@pH��1��6H���H�.�
H���^����u*H���B�����H���#<��H��H��[]���DH�
��
�6H��1�H�5�
�]��뿐��H����@���B�����SH�H���H����7��H��[�\c��ff.��H�����@���H�8�uH���1H�H�G8���@H�?H���7C�����AT1��MH�"�
UH��SH�_H���[������H�
�
�MH��1�H�5�
��\��H�}p�a�H�}P���H�}h�i��H�}�@C��H�} �7P��H�E(H��t^H�L�`I�L9�t(�H�3H��tH���1H�8H��P H��L9�u�[H�}(]A\�*���f.�H������m���[]A\�ff.���U1��bH�3�
SH��H��H�oH���i����t5H��H�
N�	�b1�H�5�
��[��H�{pH��t H��[]�tT��@H�����H�{pH��u�H��[]����ATI��USH��H�oH��ty1��nH���
H��������u'H������H�{pH��t?[L��]� A\�-u��DH��M��H�
}�
1��nH�5S�
�([��H�{pH��u�[]A\�f.�1��lH�(�
H���j����t�H�
r�	�lH��1�H�5�
��Z���m���@��H�?�dL��@��H��H�dH�%(H�D$1�H�H��tH�H��H�$�%��H�L$dH3%(uH��������AUATUSH��D���A��@�n�H��I���
H��H�����H���'��
H�����H�����
H���n��H�����
H���X��H�������H���1wQH��H��H��u]H�H��unH�H��tH�507
H���`�����utA��$�I�|$ H��H��H��H�5�E
[1�]A\A]��P��H�5H�
H���!�����u�A��$��f�H�5#7
H��������u�A��E��$���H�5�6
H��������u�����ff.���AUATUSH������+�H���H��A��I��H���$�oE(f��H��M()$�C��H�}H��1�H��H�EHDž�H)�������H�fo$E(H�]L��D�mH�{X�K���H�EH���1H�8�/<��H�E8�����>H�5a
H�E H�{p�>���UH�5�H�EH���_���uH�=Z
1���c��H�}H���K��H�M(H��t7H�A1�L�!H�u0A�Ņ�t#1�@�CH��I�ĉ؃�I�4��s��D9�r�H��H��[]A\A]�DH�X��H��PH��H�������f.���S���@���H��wH��H��H�xX�I��H�C[���H�����@���H�w8H���f���AUATUSH�����@�#�H�PH�����H�p���H��H���<��H�kPH�SXH���6����~0H�UH�CXH9����H)�H�CXH�EH�C`H��[]A\A]�DuH�CX�����DL�c���H��}
L��������t?H���G���H��I���l4��M���L��I��H�
Gv	H�5f}
1��)����L������fD��ATUSH��dH�%(H�D$1����@�U�H�PH�����H�p�d�H��H��uH�D$dH3%(ujH��[]A\�DH�H�R�H�xXH������H9��p�H�I��H��PH��L��H���`2��H��H���e��H��H��H�$���H�����������AUATUSH��L�'I��$�H����H�����@�}�H�P�J�H�p�����P8���[L��I���Bd��H�u(��H�=�~
H��1��`��L��H���$��H��L��[]A\A]�f�AUI��ATI��USH��H��(H�?dH�%(H�D$1�H�|$H�/�����v	�������H�D$H�xpH�������H�D$H����L��H��H���j��H���I9����������tU1�	uIH�D$1���H�0{
H�hH���n������H��H�
D~
��1�H�5{
�������S��H��teH�|$���uI�$H�L$dH3%(����H��([]A\A]��H�������xd��������K����H�|$�p���fD�� H���vQ��H�D$����@H������	��H���S����I�$H�|$��������H�|$����A����%��L��|
H�
w�
1���H�5�y
H�=�K	��ff.�f���ATI��USH��H�H�@H�hXH��t2H�sH�IB��H�SH1�H�����[L��H��H��]A\� ��f���H��H����2��H�CH � H��H�C@���UH��SH��8dH�%(H�D$(1�H��H�����H��H����S��H�D$(dH3%(uH��8[]��!�����U1��H�y
SH��H��H�oH���9����t5H��H�
>n	�1�H�5�x
�Q��H��H��[]�J�f.�H������H��H��[]�*�f.���SH��H�?��I��H��[�R���f���AU�+I��1�ATI��H�Zx
USH��H��H�oH�������tKH�
�x
�+H��1�H�5)x
�P��L�kxH�;�L����H��H��H��[]A\A]��@H���(����fD��U1��HH��w
SH��H��H�oH���	����tMH�
kv	�HH��1�H�5�w
�xP��H�{pH��t�*g��H��SH�5�a	H�xpH��[]�NW��fDH�������ff.���ATU�SH��dH�%(H�D$1�H�H������H�$�H�����H�hH��t<L���I;|$`�o������p�H�{h�q��H�ChH�$H�z`H�kH��t���H���R1��pH��v
H����
������H������H�<$��\��H�<$H�o`���H��t)�Eu#��� ��H�5��1H��H���BJ��H�<$H���H��t	���t�D��H�;��;��H���??��H�L$dH3%(���\H��[]A\�H�
4j	�pH��1�H�5�u
�N���J���fDL���@D��H�[1��aH��u
H��������~H������H�$���w���fD�k+�������@L�������P���O���fD1��kH�Pu
H�������uFH���v��H�$1퀈����@H�
�5
�aH��1�H�5u
��M���h���fDH�
Yx
�kH��1�H�5�t
�M���f�H���7��H���*��H�<$��xH�o`�[�����P��H�<$���
�����SH��dH�%(H�D$1�H�H�$��� H���?�H��H���u�����x1��H�<$�G�H�L$dH3%(uH��[�f.�H����"
��f���H��1�1�dH�%(H�D$1�H�H�H��H�$���������H�L$dH3%(uH�����	��f���H��H�51w
dH�%(H�D$1�H�H�H�H��H�$��F��H�D$dH3%(uH����n	��ff.���ATUSH��H��dH�%(H�D$1�H�H���H�<$�����H�khH���q�H�{pubH�{P���H����&��� H���>(��H�sPH���R
��H�����H��A��� (��A���
�H�x
Jc�H�>��D��H�{p�`D��H�L$dH3%(�(H��[]A\�H�k1��H�dr
H���	����uH�����H���"Z���H�
�r
�H��1�H�5.r
�K���אH�k�9�H�r
H���S	�����H���3��H��H�5�r
�� ��������J���f.�H�<$���@@���H���c���1�����@H�<$�����H�{PH�,$I��H�
���+H�5�q
��!��H��������@H�k���uH�CPH�H+C`H;CX��1��$H�6q
H���x��������H�
r
�$H��1�H�5q
��I�����fDH�<$�_L��������U���DH�{P��H�{PI���'��M��9H��I��H�
�A	H�5�p
1��x�������H��p
�H�������������H�{P�i'��H�
*t
�H��I��H�5fp
1��)����a����_��ff.�@��AWAVAUATUSH��H�=)q
H��hdH�%(H�D$X1��Z��L�3��D$M����_��H�D$I�6H��H����H�=�6
�����A��A��$����H�{P�TH�{x�Y���C=0A��=��ƒ�dA	Ճ�c��A��0��L�K���t{A�~ ��E����1�L�Ϲ�L�$H�Ho
���L�$����H�
[p
��L��1�H�5o
��G��I�|$`E1�A��E���D$H�Ch�~fDH�CXH�D$E����1�L�Ϲ�L�$H��n
���L�$����L�D$��L��1�H�
�s
H�5�n
�vG��H�|$���D$A�E1�@�	H�5�o
H���1���S1�H��H�5y�>���H�5:
H���|1��H�sH��H�4$���H�4$H��H���]1������hH�{@t4�H�5uo
H���51��H�s@H���P���H�5�H���1�����E������E�u7�|$uA�FPuA�����DH�{x��A�~ �2H�EH�D$ H�EH�D$(H�C H�H�T$0H�@Adž�I�|$`H�D$8H�WH�D$@H�D$H�14��I�|$`H�t$ ���?��H���lH�k1���H�m
H���J�����:H�
O6
��H��1�H�5�l
�E��H�{pH��t�3��H�{h�lH���+������M�l$`M��t
��� ��H�|$�Y����a��H�L$XdH3%(����H��h[]A\A]A^A_�@H�{pH��t7H�t$�5��D$���!E����H�{P��L�K����@H�{x��L�KE����1�L�Ϲ�L�$H��k
�6��L�$��A���gH�
m
L��1�E1���H�5�k
E1��D���D$�2���f.�A�~!�5���E����1�L�Ϲ�L�$H�}k
����L�$����L�����I�|$`E1�H�{h����D$�����D$1�L�Ϲ�L�$H�,k
�q��L�$����H�
^o
��L��1�H�5k
��C���{���E���*�����"���H�T$1�H�54
H���;���������DH���������H�5l
H����-��H�{8�;Z��H��H�$���H�4$H��H���-���H�5wH���-���G����H�k1���H�Dj
H��������H�
�k
��H��1�H�5j
��B��H�{pH��t	��;����xA��$�H����Q�����:���@������C���fDE1������L����,��L�����������L���E���fDL�������w���L����������H�5�2
H���,���������A�~!�����H�5�2
H���q,�����@H���`����
���E��u{H�{PuH�|$��L�K�����L���(����M���I������4����:����H�
�m
��L��1�H�5�h
�A���@���fDL�K�D$E1��L����E��L�KE1��6����L��E1�����D$����D$E1�E1��
�����C�P���c�$���=�����=0����E������L�K�D$E1�E1�����fDI�|$`A�E1�H�{h�A����D$�_����D�|$E1����E���D$E1��u����H�5/i
H����*�������H�{p�`������H�{p�u�������{���ff.���H��H�������G�H�GH�H���ff.���H��H������H�W H�GXHBH���ff.���ATI��UH��SH��H�� dH�%(H�D$1��Z��H�{(t_L���'D��H��H�D$�D��H�S0H�{(H�t$H�D$��)��H�S0H�{(H�t$��)��H�D$dH3%(u@H�� []A\��H���1� H�����H�8����H�C0H�C(�r����L���f.�f�AUATI��USH����������0��������F���c����H��L��H�����H�3I��H��t�H�=�,
�����tIH��p
H�5E9	L����Y��H��H�5�ID�1�1�H���6 ��H��H�����H��L��H������H��L��[]A\A]�ff.�@SH������ ���H���(�H�����t���[�ff.�@��H���H��H����GuH97s�W>����ff.�@��USH��H��H��H��`H����<��H��uH��[]�H���H�}pH��[]���f.���H�� ���UH��SH���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H�_p��H��$�H��n
�$H�D$H��H�D$ �D$0H�D$�"�����tNH��H���C6��H�
��
�H��I��H�5�n
1���B��H�D$dH3%(uH���[]�f�H������������H�� ��:����H� �s����SH��H��H�s ���H�C [�fDH��H���H���������@���H���H�7H���ff.������u3H��H���1H90����H���H���H���)����ff.�@��H�OH��whH��tH�=O'
1��G���H��tH�=�m
1��G��DH�=�m
1���F��f���SH�H��H�pH��tH�5�'
��.��H�{pH�SH��tH�5�'
�.��H�{p�ShH�5�m
��A��H���,J���H���?H��H�=�'
H��1��~F��H�{p[H��������AT�UH��H�=@m
S����I��H�L��P�JH�5�l
H��L�`X�@`H���H��`H�����1���ChH��x��1� ��H��H�CpH�EXH�H�CxH�E`H�H����1�H���Hǃ�H���H��t#H���H���H��[���]A\�fDH��������H���G`���#�����G`H���f���ATUSH��C`L������!��H��C`��P��S`��t
��[]A\�H�kp1��dH�Zk
H���������1��dH��H�
j`
H�52k
�!9�����vqH���H��tH�����Hǃ�H���H��t�w�H�{p1��|��H�CXH���e���H�H�{X�P��[]A\�fDH�������w�H���H���ǃ�	H��tJH���H���H��tWH���H���Hǃ�Hǃ�A��$��-���DI;�$�u�I��$�H����DI;�$�u�H���I��$��D��AVAUATUSH��H�� ���dH�%(H�D$1�H���@��H�$��H����H���H��L���H����8��H���L��L���H���H�D$��5��I��H��u@��u,H�T$dH3%(L���WH�� []A\A]A^��H�1�1H�|$H�(�D��H�<$��(��I�|$p�����"��H�|$I�D$p��$��H�$�@P��I��H�
+�����L��Hǃ�H�5�h
�\��H�D$H�$���v!�)�I�|$p�v+��H�$���w
H���t�H�|$����H���=���H�|$�c$��I�|$p�)���I�|$p����H��L��������uHǃ�H�|$�&������f�����.���H�|$�9K������LJ�I���������)�f���H�������������������	�@���H���ff.�f���AU1���H��g
ATI��USH��H�H�kpL���H��������H�
�Z	��H��1�H�5gg
�V5�����w
ǃ�	I�}pH��t�u��Cd��uVH���H��t�m��H���H��tHǃ�H�����H��L��[]A\A]�[��H���@��fD�����ff.�@��H���H����ff.�f���AUATUSH��H�dH�%(H�D$1�H������H�$�DH��I��L�kpH���d1���H�Rf
L������6M��H�
n[
L��1���H�5'f
�4��H���H��tL���R�����Hǃ���H�$H����H���H���H���6H���H���H����H���H���Hǃ�Hǃ��������uC��u3����Q���w%H�x`�9H�5Mc
�P�H�$H�x`�S��H��L���5	��ǃ�	H�����H�D$dH3%(��H��[]A\A]�@L���X�����1���H��d
L���J��t�H�
RX	��L��1�H�5�d
�2�����@H;���
���H���H������H;������H���H��������ff.���SH����#���Cd[�ff.�f���H��dH�%(H�D$1�H��PdH�$���,��H��HdH��Q��Pd��u	���u�a���H�D$dH3%(uH���@�C������ff.����H������H�GX����H����@��UH��H�5�
SH��H�0����H��1�H��tH�����H��H��H���#=������H��[]�fD��H����t�@���	���ff.�f�������u&H�����uH���H��t�����t��H��H�����H�����ff.����H������������H���ff.�@��H�����������������GPt�t	H���@H���H���XE�����AUATUSH��H���:�H�{p�OH�5b
�
��H�=�b
�P���1��UH��a
H��H���L���tXH���H��H��`D���D�j$�?��H��E��H��AUI��1�H�
`
�UH�5�a
�/��H��[]A\A]�H��H��[]A\A]���ff.���U1��qH�Ya
SH��H��H�opH������t=H�
<b
�qH��1�H�5)a
�/��ǃ�H���H��[]�D��@H���P���ff.���AVAUATUSH�� H���H���H�|$H�kxL���dH�%(H�D$1����H�T$���H���H��LJ�H���H����H���H���H����H���H���Hǀ�Hǀ�������H���H��t
�R���H�D$H���H�xpH�5`
H�JXH�R`L�*��L�1L+��L+px�x��H�=�`
�PL��H�=�
�PHL��H�=�
�PH���1���H��_
H��I������uQL�����H��tfH�|$����H�|$L��H���j��H�D$dH3%(�FH�� []A\A]A^�f�1���L��H�
k`
H�54_
�#-��H��u�H�D$����|H��������@P��H�|$�T��H�|$�A���k���DH;�������H���H����t���H;���E���H���H����2���H�S�sH�=Z]
1��;8��H�|$H���n��H�|$��������H�|$H�5�_
�G��H�|$��������H�|$H�5]
���H�|$�������;�ff.���1���D��AT�USH�7H��H���H�=�
��€���t[H����=����uGH���1�H���H�@H�������H���H�H��t]H���H��[]A\��D[]A\�H�����H�JH��^
H��tT�{��H�SH���H��[]A\��fDH�3�H�=�^
�����u
�{��H��^
��H��[]A\��8��@L�cp1��fH��\
L���>���tJH�
G^
�fL��1�H�5�\
�*�������H��H�^
[��]A\�x8���L���������H��H�={	���_��[]H��A\�S����ATI��U���SH���!��L���H��1�[]A\�����ATI��U��SH��H���L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�H��H��H�D$H�D$ �$ �D$0H�D$�##��L���H��H���3�H�D$dH3%(uH���[]A\���f���UH��\
H��SH�����H��HD�H��H����H��H��H����*��H��H��[]���f���ATI��H��UH��SH��0dH�%(H�D$(1�H��H���@��H��L��H������H�D$(dH3%(u	H��0[]A\����@��UH�
U\
H����SH��H������h�H��H�5B\
H��H���C��H��H��[]�U��D��AUATUSH��H���L�o8���H���1H��A���A��H�8E�H��PL��H��H���I�EH��X���H��XH���H�CHH��H�CpH���H�C(������A	�D����.���L��H��1ɉ����H�}8H������H���H��[]A\A]�ff.�f���H��@uCH��H�H���H�H�������H�PH��tH��H����fDH����ff.�@��SH��H���H�|$H�������H���H��������@�����p��H���H�|$H��t	H98���������r��	�	H�|$��H��[�@�������H�D$1���H�tX
H�XpH���������H�
'Z
��H��1�H�5HX
�7&��H�D$ǀ�H����|��H�D$H����k	��H�|$�q�H��[�H����;��H�|$�R�H��[�@H�|$�#��H�|$�4�H��[�fDH�������H�|$���f�H������\�����H�=�W
����f���AWAVAUATU��SH��H��L�.H�~ M������H�{ I������������t]��u"I�Nj@���H�$Y
��L���1��I��$�tH��I��$�[]A\A]A^A_�`���H��[]A\A]A^A_ÐI��$���������A�m`H�{0�K�S(A�El)�AE`A�El�c�A�Ul���I���H����������@�o���鮾��L���X��L��H���}��L��H��H�5 V
H��1���H��W
��L���"1���'���DH� X
��L���1���	����I�]p�E�H�V
H���k���t?L���o��L��H�����I��EH��I��H�
�U
H�5�U
1�������@H��������ff.���AVAUATUSH�/H��L���D�u`M��$��OH�0�S(�ElD)�E`�El�c�M��tGA�E��t3H���tqI��$�tV[I��$�]A\A]A^���f�L����=����u,�Ul���H���H���S������@u��E����[]A\A]A^��L�����L��H������H��H��H�5	H��1��N�H�V
��H���z/���L���D��H�GH��t���ff.�@��AVAUATUH��SH�� dH�%(H�D$1�H���H�}8H���H�|$�����I��H��I��M��H�����H�T$��J����t��H9\$��H�|$H�����H�D$H�}X�8H��PH��H��H����H��L�s(L��H�CH�]�H�|$H�CL�k0��H��H�5���H�C H����H�{ ��+��H�|$���H�D$dH3%(��H�� []A\A]A^����c���fDH�(U
��H���.���f.�H�]p�h�H�S
H���s����u'H���W��H��T
��H����-���l���fDH�|$���H�|$I������M��hH��I��H�
�@	H�5�R
1������������AUM��ATI��UH��SH��H��H��dH�%(H�D$1��.���M��L��H��H��H��H�$���H�����H�D$dH3%(uH��[]A\A]��N��ff.���AVI���8AUI��ATUH��SL���H�XH��PH��H��H�����H���L�s(I��H�CH�N�H�5�Q
��L�k0H�
���H�CI��$��&����H�C I��$�[]A\A]A^�8�����UH��H�q�SH��1�H���R��H��H��H��H��[]�N ��f.�@UH��SH���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��xH��$��-H�D$H�=V
H�D$ �H���$�D$0H�D$������tKH��H�����H�
q�
�-H��I��H�5�U
1��$��H�D$dH3%(uH���[]�fDH��������Q���USH��H��H��`dH�%(H��$�1�H�uH��H��tH�T$`��������H��`H��1��H���H�H�EH��twH�$��H��(�D$PH�{X����	ȹ�D$P���H�{`1�H������H�{`H�5�1H�����H��$�dH3%(u>H��[]��H�ɤ1H��z����H��`H�S`H�sXH�x�X����<����>��ff.�AU�H��T
ATI��UH��SH��H��xdH�%(H�D$1�H��H�tT
LD�H��1��%�����=M��H�
��	H��1��H�5*T
���L���!����H���H�EXH��t
H�H���H�E`H��t
H�H��H���H��tH�5��i���HDž�H���tH�����H���H�$H��t#I��DH���L��L���n��H�$H��u�H����Y!��H����M!��H�������H�}`H��t���H���tH����m��H���6��H�D$dH3%(u"H��[]A\A]�f.�H�������������ff.���H�GXH��t
H�H���H�G`H��t
H�H��H����ff.���H�X����ff.������USH��H��H��`H��x���th1���H�JR
H�������uH�����H��H��[]�+��D���H�ﺛ1�H�
�S
H�5	R
�l��H��H��[]�n+��fD1���H��Q
H�������t�H��`H��D���H�
�S
��H�5�Q
D�H$1����H��H��[]�+�����H��`H����@ u��u�SI��H��H�
r�zH�5^Q
���$��H���[�fD��H���H��t�+ ������H�Ǡ�����H�`H��t��9��f��ff.�@���� H�`H��t�3����ff.�@����H��� t��߈�H�`H��tH�5m�1����ff.�@��H������������u
H���t�fDSH���@tH���H��t���u����t
H��[����[�ff.���ATUSH���H�������H��H9����H�{P����L��x1���H��O
L���������L���p���{<��3���H���H���D�`Hǃ�tH����G�H���u	E���������	������H��(u7��~��d���Dž�H�����H���H��t	���@u?H������H��[]A\���H�
YQ
��L��1�H�5�N
�;���&���fDH���H����fDH���H
����t�H�������f.�H�CX�@���-���A��tSA��Z������H�5Q
H��1����H��J
��[H��]A\�#�������[���饱��fD��H�5�P
H��1��P���H��I
���f���H�5�*1H�=N�1鹼��f���AWAVAUATUSH��(dH�%(H�D$1�����P���H���1H��A��A��A��M��L�D$�H�8H��PD��L�D$�H��H��`��D��ǀ�H�ž1L���H�L���H��h����	Ј��˳��E9����D����H�uPH���hH�uXH����H�}x��H�5�L
����1�E��D��H���H���H��H�D$���H���H�|$H��x���E����H���
��H��x1���H��L
H���]����uIH���A��H�L$dH3%(H���7H��([]A\A]A^A_��D���۲������fDH�
�J	��H��1�H�5 L
���렐H���X����a���D�������������L��x���H��K
L���������L�EXH�
�V	L��1���H�5�K
������f�D�����������L��x���H��K
L���P����t<L�EPH�
QV	L��1���H�5XK
����>���fDL������8���L������������ff.���H�����������������H���ff.����USH��H�dH�%(H�D$1�����������H�������u
1�H�����H��x1��=H��J
H���Q������H���1��H�������H�����H���H��tAH�xt:H�=}J
��#��H���H����D$H����PH�|$�h���������H�-ٚ1H���H�}H��t
H��P H�}Hǃ�H�H��P 1�H�T$dH3%(u8H��[]�f�H�
gH	�=H��1�H�5�I
����-���fD�����ff.����H��dH�%(H�D$1�H�<$��u1���H�����H�D$dH3%(uH�������f���SH��H�?��u�w�H��[���ff.���H��H�5-�	1�H�|$��H�|$H�5�	�4�H���ff.�@��H��H���H�|$H��t���1���tH���fDH�|$H�5�H
����H���D��ATUSH��H�|$��uRH�o`H��x�E�� tK��htF��H�*H
�H���������H������H�|$H�5JG	�d�H��[]A\�1���H��G
H�������u&H�����H�|$H�52N	�%�H��[]A\�@H�
�J
��H��1�H�5�G
�����f�H���h�H��I���}��M���H��I��H�
HJ
H�5YG
1�����@���D��SH��H��H�`����~H��蟼��1�H��[��t�H�߉D$����D$H��[��AUATUSH��H��dH�%(H�D$1�I�������������H���H�$H��������������IH��x���Q1���H�sF
H���C������H���#��H���[��H�$�����tH���tH����]I��t@f�L��H�$���������H�L$dH3%(�H��[]A\A]�I��uɽL��H�$�����t�H�����1������@H��x1���H��E
H���k�����H�
�E
��H��1�H�5sE
��
��H��I���k�����u����9���f����\���H����N���H��x1��H�E
H����������H�
�E
�H��1�H�5�D
�W
��H��M������H�<$���H�$H����S��L�������������H���)���������������uW�������r���f�H���H���
���H���8���|���H�
�G
��H��1�H�5PD
������fD���W�������1���H�"D
H����������H�
CG
��H��1�H�5�C
�]��H�������������������fD�x!������@P����������������x���H�{`�H�5#D
�8"��H����H��x1��	H�rC
H���B����t{H�
D
�	H��1�H�5NC
���H�$��������H������6���H��`�p$9���W�������J���H������=���H����
��I������H�������t��@��AUATA�USH��H��(dH�%(H�D$1�H��`�P$9��sD���A��H��������������H���H���~H���H�D$H�������H���1��H�|$�w���H����H�|$���c��H�|$H�\$D��A��A���������
���E������tKH���L��x�61��zH��A
L���������L���x���H������fDH���������H��`���u6���9H$w[H�t$dH34%(���H��([]A\A]�f.�H�������udH��`�p$9��s����u�f�H�����E��t�H�{Pt�H������f�������{���fD��P���fD��[���fDH�
�D
�zL��1�H�5�@
�	�����fD1��H��@
L���b����t.H�
�D
�L��1�H�5n@
����H���i�������@L�������������USH��H�_XH�|$H�����C�C u���uH����[]�D����@��h��@ ���H��x1���H��?
H�������uGH��藾��H�|$H���H���������H�|$H�5F	���H����[]�H�
�B
��H��1�H�5x?
�����f�1�H����[]�DH��蘩��H��H����H�|$H��H�5�C
H��1�1��b�H�|$H�5�@	���H����[]�����t��H����[]�H�|$H�5�@	�G�����f�ATUSH�� H���dH�%(H�D$1��H��t	���tH�L$dH3%(�LH�� []A\ÐL��xH��1���H�p>
L���@����tLH�
(?
��L��1�H�5L>
���H���H�T$H�t$���A�ą�~"H���j����r���L���ؼ����fDH�������twE��trH������H�T$1�H��H�5nB
���D$��uh��H��>
��H�������H�|$H�l$����R����������u	��u1�����H������1��������u"��H��9
��H������������H�=5=
������AWAVAUATUSH��XdH�%(H�D$H1�H��`H�|$(������������H����������d�;���H�\$(��tH�����H����������H�|$(��@�
H��`H�������I$H��t�������9��S���H�|$(H�D$0H�D$0�L�-S=
H�D$���!������H�D$@H�T$0L�d$8H�$H�D$$H�l$ H�D$H�D$(H�rXM��H��H����o��Å���H�D$(H�|$0������H�|$0���L���=��L�|$(�D$$A��@�����I����s���L�t$0A�~ ��I�~8I��`Adž�H���a�p ���L��I�F8I������I�~8L��H�5 �����L�����A�F`H�=h<
A��@�D$���L���D$@�{�H�<$�B������ǟ��A�������A��A�F`+D$A�FlI�F8H��tVA�FPt$A���uI���uL�����I�F8@A���wAdž�H�D$@H�<$I�F8���A���I���wH���[�f�����NI���H���H�|$$�t����������H�|$0�B��H�|$(��H�D$HdH3%(�vH��X[]A\A]A^A_�D�[����u�H�|$(�M���9���H�D$0�j���fDL��`H�l$@H��L��������L��x1��lH�t9
L���D�������L���$���H������H���H�S`I��$�H�CXH����I�t$I��I��H��H���������H�����H����
������H���:�H�\$(�A���I���Adž�H����������@�����L���@��}���L��H��9
������H�|$������+H�D$0�@PtH�D$(��H�|$���H�|$(�����z�����tH�|$(H��`�H$9��r��H�|$(����#������u��J��H��H�D$0����D�����fD1�H�=_�����I�F8I������H�|$(H�|$@D��H�l$@H��A��A���d�������E�������H�|$(�������S���f������n���fDH�
�3	�lL��1�H�5P7
������fDH��H��1I��H�8�c�������fDA�Fl���nL�����L�����H�|$�R������h����қ��D���������H�|$(���@������H�T$81�H�|$(H�5F;
�����|$ ������D$ H�
<
Hc�H�>��H�D$(��H�|$0H�I2
������H�D$(H��H�D$@D��A��A�������F���E���=���H�|$(���H�D$(��H�|$0H��1
���i���H�D$(H�|$0��H�P2
���5���y���H�D$(H�|$0��H�G7
������R���H�|$0H�77
������7���I���H���š�����@�u���鰚��H��x�~�H�l5
H���<�������L�L$@L�C �~1�H�
�o	H�5>5
H��莲��H�|$(H�5%I	���� ���H��x���H�5
H���ػ����tyH����x��H�
�5
��H��I��H�5�4
1��(����H��x�h�H��4
H��膻����t9L�D$@�hH��1�H�
Fl	H�5�4
����M���H���C����@����	���H���1����.������?���f���UH��SH��H��(dH�%(H�D$1�H�H�pXH��t
H�H���H�H`H��t
H�H��H�P<H�@XH�@`H�@<����H�t$H�5|5
H�L$H�$�A��H��H���H�D$dH3%(uH��([]��M���ff.�f���ATUSH��pH��tH��[]A\�@H��hH��I��H��hH��p��H���tH���L���w�H���H���tH���L���W�H���H���tH���L���G���H���H���H��tL����H���H��tL������HǃpH��[]A\�D��H��1H�0�M���f.���H�H�H�2H�8�+��ff.�U1�SH��H��H�w8H�H�FH�s@��tQH�.H�5|	H�EH��{�H�E��H�8���H�=,9
H��1��Y��H�{H��[H��]�׿���H��H�5�8
[]龿��ff.���AVI��AUI��ATI��H��UH��SH��dH�%(H�D$1�H��PH�E�HH��P� H��H�����H�$H��H�(L�`L�pL�h ���H�C@��H�5r8
H�C8I�|$xH�$�I�H�5�1H�CH�$H�x���H�<$���I��$�I��$�H�����H�$H�L$dH3%(u
H��[]A\A]A^�蚶��f.���ATUSH�/H����H�H�]1���H��7
H��蛷������H���{���H�E(H��tH�}0��H�E(H�E8H�L�`I�L9�tH�L�EH�I���H�H�WH�H9�t!H;��H���
DH9tkH��H9�u�H��I9�u�H�}�@��H�EH��tH�[H��]A\H�@���[]A\�H�
�
��H��1�H�5�6
�[����;���fDH)�H����I���H��H�����I9��:����|���D1���ff.����H�����H��H�G81�H�H�@H�w@�������H�H�H���@��H�G����AWAVAUATI��USH��H��HdH�%(H�D$81����t</�;H�kL�t$L�;L�l$ H�L$H�\���L��H�D$(H���L�d$ L�l$蚙������H���H���1ҋ|$H�FH��H9��]���H��H�H�H�D$ H�x�G���H�XH�S@L��H�{8�O�H�C81�H�@H�s@��t|H�D$8dH3%(uyH��H[]A\A]A^A_�DI��L���PL��L��H�D$H�D$�5�H�T$H�H���L��t$H���H���/���H�D$�R���DH���h����w����~���L�5
H�
�5
1���H�5�4
H�=���v���fD��AVAUATUSH��0dH�%(H�D$(1�H����H�H��H��I��H�I��H�D$H�L$H�t$H���H�t$H�����H�D$H�D$��������D$��t[H���H����x�1�H�FH��H9��	���H��H�H��H�,H�l$L�uL�����A�<uL���װ���</�}�����H�\$(dH3%(uuH��0[]A\A]A^�H���H���1ҋ|$H�FH��H9������H��H�H�,H���I�E�H�UH���8���I�$�fDH�DI�E1����ޱ��ff.���USH��(dH�%(H�D$1��G����w#1�H�L$dH3%(��H��([]�fDH�GH��H�L$H���H�T$H�p8�����x�H�D$1��H��2
H�hH��脲����tXH���X��H�
3
�H��I��H�5�2
1����H�T$H�BH���o���H�z H��H�T$�и�E���fDH���������ٰ��f���H�w(H�W0���ATUH��SH�H�=w3
H�H����H��(裬����I��H�L��PL� H�uH��H��t	�>�:H�uH��t	�>�H�uH��tH�;����H�C�E�H�53
�C �E��Dº6�C$�oE C(�oM0K8H�E@H�CHH�EHH�CPH�EPH�CX�E`�ChH�}X�7��H�5�1H�CxH�����u`H�{x�W���H�{xH�5�2
�׷�����L�� H�����H������L�� Hǃ�H���H���������Hǃ�H���H��[]A\ÐL����H�CH�uH��������f�L����H�C���ff.�@��AUATUSH��L�'dH�%(H�D$1�H�I��$���I��$�H�H�hH�H9�tI��H�L��H��H�$���H9�u�I��$�1�H�@I��$�������I��$�t
I��$�����I�|$x����I�$H��t	H�L��PH�D$dH3%(uH��[]A\A]��6���fD��SH���H�H��t@H������H�[H��u�[�D��H������H�8H��tSDH�_����H��H��u�[�D����SH��dH�%(H�D$1�H�GH��t
H���t1�H�L$dH3%(u=H��[�@H��H��H���H���#����y�H�4$H�=�*	1�����H�����@�����H�=�1�����H�=�1頯��ATI��UH��SH��0dH�%(H�D$(1�H�\$H��腟��H��H�����H��~I�<$H��H��t!���H�D$(dH3%(u$H��0[]A\�H�D$�>��H�t$H��I�$��蛬��ff.���H����X���2�������XH���ff.�U� H��H��SH�5�/
H�����H�5�|1H��H����H�uH�=r/
1����H��H���4���H��H��[]�f.�ATI��1�UH��SH�?����H��H�EH�hH�H9�u�'�H��H9�tH�;L�������u�H��[]A\�1�H��[]A\�fD��H��	H��H�|7t�DH�|7����ff.���H��H�|$H�=�1H��tH��1H�t$�v��H��Ð�H�=�1��f�H��H�ev1�@H�����H�8�~��H�=Gr1H���1H���1�p�H�=as1�d�H�=�u1�X�H�=9u1�L�H�=�t1�@�H�=u1�4�H�=�s1�(�H�=a���H�������AUI��ATUSH��H�,�1H��tWH�L�`I�L9�u�6fDH��I9�t'H�+L��H�}�H����u�H��H��[]A\A]�fDH��1�[H��]A\A]����H�ċ1�f���H���� ���ۊ������ H���ff.����H�����H�G�����
f.�H��H�H��u�H�G�����f.��G@	�!ЉG@H�H��u��ff.�����g0f���H�ht�@SH�pH���J����H�=�,
�@�����H��H�ChH�����H�CxH�Cp[����AVAUATUH��SH��dH�%(H�D$1�H�h��H�=<,
�����D$�]����@H��H�����H�}pI��H�L�oI�L9�tLL�5,
��H��I9�t/H�3�L�������u�H�޺L��H���}��I9�u�H�}p1��=���H�}xH�}p�m���1�H�����L���m���H�|$�Ӓ�����<���H�D$dH3%(uH��[]A\A]A^�fD������ܧ��ff.����AUI��ATI��USH��H�����H�{pL�����H��H��t H�{hL�����H�EH��[]A\A]�DH�sxH�{p����H�Sx1�H��H��貲��H�{hL������H�E���H�?t&H���=���H��tH�@H����1�H��Ð1��ff.�f���ATUSH��dH�%(H�D$1�H���z���I��H���F���H�GH��H�xptVH�=h*
H������H��H��L��D$H�E�Pp�H�= *
H�������t��XH�|$�C������2���H�D$dH3%(u	H��[]A\��]���ff.�f���AWAVAUATUSH��dH�%(H�D$1�H��� �����A��%�=����H��H�=�)
I��I�����E��A���D$�U8H�}L��H�hH��D�p@�v���H��H�5�)
H�C(H����H�{(H��H�5t)
�ݲ��D��H��D���L��U@H�|$�Q������N������H�H���H�CH��tH�H���L��H�5%)
H�����H��H�L$dH3%(uH��[]A\A]A^A_��(��������H��H������ff.���H�W���tO��SH��H��H�H���u[�fDH��H��H���H�������Hǃ�[���ff.�@ATUSH��dH�%(H�D$1���X�Ć��H�GH�������t
����H�=2(
�C���H��@���D$H�C���H�|$A��������d���E��u,@���.���H�L$dH3%(D��uAH��[]A\���H�������X�ƒ�H�{ ��Xu���X�貣���.���ff.�f�SH�G H9�;���H�������H�G H��H9��r���H�H� �i��1�H���������(���[�D��H�GH�@XH��t��DH�G0���ATUSH��0H�/dH�%(H�D$(1�H���A�o�H�� )D$���6���H��� ���� ������H������H���"���H�E H��tH���H���;��H������H��m1H��(H�;H��t	H��P H�;H��0HDž(H��t	H��P H�;H��HDž0H��tH��P H���L��HHDžf.�H�;tH���"���H��L9�u�H�=H&
���H��D$�U(H�|$虌�����j���H�|$�w���H�D$(dH3%(u	H��0[]A\�詡���������H�uH�=�)
H��1�詄��f���AWI��AVI��AUATI��USH��H��hL�D$L�l$ dH�%(H�D$X1����H��H�����U�(H�����I��H�D$ǀ �CHA����CIA���H�6l1H�8�^��IdžPI��HL�t$H�s@I�~�j�I���H�D$���H����;���H�=r%
��L��H��L���D$H�|$�U����1�H�|$薐�����TH�;H�l$��H��(H�{H�l$��H�T$H�5�#
H��0I�$H����Y���H�s0H�{H�}$
I�$H��HD�H����H��1�1�H�5д	�#���H��1�H�L$XdH3%(��H��h[]A\A]A^A_��H�|$L���ӏ������H�uH�T$ H�=��	1��$�H�L$H�|$H��r��������1�H�=I$
1�蘵��H��1��p���f.�H�=�#
�D�_�-L���D$���H�=�#
H��1���H�=ր1f�L��H��H�5�#
H��#
D$(H��AEI�E(H�D$ �D$H�J���H��H���1���H�=��1H������H��H��t;�_�-L���B���H�=G#
H��1��!�H��H�����H��tH�����H�=B����H�|$�#���������L�����H��H������L��H�=�"
1����H�L$H�������:����������鼁��D��AVI��AUI��ATI��H�5�"
UH�-βSH���%��H��tH��H��H�h�A��H��M��L��L��H��H��[]A\A]A^���f�������AWI��AVAUI��ATL�%M!
USH��H��H�t$�.H�5e"
H���Y�I��H��u*H�����H��H������L��H���2�H��H��t�E1�H�|$L������H���҄���8I��t1��SH�O 
L���D�������L���$���H��u�f.�H��H�EH��u�L�m8M����H��L��輵�����A�$��'�w��YH��g1L��H�8H��P H�]8H��[]A\A]A^A_�f.�1�I��H�
<D
L��SH�5�
� ��H���j���M������I�n@H��t{H��H���*������PI�F�{�H�P
H���H���>������<M�N M�F@�{H��H�
G$
H�5
1�葓��H�
g1I�n@H�8H����I�^@H��[]A\A]A^A_����Y����L�u(�d�H��
L��趜������H���֮��M��dL��I��H�
�#
H�5�
1�����L�m8A�$���'w�H��H��H�Ѓ���Y��	Ј�YM���b����p���D��Y���~��A�$��'v�����Y�E���H�f1H�8H�H��P ����H���������L���Փ��L�m8�]���ff.����H�G����H�G(�����
f.�H��H�GH��u�H�G8��Y�H�i
H��HD��f.���UH��SH��H��dH�%(H�D$1���X�u+����XH�G���H�G���t
��:�H�=
���H��H�߉D$H�C���H�|$���n�������}���H��������H�T$dH3%(uH��[]��{���ff.���SH��dH�%(H�D$1���X���}��H� H����}������XH�GH�=�
�����H�߉D$H�C���H�|$迃�����Z}��H�{ H���%}������H�C H�T$dH3%(uH��[��Ƙ��fD����"�f���UH��H��SH��H���H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H�{(H���$H��$��D$0H�D$H�D$ H�D$�n���H���f�H��H�BH��u�Y�H��H���B�H�D$dH3%(u
H���[]��×����SH��dH�%(H�D$1�H����H����X�O|��H� �l|��H�Pt	H�P�sy��H�{Ht	H�{H�cy��H���t3H����My��H���豏��H���H��
H��H��1��և��H�s`H��tH�Vb1H�8H��P H�CH�C`H�xPt,H�=t
���H�߉D$H�C�PPH�|$薁�����|����X��{��H�D$dH3%(uH��[�視��fD��SH��H�dH�%(H�D$1�H����H�C�������{��H�H����x��H�H��tzH�SH�PH�CH��tH�H�H�CH�CH�H�=�
�����H�߉D$H�C�PHH�|$轀�����d{��H�D$dH3%(u.H��[��H�SH�CH9��u�H���H�C�q���貕��f���USH��H����YuRH�{���H�{(���H�ChH��t
H�H�{h�PH�s8H��tH��`1H�8H��P H�C8H��[]�DH�o(�B�H�v
H���k�����t7H��菨��L�C8H��H�
�
I���BH�5E
1�軌���\���fDH�������I�����USH��H��H�H���Cz��H���n���H���Zz��H�{H��H��[]����ATI��UH��SH��H�wXH�w`H��tH��_1H�8H��P H�C`�}���L��H�C`�UH��[]A\���ff.����H�GH�@`H��t��DH�����USH��dH�%(H�D$1�H�����y��H�hH��tVH�=�
���H�-�_1H�߉D$H�EH����ShH�EH9����y��Hǃ�H�|$�`~������y��H�D$dH3%(uH��[]��|���ff.����AUATI��USH��H��HdH�%(H�D$81���X�u+����XH�G���H�G���t
��v�H�{HH���1��X�Oy��H�=�
L�l$���H��L��D$H�C���L��H�D$�}�����=y��H�l$�E���"H�C������C@�@���E��H�kHH������H�|$�C@ uL�d$�GtX��X�H��H�5���b���H�\$H�L$8dH3%(H���\H��H[]A\A]�H�t$螀��H���-H�|$1�L��L��������%x��Hc�H�|$H��y�1��6��H�|$�t���@H��������1�H��H������m���f.�� �����E����������H�߾����H�\$�,���f�H�CH�l$ L��H�l$ H�D$(H��H��跲��H�|$ H�D$����H�|$H����x��H���#s��H�l$���f�H��H��赳��H�|$H���r��H�l$�M���fDH�{�O������Ր��D��SH��H��dH�%(H�D$1�H��tJH�=�
��H�߉D$��H�|$���E{�����w��H�T$dH3%(��uH��[�DH�?1�H��t���������H������ATI��U��SH��H�=C
H��dH�%(H�D$1���H��L���D$H�C���H�|$���z�����}v��H�L$dH3%(��u	H��[]A\��Ə��fD��SH��H�dH�%(H�D$1�H��t9H�H�=�
��H�߉D$H�H�@���H�|$�.z�����v��H�D$dH3%(uH��[��K���ff.���USH��H�=f
H��dH�%(H�D$1���1�H�މD$H�C���H�|$���y������u����y
�v���8t*�H�������X�@u2H�C�����X�H�T$dH3%(��uH��[]���࿈�X��舎�����USH��dH�%(H�D$1�H�FH9G�'u�����H��H��t
�	H����H�=�
�0�H��H�މD$H�E���H�|$����x������t����y
�u���8tH�C�	H�߃���"��H�T$dH3%(��uH��[]��č��@��USH��dH�%(H�D$1���X��t��H�GH�����t
�
���H�=�
�s�H�߉D$H�C���H�|$���x�����Et����y
�t���8tH�C�
H�߃���h���H�T$dH3%(��uH��[]��
���f.���AVI��AUI��ATA��UH��SH��0dH�%(H�D$(1�H�
U1���o)D$�3��������H�����H�=
���D$���L��H�hH��D�`(���H�}L��H�C ��H��H�5
H�CH���z���H�{H��H�50
�g���H��D��L���H�|$��v�����ks��foL$H�K0H���H�CH��tH�H���H��H�L$(dH3%(ucH��0[]A\A]A^�H�|$�N~��H�������H��V1�`H�8H��PH��H�h�y�����#�����������r���p�������H��H������ff.���H�wPH�WX����GH����USH��dH�%(H�D$1�H�GH�����H��H�=|
���H�߉D$H�C���H�|$H���u�����2r��H�{0t!H��t;H�CH�s0H��@���H�C0H�T$dH3%(H��uH��[]�DH�������t�1����s�����H����@��ATI��UH��S��H���H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1����Xq���q��H��L��H��H��$�H�D$H�D$ H�D$�$�D$0��H�D$dH3%(uH���[]A\�苉��ff.���ATUH��SH��H��dH�%(H�D$1�H�GH�xx����XA��tpH�=�
�4��H��H��D��D$H�C�PxH�|$����s������p����y
�p���8t
�H���1���H�T$dH3%(���~H��[]A\�f���u�@��u����X���H�G����d����H������R���f�H�ptH��p1�H��H�(�_1������H��
�����l����X������H��1����f���UH��SH��H��dH�%(H�D$1�H������������xH�<$H�����1�H�H����H�L$dH3%(��uH��[]��ڇ��f.���SH��H��dH�%(H�D$1�H���G������Fo��H�<$H�����H�L$dH3%(uH��[��x������USH��H��H�H9G t	H����H�C H9��!o��H�H�{ H�����K���H�{ �"������~)H�S H�CH��H�H��H��[]�i�f���n��H�{ �1���H�{ H���E��H�S H�{(I��H��1��rH����F~��1��f�H��H�߾[]�
�L�^
H�
�
1��}H�5�	
H�=��i��D��USH��H��H�WdH�%(H�D$1�H�������XH���tkH�=�
�'��H��H�߉D$H�C���H�|$����p�����n����y
�m���8t
�H���$���H�L$dH3%(��u^H��[]��u�� u��� ��X���H�G����l��������]���H�(�_�����H�!
�}����o���ff.�@��USH��H��dH�%(H��$�1�H�GH��������t
��x��H�=�
���H�߉D$H�C���H�|$���o������l����y
�l���8tH�C�H�߃������H��$�dH3%(��u1H�ĸ[]�f�H�t$��ѷ����t��8l��1�8@�����v���fD��ATI��USH��H��H�WdH�%(H��$�1�H������X�u3�u/� u+�� ��X���H�G���t��\��@H�=�

����H��L��D$H�C��H�|$���n������k����y
�kk���8t
�H�����H��$�dH3%(��u4H�İ[]A\��H�t$�����豶����x�H�D$ 1�I�$��[���ff.���USH��dH�%(H�D$1�H�GH;F�ek��H���H�������H��t
�H���^��H�=�	
����H��H�މD$H�E���H�|$���m������j����y
�qj���8t*�H�������X�@u4H�C�����X�H�L$dH3%(��u9H��[]�f��࿈�X��H�(�_1������H�6	
��y����B���f���ATUSH�� H�dH�%(H�D$1�H���`H�CH�SH�H��H�D$H�H���H�KH�HH�CH��tH�H�H�CH�H����H�=�
���H�߉D$H�C��H�|$A���Wl������i��E����H�-�L1H�s@H�}H��t
H��P H�}H�s H�C@H��t
H��P H�}H�C H�H��P H�|$袪��H�T$dH3%(D��uoH�� []A\�fDH�|$H�
�_1�A������x��H�{@�y���H�E�Z���H�CH9�����H���H�C�����E1��~���諀��ff.���UH��SH��H���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1���g�������h��H��H��H���$H��$��D$0H�D$H�D$ H�D$�K�H�D$dH3%(u
H���[]�����ff.����H�(H��	
�1��5w��D��AUATUSH��(dH�%(H�D$1�H���h��H��H�PI��I��H����I�L$�H�T$H�t$����Hc�H����yH�}P�G��uFL9d$L��H�t$L��HF\$H���Ȟ��H�}P�a��H�L$dH3%(H��upH��([]A\A]Ð�c��H�}PI��迟��H�UPH�}(M��H��1��rH���Pv���fDH��H�r�|���H��H�EP�=���H��H������1����}����~�����ATI��UH��SH��H����XdH�%(H�D$1�H�G��u+����X���H�G���t����H�CH���tvH�=F
�
��H��H��L��D$H�C���H�|$H���h������f����y
�e���8t
�H������Hc�H�T$dH3%(u H��[]A\��L��H��H���bm�����}��ff.���AUATUSH��H��dH�%(H�D$1���XufI��H������H��L��H��H�$�I��H��xMH9���e��H��H���@��H�H��tw��X�H��?H�L$dH3%(uuH��[]A\A]��{v��H����d��H�<$H��D� �#���H�<$I���7u��H��M��H��H��H�z�1��]m��D�e������H���:�����X������{����|��@��ATI��UH��SH��H��dH�%(H�D$1�H�GH��������t
����H�=�
�*��H��H��L��D$H�C���H�|$����f������d����y
�c���8t#H�C�H�߃��H�CL������H�L$dH3%(��uH��[]A\�蛐�������{��f���ATUSH���H��X@H���~H9�t	H����H���H���H������|������w!����H���٦��[�����]A\������H����o�`���H���I���qs��H���M��H��H��H���1��k���b��H����(��\��[�����]A\�fDH����c��H���?t����~:Hǃ�1�[]A\�f�H����\��H���H�������Ƹ����[]A\��H����_��H���H���%���H���I��H��H��H�Z�1���j����a��H���H����R��
\��������H���� 进��H��H����p��H���H��H����q���L��
H�
|
1��OH�5�	H�=/���\��f���AUI��ATU1�SH��(dH�%(H�D$1�H��H�H�$L�cH�H�D$H�H�D$���I�|�0H��t�υ��H�H��I9�u�H�T$dH3%(H��uH��([]A\A]��y����UH��S1�H��(H�PdH�%(H�D$1��D$
H�H�D$H��t�\���H��H�}pH��t�K���H�H���H��t�7���H�H�T$dH3%(H��uH��([]��ux��D��H�GI��H�w(	�L��H�8�D���@��H�GI��H�w��L��H�8�Ԝ��@��H����@���`�fD����fD��UH��H��`SH��dH�%(H�D$1�H���7���Å�x!H�T$dH3%(��u,H��[]��H�}H�$�1�H�B
�%o�����w��ff.���H��(H�`dH�%(H�D$1�H�T$H�t$��d����t!H�D$H�L$dH3%(uH��(��1����'w�����UH��H��SH��(H�_dH�%(H�L$1�H��`H��H��t
1�1��t���H�UH��(f�1�H��H��XD$H�$H�����H�E`H�D$dH3%(uH��([]��v�����H��H��A1�pH�8H��P�KH��1�H���H�H�� 
H�BH�����H�BH��H�BH��H�B(H����H�B0H�%	H�B8H�zH�B@H�?H�BHH�|@1H�BpH���H���H�KH���H��H���H�?H���H��H���H�A1H���H�UH���H�gH���H�i���H���H�����H���H�m���H��H��H���ff.���SH��f�H��0dH�%(H�D$(1�H�GH�t$D$H��(H��XH�T$�*~��H��hH��H�$�z��H�t$H��芺����x1�H�L$(dH3%(u)H��0[�H�{(H�L$1��H�g
�Bl����������t��fD��ATUSH��0dH�%(H�D$(1�����]������]��H��H�o��tVH��`�ʩ��H�C0H��`H��`H��t{H��1�1��Y��H��hH�D$(dH3%(ubH��0[]A\��L�d$H�t$L���q��L���6��H�t$H��`H��1�H��H�5���F]��H�C0�w���DH���0�����s��f���SH��XH��tH��X肠��H��>1H��[H�8H�H�@ ��ff.���AVI��AUI��ATUH���:SH��H��H��0dH�%(H�D$(1��gv��H����H��H��L�`菴���H�=d�H���������t|�H�=
H����€���uqǃhI�FH�L$H�t$L��H��XH�D$I�F@H�D$����xt1�H�\$(dH3%(��H��0[]A\A]A^�Dǃh�@�H�=��	H����€���uEǃh�o���H�K�	I�E������H�T$H��H�=l�	1����I�E������j���H��H�=1�	1����I�E������K�����q��@SH��0dH�%(H�D$(1�H��pt!1�H�t$(dH34%(��H��0[�DH�GH��f�H�t$H��hL�L$D$L��pH��(H�T$H��`H��X�i������H��hH�{(u 1�H��	���h��������l���L�D$1��H�}�	�h��������G����q�����UH��H�~H��H��S1�H��H)������H��H�Hdž��H�H��������xH��p�o��H�C01�H��[]ø������fD��USH��H�������x:H��pH����n��H��H������H��H��hH���W��H��H��[]�@H�����H����W��H��H�5
�81��~��H������SH� ��Y��H��H��`��謊��H��xH��荊��H��hH�C H��[�Y���f���SH� �gY��H�����H��`H��tH�H��`[H�@��[�fD��AUATU��SH��H�� H��L�g�dH�%(H�D$x1��=g�������@��u#H�L$xdH3%(�H�Ĉ[]A\A]ÐL�kf�H�{pH�5��	D$I��(H�D$臵��H��H��t=H��`H���`���H��`H�C0I��`H����1�H��1��IT��H��hI��$XH�t$��w��H�$A��$h����������H��xL�d$0H���������H�PH��H��H��H��H�<��V��f�L��1�H��H��xI��H�0H�PD$<A�D$<H�|91AD$AD$,H�D$0�D$8H�D$@�����M���H��L��蒛��H���:a��H��hH�<$H���צ��H�t$H���j����¸���h���H�{(H�L$1��H�T�	�/e��������B���DH��x��H��xH�@H�|�k��H��H��xH��H�PH�0�j���[���DH��谢���r����6m��fD��H��H�a81�hH�8H��PH���ff.���S��H�=��	�h����H��H�H��PH��`[���H��H��tH��71H�8H��` @�ff.�@��H��`��Xt	��Xu�β��fD�����AUATUH��SH��H��(dH�%(H�D$1�H��`��X��H�����H��xH����H�|$蠔��H�|$H�T$�����Lc�M����H�|$��M��M����H�{H��������x]H�D$H�E01�H�L$dH3%(�"H��([]A\A]�H��מ����x1L�e0L���M9���M)�1�L�e0�@�S���8�1U��������H�菞���DH�߾ ����H��H�D$�#���H���~��H�{(�H���	H��1��b��������@���H�|$�O��H��H���]~��H�T$H�{(I��H��1��rH����]b��H�|$��L���\���H���&~��H�{(M��M��H��H���	1���&b������������j�����H��H��51�`H�8H��P�KH��1�H���H�H���	H�BH�����H�BH��H�BH�[���H�B(H��H�B0H��H�B8H��H�B@H�OH�BHH�H�BPH��31H�BXH��41H�B`H��21H�BhH��H�BpH�
H�BxH�BH���H�H���H�v	H���H�8	H���H��H���H�lH���H�v31H���H��41H���H��11H���H����H���H�����H���H��21H���H��21H���H��21H���H��41H���H��01H���H��31H��H�441H��H��H���D��ATI��USH��H��dH�%(H�D$1�H��`��X�����t1H��p1�I�$H�L$dH3%(��H��[]A\�f.���u�H��xH��u1�}D���u�H��x�@�R��H�{�u���H��x�J��H��H��t�H���uH��x�G��uU����_�����Q��H��_����S���f.�H�t$�H����s��H���$������&����g���3L��H��xI���T���H��xH�{(M��H��1��rH�����^�������ff.���SH��`H��I��Xt�!H�=��	�������u
H�{L��[�P���H��L���E���ƃ�[�ff.����SH��H��x��H��H��h�0I��H�{[�&I��fD��USH��H��H�GH9�htH��h���H������H���V���H�-�11H�s0H�}H��t
H��P H�}H�C0H�H��H�@ H��[]��ff.���AVAUA��ATI��U��SH��L�wH���]�����p��L��L��`E��H��H�C0A��D���J��H��`H�C��Xu!H��hH��[]A\A]A^銽��f.�A�� A	�u�D��1�L��H�߀ɠ��I��H��h�ff.���SH��H�?�p����Xt����[�ff.�@��AVAUI��ATUS�>t|H��H���:I��H���Vh��H�5�yI��H��tH��H���|���I�t$H��M��H��L��H���C�����x'H�}�o��1ҨuƅX[��]A\A]A^�fD�������H�q�	�����H���ff.�@AUATUH��SH��H�L�oI�L9�t_L�%��	DH��L��H�������t1H��H��褳���:H��跈��H�sH��苳���
H��螈��H��I9�u�H��H��
[]A\A]�~���ff.���ATU��SH��H��@H�W dH�%(H�D$81�H���H��tH9���H� �MX��H���H���@��u*H����H���WN��H���H��虨�������� f�H��t{H���	N��H�{H���肯��H�L$8dH3%(��H��@[]A\�DH�G H���@��u��f.�H����M��H�����Z��������@H���GH�:uƃ�H���� 詪�����H��H�D$uXH�{�O���H�t$H���H������H���H�8��H�{H���誮��H�|$�D$�|D���D$����H�D$H���H����H�x��H�{pH�����H���H�pH�8衴��H���H��H�D$ �m���H�����H��H�l$ ���H��H�D$0H�D$(����H��I����C��H�}��C��H�|$L�d$H���H�@H����C����f�H�{�7[���@���f��@���������K��H��1��l��H����*���H��,1�H�8����H����
����Ua��D��ATUSH��L�g ��7���H�{pH��H�����H�UL��H���H�u�!���H��xH9E��K��ƃ�[]A\�fDL��蘑��ƃ�[]A\�ff.����SH� ��K��H��`H����XuH��4���H���H�C [���s��H�S�H��H���#U��H��H�5���H���H���j���H�C [�@��H��`��Xt�'u���H�駞�����SH��H��dH�%(H�D$1�H��`��X��H��xH��t4�o���H��x1��!���H��xH�L$dH3%(ueH��[�@H��h�t���H��H�5JH��H�$�NS��H��H��x�A��H��x����H��x�f.�H��'�����P_����ATUH��SH��dH�%(H�D$1�H��t|H��H�=��	I������H�߉D$�~B��H��膓��L��H���kB��H���s���H��H��H���5���H�|$�I�����
J��H�D$dH3%(uH��[]A\�f.�Ƃ����^��f���H��`��Xt�WN���H���j�����H��`��XuH��#c��H��h�c��@��H��H�q)1��H�8H��PH���f.�@��H��H��tH�=)1H�8H��` @�ff.�@���Gh��t��t@���GhSH�G`H��H�WPH�PPH�WXH�G`H�PXH�`�f��H�S`�RH�SH[��1��ff.�f���H��H��(1�HH�8H��P�KH��1�H���H�H���	H�BH�����H�BH�6H�BH����H�B(H�H�B0H��
H�B8H��H�B@H�OH�BHH�|(1H�BPH��&1H�BXH��'1H�B`H��%1H�BhH�%1H�BpH�=	H�BxH�2
H���H��H���H�6H���H�HH���H�ZH���H��H���H�.	H���H��G��H���H��H���H�dH���H��H���H�xH���H�*H���H��H���H�
H���H����H���H��H��H��H��H��H���D��USH��H���~���H�-�&1H�s0H�}H��t
H��P H�}H�C0H�H��H�@ H��[]��fD��AUA��ATA��UH��SH��H��H��莢��D��D��H��H�C0H���Y?��H�CH��[]A\A]�f.���H�?�e��@��AWAVAUATUH���:SH��H��H��XH�T$H�L$dH�%(H�D$H1���]��H���qH��H��L�xI������H�5��H����l��H�(I��H���xL�|$ L�t$(fD�=H���]��H����H��L�`H�ƽ辛��L�|$@L��L��I����i����x	�|$@d@��1�L�|$H�=��	M��I����H�ɱ0J�<�L��D�d$�r�����XI��I��uֹL��H�=g�M���L�|$�������H�=��	L��������R��-L���\��I��H����H��L�����H�t$8H���^������I�~L���^������H�D$8H�T$@H9���H��H���H���I��I�mH�������L�|$ L�t$(A�~���:L���(\��H�5�mH��H��tH��L���N���H�uI��L�D$H�T$H��L��������H�T$HdH3%(�}H��X[]A\A]A^A_�@@�����l$�D$@���X�P���H�1�	H��H�=��	1���H�T$H������뒐�H�=\�	L����������H�=J�	L�������ux��q���fD@��uC�L$@H��XH�����H��H9�u����H�t$8L���#]����xOH�D$8H�����f�H���	�C���@��	���fDL��H�=��	1���������f.�H�%�	����@H��_	��@H�D$H��	H���������H�D$H�*�	H�������o����)W��f�U��SH��H����X��u
1�H��[]Ðk�dH���E���9�Xr�1�H�$�	�H���gN�����U��SH��H����/ptƄ+pH��1�[]�f.���H�H�s(��l�����t�H��[]ÐATA��UH��S�Ӆ�t
�>���8t H�u(H�}�ٺ�2�����uƄpD��[]A\�A�������fD��UH���SH��H���F�����u"H�{H���f��H��H�ߺ[��]�q����H�������[]�@��S�
H�������uH�{衔��H�ߺ
[���1���������[�f���UH��SH��	H��H�������u'H�sH�}�Rn��H��H�ߺ	[��]����DH�������[]�ff.����UH��SH��H��H���S�����u?H�sH��t&H�}�=����H��H�ߺ[]�x����H���h�������@H�������[]�@��UH���SH��H�������u"H�{H�����H��H�ߺ[��]�����H�������[]�@��S�H�������uH�{����H�ߺ[������������[�f���ATI��UH���SH���U�����u)H�{L��H��蒒��H�ߺ[��]A\�����[�����]A\�ff.���ATI��UH��SH�������u1H�}H��L���`���H���H���������x	Hc�[]A\ÐH����������ATI��U���SH�������u"H�{L�������H�ߺ[��]A\����[�����]A\�fD��AT�I�ԺU��SH��H�w(H������uH�{L��[��]A\�C]��[�����]A\�fD��USH��H��`H��dH�%(H�D$1�H���wx���Ņ�x!�{ht3H�L$dH3%(��u?H��[]�f�H�{H�$H�5Y�	1�誧����H�{�1������H���	��I����UR��DAUI��ATUH��S�Ӻ��H������A�Ą�uH��D��[]A\A]�DI�D�H���H���9��Z=����)��C����H�EH��D��[]A\A]�ff.�@��SH��H��dH�%(H�D$1�菑��H�sH�{H��H�C`��F�����t	�$���ChH�D$dH3%(uH��[��nQ��ff.���SH��H�� H�dH�%(H�D$1��s��H�s(H�{H�L$�H�D$������u#H�\$H�T$dH3%(H��u5H�� [�DH�|$H�t$�H�
"�	���H�|$H����2�����P��f���ATUH���SH�G H��H��t5A��H;��t9H� � E��E��tTH�s(H�{���T�����uH�{H��[]A\逜��H�G ��H�{1�H���	H����@�������[]A\�H��H���<����������D��SH��dH�%(H�D$1�H� ��;��H��H�耜��H�s(H�{H��H���������u(H���H�C H�D$dH3%(u*H��[��H���H�4$H���	�A���H�C ���O��fD��UH����SH��H��H�w(H��9�����t
H��[]�fDH�{H��H��[]�T��fD��H��H�a1��H�8H��PH���ff.���H��H�11�pH�8H��PH���f.�@��USH��H��H��XH�-�1H�}H��t
H��P H�}H��`HǃXH��t
H��P H�}H��hHǃ`H��t
H��P H�}HǃhH�H��H�@ H��[]������������f.���USH��H��H�hH��t	�^����x1�kp��u_H�s`H��tH�*1H�8H��P H�C`H����[]Ëkp�x5����t�(�������H�S`H�5��	H�{�Cp1��͢����F5����@��SH�GH��H��hH����1�1��c���8H�C`u+H��1H��H�:H��R H�C`H�=�苔��H�C`H���H��H�ChH��t[�@��4�����t�CpH�S`H�5�	1�H�{[�*���f.�H���8����x���ATH�5��	USH��L�gH��p�E���H��t{H�s0H��H��tH��1H�8H��P H�C0H�����H��hH�C0H��tH��1H�8H��P H�C0HǃhI��$hH��tH��1�1��|b��H��h[]A\�H��舓����fD��SH�H��t	H��J��H�{t	H�{�h`��H�A1H��[H�8H�H�@ ������p���tH� t
�f�USH����H���Z����xǃp����H��[]�H�k(�p�H���	H����L����t'L��hH�
e+H��1��pH�5��	�#C��륐H���D���fD��USH��H� ��6����tH��������H�����H�-W1H��`H�}H��t
H��P H�}H��hHǃ`H��t
H��P H�}HǃhH�s0H��t
H��P H�}H�C0H�H��H�@ H��[]��@H��`H���j����2�����]���H�k(���H���	H���K����t2L��`H�
|�	H��1���H�5`�	�A������f�H���XC�������AWAVAUA��ATA��UH��SH��H��(L�wH��dH�%(H�D$1��FH��H��t�|�/H�p���A��tlH������H�C0I��hH����H��1�1���_��H��hD��tD��xǃp����H�D$dH3%(uuH��([]A\A]A^A_�fDI��L���G��L��荘��H�=��H��H��1��Il��H�C0I��hH���u���H���m����t����H��記��H���.����H��ff.���AWAVAUI��ATUH��SH��H��(H�z0H�L$dH�%(H�D$1�H���p���I��XH���F��I��pH�{(�ߏ��I��XH�5b�	H��I��`I��`H��I��hI��x�Z��H�I��H��trL�=��	H�-��	L�%��	��ADžxI��I�H��tC�H��L�������tӹ
H��H�������u=I��I�ADžxH��u�1�H�T$dH3%(��H��([]A\A]A^A_Ð�H��L�������uBI��hH��tH��1H�8H��P IDžhH�{躎��I��h�9���fD�
H��H�=��	�����uAƅ�������H��H�=��	�����uAƅ����f��	H�=o�	H�������uAƅ����f��H�=H�	H�������tf�H�==�	H�������ueH��H�t$H��������xs�D$%�A��|�L���H��H�=�	��H�T$H�������|���Aƅ�����H�=z�	���H��H�=��	1�趔��H�T$H�������@���H��H�=��	1�蓔��H�T$H����E��@��SH��pH�����tH� t#H��h��bk����x:1�[�f.���&s����y�H��hH�{(1�H�5`�	蹚����[�H��hH�{(1�H�5��
蛚�������[�@��SH��H��H��h�dH�%(H��$�1�H����j�����x!H��$�dH3%(��u8H�Ġ[��,��1҃8t�H��hH�{(H�5<�
1�������������D��ff.�@��AWAVAUATUSH���L�odH�%(H��$�1�H�h��H��L�%"�*,��H���H�D$ H�$H�D$H�D$�@�C(��fD�EH�{h�j��I��H���$M�w�L��L�������tʹL��H�=�~�����t�I��pI��XL���B-����t�A�G��tE<�u����C(�{���H��$�dH3%(L����H���[]A\A]A^A_�@H�=p�	脗��H�s`L��H�=,~�D$1����H�$�H��I���h����xs�C(�T$8H�|$A�ǁ����A��A����@DD���-������.��E�������O�����E��t�CpH�S`H�5��	1�H�{����E1�� ���H�$L����/B�����t���H�|$�}-�����m����.���B��ff.�AVI��AUI��ATL�%0}USH��H��dH�%(H��$�1���|H��H��H�޿��g����y\�)���8���/H����H��H��tH��H��葃��H���@�H��L���������t$L���f.��T$1���t
��A�UH��$�dH3%(u3H�Ġ[]A\A]A^��I�>1�H��H�5��
�̖���������A��UH��SH��/H��H��dH�%(H�D$1��H��H��tnH��H���ǂ��H�}H�L$H�u(H��H������¸������xE�t$H�߉��@�ƀE���@��0E���@��E��B#����t�(���8u$�H�L$dH3%(u+H��[]��H�}(1�H��H�5��	�����������@��ff.�@��AUATI��H��USH��H����H��hI��$h�P������(���8I���}����A�}u<1�H��hH�������xIH��hI��$h��������yKA�}u��u�H��hI�|$(H�5)�	1�I��$h� ���H�������[]A\A]Ã�tt��x�H��1�[]A\A]�fDH��h�.H�5��	�8m��H��hI��$h�t������0���ff.�f�AUATUSH��H��8H�odH�%(H�D$(1���xt
����	�����H���T��t��������H��hH��`1����A���&��I��E��yEA�<$H��h������H���E������UH��hH��`��藌����x�H��`A�,$��&�����>A�,$H��`H��tH��	1H�8H��P Hǃ`1�ƃ�ǃtH�L$(dH3%(��H��8[]A\A]�fD����H��hH��`謂����y���%��1�H��hI��A�<$u=��t8H���c�����xOH��hH��`���i������:���A�<$H��ht�H��`H�{(H��1�H�5�	�ג���������9���fDH��H���0��fo$H��`H��)D$�T�����(���H��`H�{(1�H�5��	�{��������������p�%�������H��hH�{(1�H�5�	�D��������@H�{(H��`H��1�H�5�	����H��`A�,$�$����yH��`H�{(H�5��	1����A�,$H�����H��`H��tH��1H�8H��P �Hǃ`���������H��`A�,$�$����y���]<��H��`H�{(H�5s�	1��t�������LH�=P�	�^3��ff.�AWAVAUATUSH��(��pL��hdH�%(H�D$1�����(����tH����wN1���uXL��1��|���ʼn�p�����1��������H�L$dH3%(�H��([]A\A]A^A_þ��t���@H�=��	�t����L�k�D$�b���H��`I���B'��L��h�/L�{(L����A��H���@L)�L��L��H���Oh��L���g.��H�{H�L$L��H���c������+�/L���^_��M��XL���?9��L��L��H���h��������t$L����N$��A�ƉD$������Y"��E1�I��A�?��A����L����-��H��H����������t$D��D��L��A����#���ƒ��t�L��T$�-��H��蓁���T$H��`��pH�|$��$�����&����p�X���DH�{(L��H�5�L	1��+�����p�3���H�{H�L$H��tL���8����������딋T$�l���L���-��H�{(H�5X�	H��1��֎���T$�e����9�����USH��H� ��%����tH��t7��p���t\1�H������`��H�C H��hH��H��[]�K��DH�q1��H�8��S��H���H���S��H�C ��H�������x��p���u��U%��@H���P��H��� ��H��H�5��	�81���z��H�C �j���ff.����ATI��UH��SH����p���tK��tL���t�_����x\H��H��[]A\���@��,��H��x>I9�uY1�H����[]A\�@H�t$������x㋝p�����$��H�t$�@H��hH�}(H�5	1�������2����H�}(I��H��h1�M�������H���	�g/���{���f���ATI��USH��h������y*�`��I��$h���t	������4�����	I�l$���uH��`I��$hugH��hu]�1�[]A\�f�H��H���x��H��`H��H��tH���.P����t�H��hH��tH���fm���<t�H���H4����u�/H���=��H��u��������'vLI�|$(H��H�5��	1�����i���f�I�D$(H��H�5��	H��1��׋��������?���DH��H���$����I��$hI�|$(1�H�5Z�	藋����������ff.�f���AUATI��USH��H��H��hH��h�z����yD����1�I��A�}H��hu=��t8H���p��xJH��hI��$h���uz����x�H��1�[]A\A]�@I��$hI�|$(H��1�H�5�	���H�������[]A\A]�f���ATf�I��USH��H��pdH�%(H�D$h1�H�GH�L$D$H�|$��x�D$�D$�����������uz)D$@H��1�H�|$0)D$P�t$@�L$X��H��h��)D$0�D$DX�C>���Ņ�����t0H�.1��H�8H��PfoL$H�T$ H�PI�$H�T$hdH3%(����H��p[]A\�fDL�A��pH��hH�L$��tNH��M��A��H��H�T$R��	=����XZ���d���H��hH�{(H�5N�	1�H�$�p����v���I��H���P�����@H��hH�{(H�5��	1��7����=����3��ff.�f�H��H� �� ��H��`�� ��1���p�tH������H�������UH��SH��H��dH�%(H�D$1������xw��p��:���D$���tCH��H�|$�f!��H��H��hH������H��H�L$dH3%(uYH��[]�f.�����H�5V�	�81��A��H���fDH���J��H�����H��H�5��	�81��}A��H�����2����ATI��UH��SH��������xq�����pu'H��L���F��H��H��x4H����H��[]A\�@ƃ�1�1���9��H��x/��p�H��hH�{(H�5�	1�臇���H������H��hH�{(H�5}�	1�H������\����f.���ATI��UH��S�������x��p�L��1�1��
C����x	��[]A\�f�L�e(���H���	L���3����t-L��hH�
�	L��1���H�5��	�Y)����L���*��또��USH��H�� H��@��tz�E)����t��w������H�=c�	�q(�����u;H���H��H�PH�0�u���H�����������H����[]�����H��[]�@��(����t��t��������u�H����D$�w���D$H��[]�@H���0���ff.����H��H��0�xH�8H��PH���ff.���H��H���0��H�8H��PH���ff.���H��H�q�0��H�8H��P�KH��1�H���H�H���	H�BH�����H�BH��H�BH��H�B(H���H�B0H�e���H�B8H���H�B@H�o�H�BHH���H�BPH�!�0H�BpH�~���H���H�����H���H����H���H����H���H����H���H����H���H�����H���H��H���H���H���H�0�H���H�r�H���H�����H���H�&���H���H�H���H���H�J�H���H��H���H���H��H��H���f.�D��1��f�����X�D��Ƈ��@��H�G0����H��hH��p�ff.�f����ff.���Ƈ���ff.�@��H�H��ƀ�H�8�0H�8H��` ff.�@��UH��SH���_xH�w`��H��tH���0H�8H��P H�E`H����[]���AWAVAUATI��USH��(H�GhH�_H��H�D$��+��H��`1�A�l$tH�D$H�AH��hH��D$9�����E�|$pM�t$`L�,�I�]L��L��H�������uk�/H���3��A�D$(u&H��t
�xtKH�XH��(H��[]A\A]A^A_�DH��t+H)�H�D$t!H9D$u:H�T$H�t$H��� ����u$@��I��A�l$t;l$�i���1��fDH��0H�t$H�8H��P H�t$H��I�D$h�
K��H��I�D$h�a�����USH��H��H�oH���s��H�C`H���*��H�=A�Cp�|s��H�5�0H��`H�ChH��[]�o\��ff.�@��U��SH��H�� H����#�����u?���u@��u!H��x1���6��H�������[]��H���[]�@H���8W��H��1�[]�ff.�@��USH��H���N���H��x���H�-��0H�s0H�}H��t
H��P H�}H�C0H�H��H�@ H��[]��f.���SH��H��`���H��tH�@�0H��[H�8H�H�@ ��[�ff.���ATA��U��SH��H���r���k@���H�C0H��0��D��`H�8�PE��@���H��x�f���[]A\��U�pSH��H�-��0H�}H��P�K�H�����H��1�H���H�H��
H�CH�����H�CH�����H�}H�CH�����H�C(H�z���H�C0H��H�C8H����H�C@H�i���H�CHH�^���H�CPH�c���H�CXH�h���H�C`H�}���H�ChH�H�CpH��H�CxH�l���H���H�NH���H�H���H�r���H���H�tH���H�F���H���H�(H���H�
H���H�<H���H�H���H��H���H��H���H�����H���H�F���H���H�����H���<L��HǃhH��`H��H��[]���H��H�������HLJ�H���f.���H�����u)���t1�H�����������������S���������f.���H�����H�������ug���tFH�~H��1�H�Hdž�H��H)�������H�H��xH�@H�F01�H���f��k����������fD�S�����������1S���������f.���SH� ����H��H��x1��_2��H��x��A��H�C [�ff.�f���USH��H����������H��tl���uKH��xH�pH�8���H��H�5F���H��H���5�����u�e�H���H��H��[]�DH���[]�7���H���[]�7����U�!I��SH��H�=`�	H�������u9H�s0H��H��tH���0H�8H��P H�C0H���m��H�C0H��[]�f�H��H��L��[]�`��ff.�@��H�����u7���u���H���f.��
��������H����sQ�������H���f�����u7UH��SH��H�����uD���u)�d}��H��p1�H�]H��[]�H��p1�H�:�fD�
�����������P���������f���H��H���0��H�8H��PH���ff.���H��H�Q�0��H�8H��PH���ff.������t1��U�H��SH��H��H��0Ƈ�H�8H��PH�EH�H���[]�D��H��H��L�5�
�@H�H������H�p�L����€���u�H���ff.�@��UH��SH���[��H���H��u����DH�[H��t!H���7��H��H���=����u�H��H��[]����f���USH��H��H����H���B7��H�}H���fW��H���H�ŀ�������Hǃ�us���tRH��x1��.��H��xH��x1�H������q��ƃ�1�H��[]��H�������
����������fD��
���������H���N�����������S���u"���uH������xƃ�1�[�f�H���hN�������[ø����[�f.���AWf�AVAUATUS��H��H��H�|$L�|$H��L�D$H�T$0L��dH�%(H��$�1�)D$0)D$@)D$P)D$`)D$p�S�������H�|$A�L�t$(H�l$ �Y��H�t$H�=B�	��X1�H�\$�p��H�������#H�5,�	H���k��H��H�D$ �nn��H�5�	H��H�D$(��n��H�|$ L����m������H�|$(t�H�5�	H�=��	�5)��H�|$ �������H�5��	H���U��I��ƀ�A���ƀ�H�|$ ��������I��$xH�x��H���p��H�5^�	�#H�����H��H�D$ �m��H�5A�	H��H�D$(�n��H��H�5&�	�T��H���
L��ƀ�H�|$ H��1��x��H��xH�x��H���p���\��H�t$1�H�=�	H�\$�!o��H���y���H�5��	H������H�5t�	H��H�D$ ��^�����DH�5/�	H�ߺ#���H�|$ H��H�D$(�������u
�����8t�EH�5V�	H�=L�	�'��H�5�	H���S��I��ƀ��@����8��H���Bo��H�|$(�Hl����x���I��$xH�x�[L���o��H���n���[��L���.Y��H��$�dH3%(��H�Ę[]A\A]A^A_�DH����n��H�|$ ������t���I��$xH�x�aH���n��H�5[�	�#H�����H��H�D$ �k��H�5>�	H��H�D$(�l��A����A�������H�5�	H�=u�	�`&���8����H�5�	H�=%�	�@&������*H�5ϴ	H�=]�	� &��I��$xH�x�9����+H�5��	H�=Z�	�%�������MH�5��	H�=��	��%������LH�5g�	H�=�Z�%���U����@H�5G�	H�=�	�%������/H�5'�	H�=ݴ	�x%�������&H�5�	H�=�	�X%������%H�5�	H�=�
�8%���O������f.�@��H��H��tH���0H�8H��` @�ff.�@��H��H���0�XH�8H��P�KH��1�H���H�H���	H�BH�����H�BH�v
H�BH�{���H�B(H���0H�B0H��H�B8H��H�B@H�H�BHH��H�BPH���0H�BXH���0H�B`H�{�0H�BhH���0H�BpH���0H�BxH�*�0H���H���0H���H��0H���H��H���H��H���H�l
H���H�F�0H���H���0H���H�z�0H���H��0H���H��0H���H�P�0H���H�:H���H���0H���H�f�0H���H� �0H��H��H��Ð��SH��H�=�	H��dH�%(H�D$1��xo��H�sH�߉D$��5��H�|$������:	��H�{�-Z��H�T$dH3%(uH��[��2��f�U1�SH��H���H��xdH�%(H��$�1�H�T$�n;����xZH�sH��p�����xnH�{H�t$ �N������H�T$�H�L$(H9JtH�{�Y�����jf.�1�H��$�dH3%(��H���[]�D�#�����t̃�t�H�k(���H�ϱ	H�������t6H��p��1��H�
�	��I��H�5��	H��1������u���DH��D$�4���D$�\���f.�H�k(���H�X�	H�������u_H�����H�{�X��������H�k(���H��	H��������t�H�{�<1��H�
]�	��I���M����H�{�1��H�
8�	��H��I��H�5˰	1�����{���f�H�k(���H���	H���c��������H�{��0��H�
�	��I���������f�AVAUATUSH��H��H�dH�%(H�D$1�H��x��L�w��q��H����/I��H���:��I��H��tH��H��L��H)�I�mH���E��I��hH��1�L��H�5�	�R��L�����1�1�H��H���w���H�{H��H�$������xCH��pH�<$�1������H���sg��H�D$dH3%(�!H��[]A\A]A^�f�����8H���OH�[(���H�G�	H�������tNH�<$�e/��H�
��	��H��I��H�5�	1��U���u����;����8u&H�<$�]V���]����H������H���H�k(���H�Ȯ	H���������H��p��.��H�
�	��H��I��H�5��	1������DH��p������������8����H�k(���H�N�	H���	������H��p�e.��H�
��	��H��I��H�5�	1��U���}���H�<$�gU����x3H�{H�4$�&������;������f�H����������}t�H�k(���H���	H���m����t>H�<$��-��H�
�	��H��I��H�5��	1��
���x���H��� ������H������[�������f���ATUSH��dH�%(H�D$1�H�GH����H��H��xH��I��H��t
�=����uaH�CL��H��H���S����xsH�=��	�gi��H�߉D$�k���H�|$�����1����7��H�L$dH3%(u<H��[]A\�@H��x�����t�H�������t�1��������������@��SH��H��x����H��p�@���H�{[�6���fD��USH��H��pH���d��H���i��H�-��0H���H�}H��t
H��P H�}H���Hǃ�H��t
H��P H�}Hǃ�H�s0H��t
H��P H�}H�C0H�H��H�@ H��[]��D��AVA��AUATI��U��SH��H�� L�oH��dH�%(H�D$1��9[��L��`H�C0��h����H�L$H�T$L��H����m����xkH�T$H�t$H�=[�	1��6��1�1�H��H���H������ H��pH���D5��H��xH���e���H���t_D���L��H������H�CH�D$dH3%(��H�� []A\A]A^�f.�H�{(H���	�_1��
��������8tEL�k(�s�H�^�	L�������t5L���H�
��	L��1��sH�53�	�q
��H��x�^���A���L��������������AVAUI��ATUS�>t|H��I���:I��H�����H�5?'H��H��tH��H���S��H�uH��M��L��L��H���C����x I�<$��������u01�[]A\A]A^�@�������f�H���	H��������H��H�=թ	1��n`��I�E��������USH��H��dH�%(H�D$1�@����H��xH� H���t�������H�{ H��t	H�{ ���H�{H���]����xNH�="�	�Ze��H�߉D$�^���H�|$�����¸���5���H�L$dH3%(uH��[]�fD������ܐH�tH����
V��H�{ ���������DH��x������L���H�{ �[��H��������3���H��H���U����q���������SH� �����H��H�H��t4�]��H��xH���H��tLH���6��H�s0H�C H��[��"��H���'��H�5�	�H��1��RR��H�s0H�C H��[�"���H�C H���d
��H�{ H�s0[�"��fD��H��H�1�0��H�8H��PH���f.�@��AVI��AUI��ATI��UH���/SH���K��H��tFH��H��H���Q��H��I��-H�����H��t.H��H����P��I�$1�[]A\A]A^�DH��IH��I��I�}(H��H���	�����������f���SH��H��PH�v0dH�%(H��$H1�H�L$H�T$�i����t'H��$HdH3%(�[H��P[��H�t$ H���B����u�H�|$0u�H�T$H�t$H�=\�	�1]��H�s(H�{1�H��� ��H��$�H��H�D$�A����uH��$�H9D$(tH�|$�]���a���H�L$ H��$�H��H��H��H���lj�H��H�� %������	�H��H�� %�	�9�u�H��@����H��0�	�H��H��0�	�9�u�H�|$��L�����s���H�D$�5�H���	H�X(H�������t4H�|$�Z%��H�
{�	�5H��I��H�5ť	1��J�������
��H�����������USH��H��H��XH�-��0H�}H��t
H��P H�}HǃXH�H��H�@ H��[]��D��H��H�Q�0�`H�8H��P�KH��1�H���H�H�i�	H�BH�����H�BH��H�BH�[���H�B(H�h�0H�B0H��H�B8H�jH�B@H�OH�BHH��0H�BPH�q�0H�BXH�v�0H�B`H�K�0H�BhH���0H�BpH�}�0H�BxH���0H���H���0H���H���0H���H�HH���H�jH���H��H���H��0H���H���0H���H�J�0H���H���0H���H���0H���H� �0H���H�:H���H�t�0H���H�6�0H���H���0H��H��H��Ð��SH��H�=�	H��dH�%(H�D$1��H_��H�sH�߉D$�%��H�|$������\���H�{�I��H�T$dH3%(uH��[����f�ATUH��SH��L�gdH�%(H�D$1��L���/H��H���l��I��$XH�=sEH��H�PHE�1�H���8Y��1ɺH��H�����1�H�5mH��H�$�I����x%H����Y��H�D$dH3%(urH��[]A\�@��8t�H�](�t�H�Ӣ	H���q����t-H�<$��!��H�
��	�tH��I��H�5��	1������f�H���(���v�����	��ff.���SH��H��H�dH�%(H�D$1�H��tS�6H����xJH�=T�	�]��H�߉D$���H�|$�P��1�������H�L$dH3%(uH��[�fD��������\	��ff.����USH��H���^��H�-w�0H�s0H�}H��t
H��P H�}H�C0H�H��H�@ H��[]��fD��AVI���:AUI��ATI��UH��L��S���H��tn�xH��teL��H��H���b���:H��L�5�H��X����H��tH��H��L�p�I��H��M��H��L��L��H����9����[]A\A]A^�@H��	I�$�������fD��SH��H��H�dH�%(H�D$1�@��u3H��tH�s H���*M�������H�L$dH3%(uLH��[��H�s �T����x�H�=��	��[��H�߉D$����H�|$��¸��u��������@��SH� ����H��H�H��t�T��H�s0H�C H��[���fDH��� ��H�5A�	�H��1��zI��H�s0H�C H��[����f���AVA��AUATA��UH��SH��L�oH���lN��L��`H�C0A��t#D��D��H��H���*�H�C[]A\A]A^�DH�{(H�y�	[�_]1�A\A]A^�Y���f���H��H���0�hH�8H��PH���f.�@��H�?�$��@��H������H�������H��/����H�?�U��@��H��Z����H���2����H���
����H��S����H���'����H��cD����SH� �X�H��H��TR��H�C [�ff.���H� t��H�w ��tH��Q��f�H�����H���J�������H���@��H������H��H����H��8����H������H�vH��tH����f.�H���Q�����H�vH�����ff.�@��H��C����H��H��0�hH�8H��PH���ff.���SH���sD��H�C`[�ff.�f���SH�G`H��H�WPH�PPH�WXH�G`H�PXH�`�7
��H�S`�RH�SH[�f.���UH��H��`SH��dH�%(H�D$1�H����)����x!H�L$dH3%(��u'H��[]��H�}H�$H�5��	1��
Y����������USH��H���H��H���dH�%(H�D$1�H��t8H���H����F��H����D��H�T$dH3%(uDH��[]�fDH���PK��H���H���!%��H��H��H�$�r7��H���:�H�����,��ff.����SH��H����lN��H���[�_R��ff.�@��UH����SH��H��H��0H�8H��PH�3H�=����H�x H�=��H���H��XH�xHH�ǀ���V@������������	ʈ���N@���1�������	�1Ɉ��������D)��H�;H�����H��H�����H�H��H��[]�f.���SH��H��H���H��H����JE��H����.C��H��~H����H�D$�6��H�D$H��[����H���0ATI���UH��SH�8H��PH��L���H��H�EH��X���H��XH�P���H�CH����U���	Ј���U����	Ј�����H��H��1�[��]A\�(��f�����u3H���HLJ�HLJxHLJp�f.�H���HLJ���ff.����SH��@��H��H���dH�%(H�D$1�H���!������H�$���o���oH���oP ���oX0���o`@���ohP���op`��oxp��o���(u>H���H���H9����H)�H���1�H�L$dH3%(uSH��[�DH�����V����xu�Hǃ������Ɛ�����t�������H����@��������������ATUSH��H���H��H����B������H����2G��H���� I���~��;@�}���:H���A��H��� �H�pH��H������H����u�H��H��u�H����G� ��G������ ��������DL�����H����*H���H�H���Hc�[]A\�f�H���[]A\�?��1�1�H������H���L����H�����H���H���H�ƃH��H���H��t�H��H���KA��H��[]A\�T���H���H�߽����H�5*�	�=C��H���ǃ������1���������H���H��H�5�	1��������B��H���ǃ� �����~��y���AUI��ATI��UH��SH��H�}�0H�8H��P�H��H��H�EH��XH��XH�����H�CHH���H�CPH�:����EHD�H�C`����U���	Ј���M���	Ȉ���M���L�����L���	�ƃ�������H��H��H��1�[��]A\A]�n#��f.�@��ATUH��SH��H��H���L�&H��tHLJ�H����Hǃ�H���H�������tH�UL)�H��H��[]A\�DH�߉D$�T&���D$��ff.���ATA��UH��SH��H��H���H��tHLJ�H����Hǃ�H���D��H���N8��H��xH��H��[]A\�f�H��H�D$��%��H�D$H��[]A\�D��AUI���ATI��UH��SH��H�m�0H�8H��PH��H��H�7���H���H�����L���L��H����-��H��H��H�߉�[]A\A]�����H���tBU��SH��H���H�����@��uH��[]��H���H��[]�6+��fD�ff.�@��AWAVAUATUSH��(dH�%(H�D$1�H����I��I��L�|$H��L�t$�*H�t$H��L���P����u<H)�H��L��I���H��tNH�K�L��L��L���M��H�D$H��H9�HF�H��u�1�H�T$dH3%(uH��([]A\A]A^A_��������ff.����AVI��AUA��ATUH��S��tA��t=�B�H��H��L�d�DH��L9�tH�SH���H�3�� ����u�ƅH���D��L����5��H��xH��[]A\A]A^�H���r#��H�������f���H�5�0ATI��UH��SH�8H��PL��H��H�0���H���H��H�C L���ƃ�;!��H����*��H��H��[��]A\�b�f���H�G������ff.�AUI��ATUSH��H�,�0H�L�`I�L9�u�3H��L9�t'H�+L��H�}�0����u�H��H��[]A\A]�fDH��1�[H��]A\A]��SH��dH�%(H�D$1�H�H�H��t$H���H�$������������t H�D$dH3%(��H��[�fDH��PH�<$��H�5c�	����H�=�	�P���1���H�@�	H��H�������uH���x�H��� ���fDH�
ʑ	��H��1�H�5�	��9��������@SH��H����y	H�������sn���~����H�5��	H������1���H��H���	������t%H��H��H�
��	1���H�5��	[�k9��H��H��[��tVH��H�5�H���-���f�H�^H�5�	H����,���o���DH��]H�5�	H����,���O���DH��]H�5ʐ	H��H�L$�,��H�L$�L��	H�
0�	1���H�5ӂ	H�=s1���fDAUATI��U��SH��H����y	H���H�5>5H����F��I�Ņ���teH�5��	H�����1���H��H�f�	�����t{L�
�k	����H��M��H�ߺ�[H�
��	]1�A\H�5+�	A]�8��H��\H�5�	H���+��H�5@�	H�����1���H��H��	�E�����uH��H��[]A\A]���L�
D4�o���@L��H�5a�H���V+������L���	H�
��	1���H�5��	H�=&0���f���S�H��H���;��H�C[�DU�4H��H�5A�	SH�����H�UH��H��tH�5�	H����*��H��H��[]ÐH��I��H�=�.H�������tH�H�=�.H�������u&H��M���z�A�8��k�H���D1��D��f���SH��H�=�0H�|$t8H�D$H�H���(���H���H�H�`�0H�=Q�0H�t$� ��H��[ÐH���0�@H�����H�8����H��0H��0�ff.���H��H��H�=��0H�7H�WH�H9�tH;��H����H9t;H��H9�u�L�:�	H�
d�	1��RH�5�	H�=W.����f.�H)�H���ƃ��t�H���0H���2.��H�k�01�H�@H�5f�0��t
H���DH�=I�0H��� ��1��ff.����AWAVI��AUI��ATI��USH��H�o�:H�L$dH�%(H�D$81�)D$ �M���H����H��L��H���v3��H��I�����H��H���FI�~�mH�5�~	�*��H�5C�0H��H�D$�6��H�UH�|$H�5-�	�A(��H�uH�=$�	1��/@��H�|$H�����H�D$L��H��H�T$ H�sH�D$(L�D$�U����I�$H���&����I�$�|H�5&~	H�|$H������H�=Ҍ	�P���1��|H��}	H��H���K��u7H���/�1�H�L$8dH3%(��H��H[]A\A]A^A_�f.�M�1�M��H�
y�	�|H�5�}	H���}3��1��L��H�=��	1��(?��H�L$H�������L��H�=�	��H�T$L��H�=��	1��>��H�L$H�|$H�����������N����F�fD��H��dH�%(H�D$1�H�H����H�$���v�������@�H����
�H�������H������H�D$dH3%(uH�������UH��SH��H���H��tG�H�{H�'1��H�CHH�[H��u�H�ExH��t
H��Є�E�H����[]�f�1���ff.����H���H��t�������H���t"SH��H�����H���[��D�ff.�@��UH��SH��H��H�>�X���H�sH��SH�;�v��uH�UH�{����H�{���H�����H�޹0H��H�8H�H�@ H��[]��f���AWM��AVAUM��ATI��UH��SH��H��(H���H�T$dH�%(H�D$1�����H�uH��H�D$���������L�t$1��BH��z	L���J���uvL���.�H�|$H��H�5s-�z$��H��M��M��H�T$H��L��A�T$ I�UH�|$�Ɖ�����H�|$�%����H�L$dH3%(u8H��([]A\A]A^A_�@I��H�
��	L��1��BH�5Vz	�@0���m����f�fD��AWI��AVM��AUI��ATI��USH��H��H��HH�6dH�%(H�D$81���������H�{p��H�J�0� H�8H��PH��H������������L��L�uL�}H����X���L��H�5B,H�EH���B#��L�u1��dH��y	L�������uDL����I��H�
����L��L��H��SpH�D$8dH3%(��H��H[]A\A]A^A_�M��H�
l�	L��1��dH�5y	�/���fDf�H��)$)D$��L��H��L�ML�EL��H���5��L��H��H�D$(�$H�D$H�D$ H�D$ H�D$A���V���������UH��SH��H��H�GHH��tH;G@vAH�H��H��P0��t�C(uH�}�g��H�C@H��[]�@H�E��fDH�o1���H�/x	H������t2L�CHH�
G�	H��1���H�5x	��-���cP�H��1�[]�@H���8���fD��UH��SH��H��dH�%(H�D$1�H�������t�C(tH�L$dH3%(uH��[]��H�$H�H�U����ff.���H�w0H�W8���H�wH�����GP���@���OH����H�@�wH���H��t	@�����ff.�@��ATUS�GH�m��H�8H���7��H�>H������o�H�5�v	G8H�0�F��H�=Y�	�P���1��H��v	H��I�������u)L�����H�H���H��tFH��H��[]A\��fDL�ML�E1��H�
��	H�5Dv	L���+,��H�H���H��u�[]A\����ATI��H�=ͅ	UH���@SH�� dH�%(H�D$1����pH��H�H��PI�<$f�I�$H�)$H�������[�������H�W H����H�O(H�J(H�W(H��tH�O H�J H�G(H�G H�@H�H���H�PH�H���H��tH�AH�H���H�H�H�����������H���1����H��H��H�X(H�PPH�W0H�P �oOH0H�WH�P@L�H�jA�PHH�|$��H�t$H�EH��tH�'�0H�8H��P H�\$dH3%(�$u/H�� []A\�f�H�H�W(H9�������H���H�W(��������AVI���@AUI��H�=�	ATI��US�z��pH��H�H��PI�}I�EH��H���������������H�G H����H�W(H�P(H�G(H��tH�W H�P H�G(H�G H�CH�H���H�CH�H���H��tH�ZH�H���M����H�+H�H�S������Z����H�پ���H��
L�s(L�cPH�G0H�C �oGC0H�G�KhH�C@H��PH�ch�[]A\A]A^�fDH�H�G(H9���%���H���H�G(����@L�5��0�^���ff.����1�1��C����AUI��ATUH��SH��H��H�wH��dH�%(H�D$1��������H�{0��H�5�r	� ��H�=_�	�PH��H�= %�P@���1���H�fr	H��I������u^L�����H�=?�	�b9��H��L��H��D$H��PXH�|$������F���KHH�D$dH3%(u6H��[]A\A]�fDM��I��H�
΁	L�纇H�5�q	1���'������ff.���ATUH��SH��H��H�wH��dH�%(H�D$1��������H�{0��H�5{q	���H�=q�	�PH��H�=$�P@���1���H�Kq	H��I������u[L�����H�=M�	�G8��H��H��D$H��P`H�|$�������d���KHH�D$dH3%(u3H��[]A\��I��H�
�	L��1���H�5�p	�&������f���AUI��ATUH��SH��H��H�wH��dH�%(H�D$1��m�������H�{0��H�5fp	����H�=��	�PH��H�=�"�P@���1���H�6p	H��I������u.L���n��M��uIH�D$dH3%(uoH��[]A\A]�fD1�M��I�躧H�
#�	H�5�o	L����%��M��t�H�=$�	��6��H��L��H��D$H��Ph�KHH�|$�����u������D���H�����AUATUSH��H����/����\u��fD��/t#��\tH�����u�H��[]A\A]��I��I)�I���I���;;��L��L��H��H���Z���3@��u�FH�����H���3@��t2@��/tF@��\u�\H��H���_���\H���R���3@��u�H��H��[]A\A]����H��\�#���|H�����댿�E1��T����fD�������AUATUSH��H��<\u
����\t#H�����u�H��H��[]A\A]�f.�I��I)�H��H�����I�|�%:��H��L��H��I���D���3@��u&�Rf.�L���h��H��H��H���u@��t.H�k@��\u��s@��|t2@��tL��H���1���u@��u�H��L��[]A\A]���fD�/L��H������E1��K���H����Uf�H��SH��H��H�FH�?�'��H�H�}�'��H�C�E�CH��[]�ff.���AVAUATUSH������I��H�6I��H��H��A����������I�E(H����D��H��L��L���H��I���L���_�D�s(L��H�sH�C����H�{H��H�51�8��H�{H�5�|	���L�c1���H�gl	L������u"L�����H����H��[]A\A]A^�@I��H�
�|	L��1���H�5l	�"����fDH�ѧ0�F���@��ATI��UH��SH�� dH�%(H�D$1�H�G@H������H��H����H�H�C H���H�S(H��tH�Z H�H���H���L��H���7�H�sL��H�C0����H���O��H����-��H�{0H�5�{	H�����H�{0H�5�{	�d��H�k01���H�3k	H�������t>H�
�{	��H��1�H�5k	� ��H�L$dH3%(H��u*H�� []A\�DH���0����fDH�y�0�����������SH�7H��H��tH�	�0H�8H��P H�sH�H��tH��0H�8H��P H�C[�fD��USH��H��H�WH�GH����H�BH�GH��tH�SH�PH�CH�CH�{H�%��H�{��H�C(H����H�sPH�{X��H�{����H�K`�sX1�H�{ ��H�{0�0��H�{ �g��H�{���H�H��t>H�H��H�@H��[]��@H�WH9���U���H���H�G�E����H��[]�CX���q���H�k ��H�ai	H�������t,L�C`H�

z	H��1��H�59i	����*���fDH���p������ff.���U1���H��h	SH��H��H���H���F����tRH�
�{	��H��1�H�5�h	���H�CH��tH���H���H��tH�_�/���H��H��u�H��[]�H�������fD��S�H��xR�oCX�Cht4H�s`H�;����I�غ+1�H�C`H�
���H�5=h	���H�CH[ÐH��[����H�������ATUSH��0dH�%(H�D$(1�H�H����H�PH�T$H������������I�􉑐H��o@H��H�P H�h@)D$H�T$ H��R8H�|$������H�|$H�5sx	H���k$��H�|$H�5dx	�������L�d$H��tx1���H�Kg	L�������u6L�����H�|$�����H�\$(dH3%(��H��0[]A\�DI��H�
nz	L��1���H�5�f	�����fDL��H��AH�5�t	�z��L�d$�h���I�$H�|$H�5c��[��H�l$1���H��f	H��������t<M�$H�
�w	H��1���H�5qf	�[���0���fD1��-���f�H������
����^��ff.���H��8dH�%(H�D$(1�H�H����H�P0H�H�T$H�������.�������H�P H����H�H(H�J(H�P(H��tH�H H�J H�@(�o@H�PH�@ H��)D$H�T$ H��RPH�|$1ɺ���H�|$���H�|$���H�D$(dH3%(u*H��8ÐH�H�P(H9���s���H���H�P(�c����G���USH��H�H�-p�0H�H�s`H�}H��t
H��P H�}H�shH�C`H��t
H��P H�}H�ChH�H��H�@ H��[]��ff.�f�H�9�0AVI��AUATI��S㥛� USH�(��H���H+o@H��H��I��H�GH��PH�����H��I+VHH��H�H��H��I��H��I��)����I+^P��MbH�H��H��I��H��H����������A��A)��������)�D���D��Di����D��)�i��)�Ai��H��D)�A��)�1�WH�=vy	�i%��ZY[]A\A]A^�ff.���SH��H��P���H��PH��X���H��hH��PtH��h���H��hH��`tH��`����H��`H����\��H��x1�H�@H���[����ÐAVI���@AUA��ATI��U��MbSH��@dH�%(H�D$81��.��L��H���!���D��H�5�{	H��I��D���D����)�i��)�1����A�~X�A�F(���+M��t
L����2����w9H�߾)���H������H�\$8dH3%(�{H��@[]A\A]A^�H�l$I�<$H����
����u�I�|$H�t$�����u�L�l$ I�|$L���
����u�I�|$H�t$�����r����D$H�=@�0H��H�D$�D$H�D$(���H��L��A�������MbD��A����D�����A��A)�D���D��H�5�w	��Ai����)�A)�H��i��)�1���������H�=��0I�v0�`���MbH�5dw	H�߉�������)�i��)�1��������I�FH�=m�0H��X��H�5�v	H�߉�������)�i��)�1��:���>�������AWAVAUATUSH�����L�nu,���I��H��H��u3H�{0��L���0�H�{8�S0H��L��[]A\A]A^A_�C��H�=ɛ0H�v�p�H�{XA��tnH��L����9���H�sXH�=Xy	H��1��d���H�sXH��H��tH���0H�8H��P H�{0H�kX�q���I���H��[]A\A]A^A_�����}\�;���A9�<�.���M����.�H��x	L�������tEL�M L��D��H��L�L$���L�L$L��H�
�x	I���.H�5�x	1���������@L��������ff.���AWI��AVAUATUSH��x	H��HH�|$L�l$4L�d$0H�T$H�L$(L�$dH�%(H�D$81�H��0�D$0�D$4�H�H�D$ �EfDI�o�:H�����I��H����H��H���H��L��H���]�����M�~�L��H�������t��L��H�=x	�������I��:���I��H��t7I�H������L��H�������y�H�$H��w	H�������$�L��H�=xw	1����H�$H������H�T$8dH3%(�=H��H[]A\A]A^A_þ:L���#��H��H��t�H�=ò0��L�%�0��I�<$H��P�H�����H��H�D$�oE�oPU�o` e �op0u0�o@@E@�oPPUP�o``e`�oppup�o�����o�����o�����o����H���H��(H���H�D$)4$H�@H��x�D$0I�<$��p�D$4��<�W�HDž�H��xA�<:��H��L��</���&��1�H�5��H��H�D$H�81��+�H�=t�0H��H�������H�{����H��0�P����	H�=qu	H����'��H�|$ H��P����H�D$(H�(1������H�$H�wu	H���������H�D$1�H�5�u	H�81����`���H�5t)0H�=
y	����H���0����G���7�������ff.�f���S�H��F���t��t[��H�����H�[�f�H�����H�C[ÐSH��dH�%(H�D$1�H�G`H�$�G[H��t%H��D��I��H��H�"�
������Ѐ{[�|���H�D$dH3%(uH��[����fDUSH������������H���uFH�p�^���H�w H�- �0H�}H��t
H��P H�}H�C H�H��P H��1�[]�H���[]�@USH���Gl���R�����H���Glu<H�wXH�-��0H�}H��t
H��P H�}H�CXH�H��H�@ H��[]��@H��[]ÐH��hH��t$��p��u
�f�H���x���H���u�H��x1�H�NH��H�����t;H�H�
H9�t!H�
�y\u�@H�
�y\tWH��H9�u�H��`���f�SH����pH�
?
I�غ�H�5�r	�K��H��`H��h[������ff.�@��AU1�ATUSH��H��H�/H�XH�����؀������ƃ�I��A�����H�{xI�E�¯��H�CpH��t
H�H�{p�PH�s`H��tH�/�0H�8H��P H�C`H���6���H�����H��D��[]A\A]�AUATUSH���������L�-�0I�EH9�@��H��H���I�������H��01�����H���L�
7�
PD��81���HH�=r	����H��(ZH��Y�6��H������H����[]A\A]Ð1�H����[]A\A]�H��HH���I�EH��@蕲��H����8
tPH�=�1��[��I��H��HH��tH���0H�8H��P HDžHL������H��HM�,$�{���H�=f��}��I����SH��H��H��0dH�%(H�D$(1�H�4$���H��H��H�D$H�9�
H�D$H�D$����H��x-H��H�D$H�P1�H9�����H�\$(dH3%(u
H��0[ø����������@��H��x1�H�@H�����u�SH��H����`�������H�i�0H���H�H������H�������
�H������H��x1�H�@H�����u�H�������H��Hǃ����H��������������[����AVf�M��AUI��H��H�
D���ATM��UH��SH�� dH�%(H�D$1�I��)$H�D$�D$��������\$�������tx��uSH�t$L������H�t$I�$H��tH�ѓ0H�8H��P H�L$dH3%(����H�� []A\A]A^�D���t;�	H�=\n	�z���f.�H�|$�����I�$�f.�H�<$���H�4$I�H��t�H�D�0H�8H��P �n���fDH�������\$�#�������f.���AVAUI��ATUH��SH�� L��`dH�%(H�D$1�I��$`H��t�����}*�gI��`1�H��xH�AH�������H��L�11��G���H�8H��H��t	�?+�3I��zZ������������1��H�I�.H��t�2H��H��H���E[E1�E1��U`I�>D�m[�����������t�E����H�\$dH3%(���2H�� []A\A]A^�DI����
�H��l	H��������t,I��H�
�j	�
H�5�l	H��1�������'����DH�߽����胿���v���fDI�>�0���I��$�I��$xH��H�����L�������?����H��H�t$H�D$������)�|$H�L$���M��`1�I��xH�FL�I�����tCI�9z(�i�p��H���$�I��L��H�S;x(�7H��H9�u�I������H�tk	H������������D�D$I��H��H�
�i	H�5Fk	1����������P����H�t$H�}������D�D$E����I��`1�H��xH�AH�9H���H��t5H�7�V(����H�O�@�L���@H�1H��H���F(��tI9�u�M������H��j	L��������t>I��A��H�
Qh	L���H�5oj	1�����������y����M�H������@L������c����V���fDH�a�0D�F(�H��o@0�0���I������H��i	H���(���������I��H�
�g	���O���I������H��i	H���������D���I��H�
�g	���������ff.�AV1�AUI��ATI��USH��xH�@H���H�������H�����H��H����I��$xI��$��*���H��H�����1�H���c��I��$x1����H�]L�uI�L9�t(@H�+�L��H��H���Y�H����I9�u�I��$�H��t �H�kX�CxtH�{ht7H��H��u�I��$h��
��I��$`��
��[I��$�]A\A]A^�` ��L���	��H�Ch�f���H���tH��h�
��fDH��x1�H�@H�����u�H�5"i	���ff.��AWE1�AVI��AUI��ATUSH��8H�T$1�L�d$dH�%(H�D$(1�H��xH�@H���H���c����H�����H��H����I��xI���H��H�wH��1�H��A9���D��H9������H��H�H��H��xYH�D$��H�@hH��t
������L��H���f�I���H��I��xH�����I��xI���1�H�wH��H��A9��t���L��L���n���H�t$L���!������.H�EH����u=1�H�L$(dH3%(���kH��8[]A\A]A^A_�fDA�������I������H��f	H���������H��萹��H�9�
1�L�|$ H�D$ H�EL�d$L�uL�H��I9�u(�c���L��L��L���������I��L9��B���I�>�H�|$�G(f�GX���u�H�t$ ��a�H�|$����DM��H�
�f	H��1���H�5�e	�����K���H�D$L��H�=�f	H�1��"��H�]I��H�EH�H��H9�t(H�;�L��H��H�|$���H�|$�I�H9�uػ���������E���DAUATUH��SH��H��hH��(dH�%(H�D$1�H�L�d$H�D$D�hYH�H�D$�B��L��H���'��ycH�|$�Z�TH�t$H�������WX�=�H�|$��1�H��t	H�T$H�UH�L$dH3%(�UH��([]A\A]�@H�D$H��(H�p ���x?H�|$�Z��H��`��H���H��xH�t$�b���H��(�l�H���H�=�H��1����H��H�D$E����L��H�������������H�D$H��(H�p �[���\���H��(��H���H�=r�H��1��/��H�|$H�D$H�ƀZ������k��������\����I��H�
<�R�0uH�5Xc	���H��`���5���H�|$�Z�`����@��AV1�AUATUSH��H��xdH�%(H�D$1�H�AH�	H�����t/H�H���{\tQH����H���@H�H���{\t3H9�u�L�9jH�
�f	1���H�5�b	H�=�讟��fDH�=��0H�s�h��A��=/u�H��P�n���H+�XL���I��?B��H���k�1�H���L�c I��H��xH�@H���H���!����MbE��M��H��D��H����D��AVH�=�`	�����щ�)�i��A)�1��b
��ZYH��H��H�����H�D$dH3%(��H��[]A\A]A^ÐH��`I������L���I��H�
^���H�5�a	H��S㥛� H��H��)׺��	��H��`돐H��`����0uI��H�
���D)��H�53a	����H��`�S���������AWf�AVAUATI��USH��H��HH�odH�%(H�D$81�H�T$ H�D$()$)D$M����$����L�D$H�=�0H�s���H�|$A��tiL���H���\�H�t$H�=z`	H��1��	��H�D$H������H���H��SxH������H�D$8dH3%(�fH��H[]A\A]A^A_�{\u�9�<�L������H�`	L���B�������L�{ L��D��H����H�
=a	��L��I��M��H�5�_	1������O�����M��~-��N�������OuGH�D$ H�T$H�D$�$����@��Fu#�:H��`	��H�D$�$�������f�H�щ�H�s H�=x^	1�����H��H��H�D$����$�����y���DH������H�D$H��$H�D$�S����L���(������H��H�=�]	1��o���g����ո��D��AWAVAUATUSH��8H�odH�%(H�D$(1�H�p�D$����H�D$�	���H��I��M���OE���6L�D$H�=��0H�s�Q��H�|$A��tvL���H����H�t$H�=7^	H��1�����H�D$H�{p����H�����H���H�|$���H��質��H�D$(dH3%(��H��8[]A\A]A^A_À{\u�H�Cp�@Hu�D9�<�L����<�H��]	L��������/H�CpL��D��H��L�H`D�xtH�C L�L$H�$�H�L�L$L���<I��H�
�\	1�AQH�5c]	AWL�L$芾��XZ�����D$���������N��~E��Otp��Wu@�D$����I�<$H��tz�%�H�=�[	I��H��1����H�D$�u���fD��Ft�H�=,\	1��]��H��H��H�D$�=��G�����D$�2����D$�"���H�5i�
H�=�[	1����H�D$�����L��蘯���5����^���ff.���AVI��AUATI��UH��SH��H�_hL�o���uNM����H�{X������Ы��ƃ�H��L��H����H��H��[]A\A]A^�<�@�G\I��`t�I��xH�H�HH�H9�t@H��x\t�H��H9�u�I��`L�D$�4$�����4$L�D$�W���D��F���Ot:��tf��I���L��1�H�=	[	����L��H��H�$��L�$����@I�D$M��t>I�<$t7�E[���t2H��[]A\A]A^�D������鑪��fDI���z���H���H�{x�P�H���1�H��I������H�{pL��� �L��I�EH�{p����H��H��1�I�EH��[]A\A]A^��L������H�CX�]����L��H�=^Y	1�����I���2���ff.�@��UH�5�[	SH��H��H��0H�(��H����A���H��P���H������H��x1�H�@H����������H����_���H������H���K���H��x�_���H�-�~0H��HH�}H��t
H��P H�}H��0HǃHH��t
H��P H�}Hǃ0H�H��P H�2�0H�8tH��[]�DH��H�=�0[]�^�ff.���SH������H��`[H������H�5~0SH����H�8H��PH�����Q����PpH�@PH���H�PXH��tH�BPH���[�f�ATI��UH��S�q���H��}0��H�8H��PL��H�hH������H�C H��z0�oH��{0H�CH�C@H��P�J���H�CH���H�CPH��[]A\�DAVAUATUSH�� dH�%(H�D$1�H�ht%H�D$dH3%(�H�� []A\A]A^�@�GxH��I��H�/�tWL�t$L�l$�CtH�{`��L��H������L��L��H��H�D$�@Z�L��u�H�|$����H�Ch�x���D��H�
F�
�GxH�H��t���H���Sp�B1�L�t$H�=�X	L�l$����H��H������L��H��H�D$f�PYL�������F����v���fDL���@���H�C`�9������f���S@���WpH��H�b�H�
b�VHD�H�=oX	1��=���H��[H��������UH��SH��H��H�����SpI��AH��H�=6X	1����H��H��H��[]�;���ff.���SH��H�����Sp�UH�=�W	H��1����H��[H�����ff.���ATI��USH��H���z�L��H���o��SpI��SH��H�=�W	1��c���H��[]H��A\���@��SH��H�dH�%(H�D$1�H�<$�GxuZH�WPH�GXH��t~H�BXH�GXH��tH�WPH�PPH�GXH�GPH��� ��H����H�D$dH3%(uRH��[�f��Wp�RH�=W	���H�<$H������H�<$H�WPH�GXH��u�H9��u�H���H�GX�q��������USH��H��H�>H�n�����SpA��TH��H�=�V	1��K���H��H��H��[]���f.���AVI��AUI��ATM��UH�-e�
SH��H��H�>dH�%(H�D$1�H��t���H��L�����H��LH�=1V	H��1�����H��H�����1�H��H��H�
�L�hxH�H`L����@YH�$���H�D$dH3%(u
H��[]A\A]A^����@��AVAUATUSH��H��dH�%(H�D$1�H�Xt&�gP�H�L$dH3%(��H��[]A\A]A^ÐH�xI��1ҋ��H��H�GH���9��;���tj���1�ǃ��������CP��	ЈCP�6���H�{pH��P01��Ch �n����CP�d���H�;�.�L��H��H��� ����I���ƃ��L�3�����KhL�CH�II��H��H�5�T	1���L��	�'��H�s`L�����L��	���H�sH�s�
L��H��HD�����L���̟��L��H������H����H��L��H�XhH�P`1��@Y�ClH�$�	�L��H��H���[������fDH�H��H�
H����H��H�DI�$��KP���ƃ��A������ff.���AUA��ATI��USH��H��HH�WPH�/dH�%(H�D$81�H�|$H�GXH����H�BXH�GXH��tH�SPH�PPH�CXH�CPH�Ch�CxtYH�����D$ ����H�D$(H�|$ H��A��H�|$���H�����H�D$8dH3%(��H��H[]A\A]��H��u��D$ H�D$(�H9���[���H���H�GX�K����Sp�CH�L$H�=�R	�W���H��H������H�T$H�L$H�5��L;%,t0H�D$ H�PpH�p`L���H���t71�H�t$ H���8�<�*���E���!���H�;������f.��@\���E���D��AVI����AUA��ATI��UH�-`u0SH�}H��P�H�=R	L�0H������D�khL��H�Cp�>��ClH�}H��H�C`��;��Hǃ�H�CxH��[]A\A]A^�ATUSH��0dH�%(H��$(1������������H��tFH���H���y�����xe���H��$���������H��$�H9D$���H��$(dH3%(���nH��0[]A\��L������H�PS	L��� ����ń��L���H�
"@
L��1���H�5S	�r���f�1��|���f�H�$H��$�H��H��H��H���ω�H��H�� �������	�H��H�� ���	�9���������H��H��0�0�	�	�9�����1�����ӏ���8t���L������H�jR	L���:����ń�t<L���H�
�:	L��1���H�5=R	萟�����L�������L���۠���y���衧�����ATI��U1�SH��H���H��@���
���H�{`��I�$�.���H�CXH��t
H�H�{X�P��[]A\�@��AWAVI��AUATUSH��8H�4$L�l$ L�d$H�T$dH�%(H�D$(1�I�~`L��L�����ń�tSH�\$M�~pI�~hL��H���K�����u�A�Fx�u
J�<;�tO�?u�H�$I���H�H�D$ I���H�D$H�H�L$(dH3%(��u+H��8[]A\A]A^A_���/让��H���]�����n���ff.���UA�{L��P	H�
'R	SH��P	H��H��H��H�w��8���H�����H���H��t
H�H����PH�-<q0H���H�}H��t
H��P H�}H���Hǃ�H��t
H��P H�}Hǃ�H�H��H�@ H��[]��@��AWAVI��AUATI��UH��SH��H��p0L�D$H�8H��P�:L��ǀ�H��聨��H��t[L��L�xH��I�����H�=�O	L���I�������!�H�=Y7	L��������ǃ�L���9��H�=fO	H����oE�oMK�oU S �o]0[0�oe@c@�omPkP�ou`s`�o}p{p�o�����o�����o�����o����H���H����P���L�!m0H�
bo01�H���H��H���躎��1�ǃ�����I�H��[]A\A]A^A_�@ǃ����I�uH�=�B1��g�H�T$H��H�H�o0H�8H��P ������DAVI��AUATUH��SL���H��L���@��tZ���L���uSH��L���q��H����H��H�����H���M��tH��n0L��H�8H��P ƃ�1�[]A\A]A^�L��H��L��1�H�=GN	��I���������ATI��USH���A�����u
1��[]A\�@H���H���A��L�-M	H�
�N	H�+M	�´��1����H���@����w����ʼn�����t�ƃ�[��]A\����������s���H�����
tH�=��1����I�$�R���DH�=�'	�,���I�$�8���UH���/SH��H��dH�%(H��$�1�蔨��H��tBH��H���T�H�T$H�t$H��H�������xx�t$(��H���D�����x-1�H��$�dH3%(��H�ĸ[]�f.��+������t�H�ރ�
tAH�=r4	1����H�E���������H�t$�8
t3H�=�8
1����H�E������H�=�K	����H�E������f���H�=��
����H�E������L�����f�USH��H��dH�%(H�D$1���������1����u
�����t%H�L$dH3%(��H��[]�f.�H�������H���H��P0������uƃ�1��@H������l���H��H�$�XH���H�����H�����H�<$H��譊��H��t7H���H���y��H�����H���H��H����H�<$�v���H��u�H���9�ƃ�1��������������輟��ff.��AVI��AUI��ATM��UH���S�Ӊ�H��dH�%(H��$�1�H����������A��u;T$ t���1�ur�D$1�u-1�H��$�dH3%(��H�Ġ[]A\A]A^�@�����{����y‹UL��H�=�I	1����}�I�$������f�������������x5�u�D$1��w����L��H�=�1	1��9�I�$������X���A�>��L��H�=*I	H��1���I�$���0����n���ff.�AVI��AUA���/ATI��UH�-��SH��H��dH�%(H��$�1����H��tH��H�����H��H��H��H�������xAH�s H�{M��L��D��d$��)���H��$�dH3%(u,H�Ġ[]A\A]A^�H��H�=5
1��5�I�$������蕝��D��AWf�AVAUATI��USH��XH�H�wH�T$HH��$�H�L$PH��H��dH�%(H��$H1�H��$�)�$�H�D$H�D$hH�D$p�D$d�����^�����������������H�D$(H�D$H��H�p������a���D�t$dH�������YL��$��L���������H�L$(I�u I�}D��L�D$x��������I�D$XM�4$�D$H�(H�HH��$�H�D$H��$�H�H�D$ H�L$8H9��AH��$�H�\$XH�D$@���UL��$�L��$�������<����M���zH�t$@L���ų��������H��$�H�=�C	Hu1�H��$��;�H��H�D$0���L��H����H�t$0H9���I�������I��M����M����I���L��L���"��H��H9l$8tQH�uI���H�L$H�T$ ������
����E��t˅����L$���D�H���L$H9l$8u�H�\$X�|$d1�L��$���H��H��$����H����B����H��$���L�t$H���UfDH��$�H������
H����H��$�H������
H���־��H�UH�uH��$��!���H��$�L��L��������H�}t�1�H���%����L�l$hH���1�H�=�k0L�����D$d����H�|$h�L���H�D$(���f�M�������I���L���8������n�������M��tKH�uI������I���7���H�SL���<���M������H�uI�������I�����H�uI�������I���H��$�����H��$��6�������H�|$ ����H�|$h�(H�|$h���������1�H���A��L�SC	H�
E	H��C	����D$d���1��|$����$�I�D$PH��tH�I�|$P�PH�D$HH�t$PH�|$��H��$HdH3%(�{H��X[]A\A]A^A_�fD�D$�
����H�T$(H�L$xD��H�����������I�l$0�e�H��B	H���]������UL�D$x�eH��1�H�
�?	H�5`B	賏���|���fDH��H������������� H��$�H�D$DŽ$����H�l$pL��$�H�D$pL�|$��$�H�D$L�p�DL��H���m���H���M��H��L��I��H������AW�D��h0�ӟ��ZY���H���H��$�H�=B	1���H��$�DŽ$������;����H���H�|$(�o������H�|$p��������H������A���H��H�={)	1��2�H�D$xDI�l$0�a�H��@	H��躗����t�L�D$x�aH��1�H�
8>	H�5�@	����������:���H���H�=�-	1�����H��I��H�D$(����D$d����&���L��H�=iA	1���H��H��$��Z�������D�}��H����8�H��1�H�=GA	�J�H��$����DH������B1��p��������t}H���H��$���H�L$H�������������H�����H��?	H����������L��$�H�
=	H��1��H�5?	�Ҍ���R���D�|��H���I�ŋ���H����
��H�=�?	1��d�H��$�����H����������H���L��1�H�=f0����D$d��������H�������H��蠍�����H�|$h��H�|$h赨���H���H��$�蓶��H�t$(H�=�H��1���H�|$ H��$����H�|$hu�H�|$dA�~L�i>	H�
@	1�H�n���H�|$p�R�������H���������H������B1�����������!���A�EH������fDH�|$dA�Y�x���H�=1?	1���H�|$dA��H��$�L��=	H�
q?	1�H�mm�S����6���H���H�t$(H�=�&	1���H�|$pH��$�肑��H�|$dA�������H�=�=	��H��$��������AVI��AUI��L��ATM��UL��SH�vH���	���xEH��H�����x6H���L������L��H�����[]H��I�$A\��A]A^���fD[�����]A\A]A^�f���AT�I��H�=��US�T����hH��H�H��PH��L��H��H��肚��H��[]A\�f.���AWA��AVI���AUI��ATI��H�=
=	USH��dH�%(H�D$1������H��H�H��PL��H��L� H��H�hX���L��I��H�Ch���D�{xL��L��H�CpI�v�����xIL��L�����x:I��$���}��H�C`H��H�L$dH3%(u+H��[]A\A]A^A_��H�4$H�����H��������f.�@��U���H�2=	SH��H��H���H���#�����tWD���A��MbH��H�
h>	H�5�<	D��A��A�к�A��Ai��A)�1��^���H���H��[]霋��@H��谉����ff.���USH��H��@��t>H��`ƀxH��`H���H��t
H��[]�B���f�H��[]�f�H������H�@<	H���@�����t$H�
ys
��H��1�H�5<	蟇���DH�������{���ff.���SH��`H��ƀx��H��`H���H��t
[霊��@[�fD��AWM��AVAUATI�̹UL��SH��H�=�H��HH�T$L�D$dH�%(H�D$81��@��@��@�����H��Z0H���I��H��?H�D$�SL���[���I��H=����H����@����t��H���H���H��H�$�ό����,��:���I��H�
�����6H�5�:	�Q����xH�D$0�H��X1��q���L��X��D��ȉD$,L���IJ��1�L��躲��D��L���謲��A��L��蠲��1�L��薲��1�L��茲���L���O��H�t$,�L���-����L���0��I�}��H��XL��L������H��XH��PH�PH�0艋��f�H���Hǃp�`�7��H�|$0����H�|$����H�<$芋��H������H���貟����r�e��pf����swaf����f���vH�T$8dH3%(����H��H[]A\A]A^A_�f�H��������x�P����c���f�f����mf����H�;	�����I��f�L��1�1��4���I�����@H�=Y:	1���������I��O���DH�<$�����������L����3�H��8	L��臍������H�
�8	�3L��1�H�5_8	������DH��L��1������H�=�9	���I������H�<$������"���H�O8	I����H�S8	�����I����@H�=m8	1�������5��I��o���DH��hH�|$�H��`�{���H�L$H��@���fDH�	8	�����I��&���@L���x�������>����Á��f���USH��H���H���G}��H��X�n��H�-DV0H���H�}H��t
H��P H�}Hǃ�H�H��P H��l0H�8t	H��[]�f�H��H�=�l0[]����ff.���ATUSH��H��H�XdH�%(H�D$1��xm��H����&H����H�{XH���y���H�$H��H�����8���@ȍpH��H9�rw�Uf���}���M�ҍT9��:�M)Љ�H��xH�H�{X��H��pf��f����[x��H��`ƃ�H���H��t	�̄��@H�D$dH3%(�1H��[]A\�L����f�H��5	L��踊������D�EE1ɺfL��H�
�7	H�5�5	1�����H������fDL����V�H�X5	L���X�����t4D�EA��L��1�H�
�5	�VH�5)5	謀���f.�L�������fDH����m�H��4	H������t,H�
�5	�mH��1�H�5�4	�O����B���f.�H��訁���+����n���ff.���AWAVAUATUH��SH��H��(H�=(j0H�T$H�L$L�D$�+H�dS0��H�8H��PH�=!5	I��H���H��H�$詛������~����+H�=Ŝ
ALJ�0ufA������H��H�5�	I������H�I��H����E1�L�%�4	�f��H��H�=�4	������2�H��H�=�	�������I���H��tH��R0H�8H��P ILJ�H�{�t��I���I��I�H��tY�H��L��������g���H��H�4$H��藚��H��H�=�3	��y�1�I��A������X��H�T$I�H�H��u�A�����H�D$H�$1�E1�E���H�=yh0I���H�@I������I���H�5�3	臎���oE�A�oMAO�oU AW �o]0A_0�oe@Ag@�omPAoP�ou`Aw`�o}pAp�o��A���o��A���o��A���o��A��H���I���H��P0H�8�f���M��PI��XH�D$L�8H��(D��[]A\A]A^A_�fD�H��H�=�2	�����u^H��I���H�����H��H�=�2	���,����k���@H��I���H�����H��H�=Z2	��������=���fDH��H�=w2	�(����H�5��/H�=�3	�n��H��f0���H�P0I���H�8H��tH��P H��O0H�8ILJ�H�L���P ����f�AVAUATI��USH�� dH�%(H�D$1��$����H�t$�`�I��$`H���H��t
�g��I��$`H���H�L�oI�L9�tdI��fDH�CH��tBH���H��t
H�
�O0H�H�sL����H���tH���H��O0H�I��$`H��I9�u�H���1��Ύ��I��$`1�H��p踎��ADŽ$pH�D$dH3%(u
H�� []A\A]A^�芃��f.���S�����MbH��H�=�2	�����i��)�1�������H���[H�����ff.��ATI��USH��H����ʍ������y��H��N0H���H�H���腇��H���tH����o��H���H���H���ـ��H����]���H����A���H���Hǃ�tH���� ��H���H��葀��H����%������Xy����4���t1�[]A\�H��1	I�$��ff.�AUATI��USH��H����hdH�%(H�D$1�������m��H��`H��[ƃlH��P���H��H���H��p1�L�(H�@H��x���eA�E���X������w���~��H��H�=J1	1����I�$�����f�H�L$dH3%(�)H��[]A\A]ÐƇm�X���@H��PH���Q�����hH�$H��)�H9�rm��hH��`H���8���H��PH�4$�xo����h��u.H��`H�wH����ƃlƃm����fD1��I���f�H�<$H��1��D�H�=F1	H���H�=]
	�€�����H����€�������������H�=1	H���H�=�0	�€���u�����H�=�0	�f��
H�=�0	H�������t��H�=�0	H��������v����H�=�0	H��������X���H��H��蟗�����E���A�E����fD1�葊�����@� H������H��hH�x�����x���hL��H���������H��H�=�.	����I�$����������.���)����K���@USH��H��(dH�%(H�D$1��$H�D$�������H��xH��p1��e���H���1�1�H�GH���H��藣��H������u�������u������u]H�AH��t:H���H��t
H�5BJ0H�H�qH���H���tH���H�J0H�H���H���1����H�L$dH3%(uH��([]��~��ff.�f�ATUSH����4���u��H��H�����H��P��I��H�
W����#H�5f.	���H����GDH���1�H�@H�������t��H��H���q�������H��H���N�������H��p1�H�@H��x��u�H������H��p1�H�@H��x����t��H���1�H�@H���1҅���t��H����[]A\�DI��H�
~����?H�5�-	���H��H��H������H���A�����E��x+�������@H����D$����D$���J���������z���f��,���H�uH�������H������������L���@��U1�SH��H��dH�%(H�D$1�H�H0H�(H��pH�@H��x����H����An��H���蕀��H����I���H��聀��H��`�U���H����_��H��p�}_��H�-G0H���H�}H��t
H��P H�}Hǃ�H�H��P H��]0H�8t3H�D$dH3%(u1H��[]�@H���X������C����^s��H�=A]0�|�����E{��D��USH��H��@��t.H��`H���H��tH��[]� v��H��[]�f�H����R�H��+	H��� |����t$H�
Y^
�RH��1�H�5_+	�r���DH����s���ff.���SH���C���H��[H��������AWAVAUATI��USH��H��8H�)F0H�=I\0H�T$ H�H�L$(L�D$H�D$��L�5uE0��I�>H��PH�=2'	H��H���H��H�D$蹍�����r����+H�=Վ
Dž�0uf����/���H��H�5��H������H�I��H�����D$L�-�&	�~fD�H��H�=�&	��������H��H�=�	������<H���H��t	I�>H��P HDž�H�{���H���I��I�H��t\�H��L��������n���H��H�t$H��譌��H��H�=&	��y�1�I���t��H�T$I��D$����H�H��u��|$��@H�D$ H�L$1�H���D���H�=�Z0H�@H���迷��H���H�5&	蜀���Ao$�E�AoL$I�>M�AoT$ U �Ao\$0]0�Aod$@e@�Aol$PmP�Aot$`u`�Ao|$p}p�Ao�$����Ao�$����Ao�$����Ao�$���I��$�H����u���H��XI�>H�����H��`�����I�>�`HDžxH��pH������HDž�H����@]��H�|$H�����{��H�D$(�D$H�(�D$H��8[]A\A]A^A_�@�H��H�=a$	�����u^H��H���H��苆��H��H�=H$	����������@H��H���H��蝛��H��H�=�#	�����������fDH��H�=$	����H�5��/H�=�(	�_��H�vX0�E���H���I�>H��t	H��P I�>HDž�H�H��P ����AV�AUI��H�=�ATUH��H��SH�������uH�BI�}�?��[]A\A]A^��H�=��H��������n���/H��H���	y��H�����@L�5�&	����uI��@��u�C�L������H���u@��t-@��/tm@��\u�H�5}�L��H��觢���u@��u�L���h��H�=l&	H�ٺ/H��1�����I�}�?�,���[H��]1�A\1�A]A^鼙��@�L��L���H����k���H�ٺ/H��H�=&	�������@AUATU1�SH��H��PtH����[]A\A]�D��4I��H�����tH��L��H��[]A\A]���f�H����4�����y�D���H�������H�=�$	H��D��1����I�$�f���AWI��AVAUATUH��SH���t$H�$dH�%(H��$�1�H��D$`H�D$hH�D$�GHuSH�_PL�t$`H�4$L��A��H�EPH��t	H�H��PH��$�dH3%(��H�Ĩ[]A\A]A^A_�DH�D$H�|$x��L�t$`HDŽ$�H�D$pH�$H��$�H��$�H��>0H�8� ���L�l$pI�vH��$�L���g������>I��xH�\$x1�H�D$(I��pH�KXH�@H�D$0H�AH�s`H�I�ą��\k��I��X���A�D$�H�L$XL�|$@H�@L�t$HI��H�D�L�l$8H�D$H�D$\I���������D$\H�KH��$�H����L��H�5�#	1��Ѭ��H�D$pL��H��xH��p覟��H�sH�=6	1���H��H�D$ �p��L�D$ L��H��$���H�5�#	1��w����H�D$pL��H��xH��p�E���H��$�H�L$pH�PH��XH�0��o��L���\�����!j��H��H9\$��H�=�"	����H�u�D$XH�D$pH�SH����]���H��$�I��H�uK���tR�������D$\L�kL����o��H��$�M��L��H��H�5�"	1�虫���$���@1��I|�����u�H��$�L��H�5w"	1��D$\�a������@H��L��H�5�"	1��D��������L�l$8L�|$@L�t$HI��X���I���I����J���I���1�H���	|��1�I��H��$�I�@H��$�I�@I��pH�@I��x1�H��H�D$0��H�t$()�1�A�H��$��D$`H�]P�ͦ���|$t�T$`���H����M���D�D$`���2���H�|$I�v��������D$`���������������p��D��USH��H��H�XdH�%(H�D$1���R��H���tTH��H��uH�D$dH3%(ujH��[]�DH��`H������u;H��`H����j���fDH�{X���H��H������f.�H�4$H������Mo��ff.�f���AT�I��H�=k�US�4k���hH��H�H��PH��L��H��H���bw��H��[]A\�f.���AWI��AVM��AUI��ATI��L��UL��SH��H��dH�%(H�D$1��D$�������I�4$L��H����A���H�= 	H��1�����H��XH��聻��H��xH�t$H��p艛��H���H����Ơ��H���1�H���y��H��H������x(H��`�da��L��H���y���I���l�
D�����H�L$dH3%(uH��[]A\A]A^A_���m��f.�DUSH��H���dH�%(H�D$1��}tMH��H����k��H��H�=0 	��1�����H��HH��耺��H��hH��`H�t$�D$耚��H�D$dH3%(uH��[]��4m��@USH��dH�%(H�D$1�H����~e��H��80H��H���H�H�����R�����I��H�
|H�����H�5�	脺��H��H�$��j���H����D���H��`1�H�@H��h��u�H���Դ��H����q��H���j��H�����p��H����~��Hǃ�H�D$dH3%(uH��[]��1l�����H��`1�H�@H��h��u�����ff.���USH��H��@��t>H��`ƀ�H��`H���H��t
H��[]��f��f�H��[]�f�H����2�H�X	H����l����t$H�
	O
�2H��1�H�54	�/c���DH���d���{���ff.���U1�SH��H��H��`H�@H��h��t�����c�����H����=]��H��P�q���H��p�N��H��`�N��H�-"60H���H�}H��t
H��P H�}H���Hǃ�H��t
H��P H�}H���Hǃ�H��t
H��P H�}Hǃ�H�H��P H�cL0H�8t
H��[]�fDH��H�=EL0[]�v���fD��AWI��AVAUATUSH��H��hH�T$ ��H�L$L�D$(dH�%(H�D$X1�H�=�K0f�T$:�1L�-*50��I�}H��PH�=�	I��H�D$@H��H�D$�o}�����yb��Adž�0uH�=�~
��H�=y~
I����ݰ��H��H�5d�I�������H�I��H�����D$H�-6	H�$� �H�CH�$I��I�$H�����H��H�������tѹH��H�=&	������#�H��H�=	��������H��H�=2�������/I���H��t
I�}H��P Idž�H�{I�����I�$I���H���N���D�|$���H�D$ H�$I���H�=NJ0H�@I���H�����t��I���H�5Q	�Jp���Ao�A�AoOI�}AN�AoW AV �Ao_0A^0�Aog@Af@�AooPAnP�Aow`Av`�AopA~p�Ao��A���Ao��A���Ao��A���Ao��A��I���I����$���M��HI�}H�����I��P�辊��I�}�`IdžhI��`H���蔊���D$I��pH�D$IdžxL�0H�T$XdH3%(�D$��H��h[]A\A]A^A_�H��H�t$H���wz��H��H�=�	���u���1��>���H�T$(�D$����H��Y���f��H��H�=d	��������H�=c	H���������H�=�	H����������	H�=�H��������CI���H��t
I�}H��P Idž�H�{	�>���I������f�H��H�t$:H��蟊��H��H�=�	���}��������H��I���H���-u��H��H�=z	���K�������fDH�D$ H�=lG0I���H�@I���D�D$:H�L$1�耤������H��H�t$<H����t����x�D$<��u!H��H�=+	1�誳��H�T$(�D$����H�I���H��t
I�}H��P Idž�H���1���I������H��H�=<	����fDH�5Y�/H�=�	��M��H��F0����H��I���H���t��H��H�=�	���;������I���I�}H��t
H��P I�}I���Idž�H��t
H��P I�}Idž�H�L���P � ����d��ff.�f�USH��H�/dH�%(H�D$1�H�X�����H�����GHt&1�H�L$dH3%(��H��[]�f�H��`H��hH�t$�D$���H��HH�5�	�`��H��y�H��H輅��H�=�eH��1��k���H�CX������y���D������j���H�=?	肪��H�CX������P����c��ff.�@AWAVAUATUSH��H���dH�%(H�D$1�H��t`I��H��H��I��I���2a��L��I���'a��I��E��L���H�5�	L��1����H��hH��`H�t$�D$軏��A�$H�D$dH3%(uH��[]A\A]A^A_��bb��f�AV�AUI��H�=��ATUH��H��SH�������uI�}H�B�?��[]A\A]A^��H�=��H���������Z���/H��H���e��H��tq�@�ں���uI��@��tPL�5�	�DL���(���H���u@��t-@��/tu@��\u�H�5i�L��H��跎���u@��u�L����T��H��H�=y	1�H��H��/���I�}�?�)���[H��]1�A\1�A]A^�Ʌ��f��L��L���P����c���ff.���AWAVAUI��ATI��USH��H��H�/dH�%(H�D$1���������H�sL��H����b���L��H�=�	I��1��>�����I��衹��L��I���^��L��I����^��M��E��L���H�5�	1�L��诚��H��hH��`H�t$�D$�����CPH�;H�sPL��L���)���I�T$H��HI�4$�4���H��xH�D$dH3%(u2H��[]A\A]A^A_�H��H�D���H�=DbH��1���H�CX���_�����ATI��USH��H��H�/dH�%(H�D$1������xiH�sL��H����/���H��I����]��H�=�	L���1�����H��HH���r\��H��x=H��hH��`H�t$�D$�m����CPH�D$dH3%(u,H��[]A\�H��H�d���H�=daH��1�����H�CX��^�����AWAVI��AUATI��USH��H��H�/dH�%(H�D$1��������H�sL��H����B�����I��蕷��L��I����\��L��I����\��M��E��L���H�5�	1�L��裘��H��hH��`H�t$�D$�s����CPH�;H�sPL��L������I�T$H��HI�4$�(���H��x#H�D$dH3%(u6H��[]A\A]A^A_�@H��H�4���H�=4`H��1����H�CX���]���AUATUSH��H�H����V��I��H�H��I��H���H��tH���b��H�EI�uL���H�H���t H���H��[]A\A]��a��f.�H��[]A\A]�DAVI��AUATUSH�� dH�%(H�D$1�H��`�$����H�t$ƀ�H��`ƀ����I��`H��pH�H�oH�H9�t9M��`I��DH�SH�sL��L�����H��H9�u�I��`H��p1��g��I��`1�H��`�g��I��`H���H��t�zW��H�D$dH3%(u
H�� []A\A]A^��H\�����USH��H�/dH�%(H�D$1�����"U��ƅ�H�wXH��H��tSH������H�-0'0H�sXH�}H��tH��P H�}H�CXH��H��P H�D$dH3%(uPH��[]Ð�GHu
H�-�&0�ĐH��HH�5�	蝨��H��hH��`H�t$�D$蝈���q����c[����S�����MbH��H�=�	�����i��)�1���輩��H���[H������ff.����S�����MbH��H�=�	�����i��)�1����l���H���[H�����ff.����SH���cm��H��[H���g������AVAUATUSH��0H�dH�%(H�D$(1��D$����D$H�D$��S��A��ƃ�H��I��H�wXI��H��t{H������H�EXH�|$L���D$����H�D$A��H�L%0H�uXH�;H��t	H��P H�;H�EXH�H��P H�D$(dH3%(�H��0[]A\A]A^�D�GH���WP���S��H��HH�5+
	訦��H��xH��p����H��x1�H����d��L�`H��E1�L�h�EPL�l$L���D$H��hH��`�n����EP��t/��D$L��A��H��hH��`�>���D9ePw�E��t3H�<$0H��H�8H��P ����H�|$H�������f�H��������X��ff.�USH��H��dH�%(H�D$1�Ƈ������tR葬��H��H����V��H��H�=		��1���H��HH���d���H��hH��`H�t$�D$�d���H�D$dH3%(uH��[]��X�����AWAVM��AUI��H��ATM��USH��H���H��(H�6dH�%(H�D$1��p���1�H���f��\�=Q��I��H�w#0H���H�H����y=��H��H����U����$��m���I��H�
]����4H�5!
	�������H�D$�����uH�����L���U��L��H�=�
	��1�讥��H��HH������H��PH���H��hH��`H�t$�D$�
���DH����l���H��`1�H�@H��h��u�H�|$���H����.[��H���T��H����[��H�����h����]Hǃ���1���\u H��P�I��L��H��贋��I�$�H�L$dH3%(�H��([]A\A]A^A_��H���}���������L����1�H��	L��� W������H�
4	�1L��1�H�5�	�{M������fDH����D���������H�������������3���DH��P�H��H�=M
	H��1����H��I�H���
������������1��9`���7���@L���XN���y����U��ff.���AWAVAUATUSH��H��8H�XdH�%(H�D$(1���7��H�����H����H��`L��`L�d$H�D$H�-�
	I��`1�H�{XH�AI��h����H�D�8A���蛡��I��H����I��hI��`1����A��w,D��HcD�H�>��fDA�<+�$<:�@I��PH�}tH��1��_��I��PL���aR��L��H��H���#���L��D��1�H�=�		�o���H��H�����@H�D$(dH3%(��H��8[]A\A]A^A_�D�à��H��t�H��H�=�	1������A�>*�V���I�~L���c�����B���1�I��p�l3���0����L���T$9�t$H�=�	1��̡���X����A�>+�����L��`�j���f.�I��p1��3�������L�����u�H�|$H�PH�pL���D$H�D$����I��xI��p1��F���I��p1�H�@I��x���t���L��`I���H�������M��L��`����f���p��uf聟��I��H�������H�ƹH�=	������'A�?$��H��pI��a��������pH�{Xf.�L���j����pH�T$H9�sH�L$H��H��hH�����H�t$)�pH�{X�=@����p������H��hƃuH�wH����H��`H���H��t�L��H��`H��hH��`1����L��`���H�{X�5��H��H�����g����L��H�=n	1�诟���;���f.�H��`�f��tH���H���m����t�����P����[���F���f���ATUS�����J��H��0H���`Ƈ�H�8H��PH���$�H��tU���t���uH������H��[]A\�H���0����t�H�������u�H��[]A\�fDH�����w����y�L����n�H��	L���HQ����t$H�
`��nL��1�H�5�	�G���DL���I���fD��H�
	I�������ff.�����ff.���H��	I�������ff.����H�0�@��1��f���H��	H�������ff.����H��0�@��H��(dH�%(H�D$1�H�Y	�$����H�D$H��tH��H���H�D$dH3%(uH��(���N��ff.����ff.����ff.����ff.�����fD���ff.����ff.����f.����SH��H��H�3�H�SPH����q��H�C`H�CX[�ff.����H�GPH��tH�H��P�`f��ff.�@��AUI��ATI��USH��H��H�w`H�X�L���H�S`1�H��H���Y���EH�{PL������L��H�EH�{P����H�EH��[]A\A]�f���ATI��USH��H�w`H�X����H�S`1�H��H���X���EH�{PL��豂��H�E[]A\����AUI��ATI��UH��SH��H�w`H�X���H�U`1�H��H���KX���H�}PL���Y���L�cH�CH��[]A\A]�fD��@��t����ff.�@ATH�5*	�FUSH��H�� H�pdH�%(H�D$1�I����i��H�=	�PL��H���>��H�s0L���L_����~�CXHcsH��u}���1��RH��	H��H���nM������D�CXH�
�	H��1��RH�5�	�Վ��H���H�{H�SxH�D$dH3%(��H�� []A\�f.�H�=n	�UHH�sPH�=NO�U@���1��OH�'	H��H����L����t-L�KPD�CX�OH��H�
	H�5�	1��@����f���H���D���V����VK��fD�������p=����UH����SH��H�g0H�8H��PH�5w�/H�=�/H�ËE����E����&4��H��`H�EH��tFH���H�}�&���H��`H��H���H�UH���H���W��H��H��[]��H�a0H��@��USH��H�dH�%(H�D$1�H��`H�H��hH�$�wD�����uZH���r���H�-{0H���H�}H��t
H��P H�}Hǃ�H�H��P H�D$dH3%(uH��[]�fDH�5�H���q���I��f.�USH��H�dH�%(H�D$1�H�SH�H�$H�H����H�KH�HH�CH����H�H�H�CH�H�{(蹑��H�,$�����~H��ht<H�{p�r��H�CH��t
H�H�{�PH�D$dH3%(��H��[]�D�t����I��H���L����H�l	�~��H��x�H����{������H9�p�B���H�H��p�3���@H�CH9�h����H��hH�C����H��f�������ATI��USH��H��xH��@dH�%(H�D$81�薐��H���.���f�1��f����H���H���D$H��D$$�D$4�D$����L�d$�7I�����M��H�
��H��1��fH�5W�蟊��H��hHǃhH�|$H��t)H�l$fDH�_���H������H�\$H��H��u�H�D$8dH3%(uH��@[]A\ÐH���@����aG�����SH��h��A��H��H�`H�5��J������u	[��H��H�5��[������AWAVAUI��ATUSH��H��hdH�%(H�D$1�H�$H���7H��H�sHH�}�wB�������CH�����{ H�{�6�(L�}A�H����i��H�}I��u%�f�A�D$L�|�I��I�?���L����x��f��@H��I�?��Y����y�I�u 1�H�="�譔��A����������H�L$dH3%(��H��[]A\A]A^A_��H�EH�CPH�<$����H�$H��H�@�����������u����H�w H�=|�� ���A����s���H��L�������c���f�H�u��z��H�Ch뉐H���������H��I�fH���S\I�H�C`�d����7E�����H�;�H��H�GPH�|$�c���H�|$�9���H���@��ATU1�S���u%I��H���H��H��t�r��H���nl���Ņ�x��[]A\ÐH���H�=�1��;���I�$��[]A\�ATI��UH��SH�����uH���]����xoH����B��H�{`H��H���w����Ņ�x��[]A\�f.�H�{`�f��H�s H�=H��1��’��I�$���t�H��H�5^������[]A\ý������AWAVAUATUSH��(L�D$L�l$`L�$dH�%(H�D$1�H���?>���:I���3>��H��H�=��A���=����H�=��I���?����H��H�H��PH�hH�x0H�D$�6��H�l$L�D$�}L�$H�5�L�ExL���H�]D�} �EH����H����l��1�L��H���H�EpH�=~�1��g��H�T$H��H�zp�'K��H�D$��H�5y�H�xp�]`��H�=J��P���1���H�R�H��H���D������H����;��H�D$L��H��H�PP���������������H��x�Ί��H��pH�D$H�H�D$H�@H��pH����H�BH��pI�E1�H�L$dH3%(��H��([]A\A]A^A_�fDH�
����H��1�H�5���˄���B���fDH�T$tH���1���H�|$����������H��PL��H���!������!���H�T$��f�H�l$H���L�m�����H��I���)w��H�E(���H��h�&����oA��ff.�@��H��I��1�API��H��H�5/��?���H���f.���AVM��AUI��ATI��UH��H��S�D��H�5�0H���H���څ��M��L��L�​�H��H��[]A\A]A^�������AUM��ATI��UH��SH��H��H�����H��M��I��AUH�߹H��H�5<�	���H��[]A\A]���AVM��AUI��ATI��UH��H��S��C��H�590H���H���*���M��L��L�​�H��H��[]A\A]A^�y�����SH���#>��H��x藁��H��xH��0H�H���H��hH��t H�{(t
H�{(�`���H�C(H�[H��u�[Ð��H�G���u'H�(tSH��H�(�+���H�C([�D��H���2����H��1�H	���H��u�H����H��u	H������H��tg��������H��(DH��L�F�I9�����thA���thL��D�H�D�@ A��D�I�AB�D�A A��AB�8�t����P���w�� �q��Q ��@��B���)��f.����N1��ЍP�1ɀ�v���@�P��N��v�벸�����ff.����H������01����H��H	��7H��u�H��t�H��u	H���$AVAUI��ATI��US�<��L��M�t�r<��I�M9���I9���@L��D�;.t	H��I9�r�H��I9����:.u�@�}.trH��I9�u�L)�I)�I9�uiH��H��L�s��o0��M9�H�U�@��I9���@��t��t��[�H��P ��B��U]A\A]�r��J ��A^@��B���)��@H)�I)�I9�t�IN�H��H��[]A\H��A]A^�/��f.�1��c���1��H��L��뉸��������SH����7��H��H����7������uH�jf.�<?t�r��J @���p�BэH @��B�8�ufH��H���PH�xH�Y�A��t$��tP<*u��.�?��H��t5�{.u/H�K�ɐ<*u�C�P���w0�� 1�8�[�������������[Ð�J��B ��B�1���1���f.�f���1��?wH�GH������1��?uH�GH��������P�1���uH�GH��������t1���wH�GH��Ð�����uH���f���/��ff.�����P�1���wH�GH������?uGH�OI��1�H�AH�w H�H��Dž�u2��H��H�@H���<��5��A�8�H���D1��D�H�H��H�IH���<
u�A�0��ff.���H��dH�%(H�D$1�H�T$�.V��H�L$dH3%(uH����:��@��H��dH�%(H�D$1�H���l�����T5��H�T$dH3%(H�$uH����J:��f.���H��dH�%(H�D$1�H���@D�����5��H�T$dH3%(H�$uH����9��f.���H��dH�%(H�D$1�H���F������4��H�T$dH3%(H�$uH����9��f.���H��dH�%(H�D$1�H���U������4��H�T$dH3%(H�$uH����Z9��f.���SH��H��dH�%(H�D$1�H�������tH�<$H���������H�T$dH3%(uH��[��8��f.�f�H�1��:[uH�J�R��u%f.�1���]t��H�����t�[t�]u�y H�AtH�AH���@��AWAVAUATI��UH��SH��H��H��dH�%(H�D$1���6��H��H��I���R��H�
�0L��H��H��H���m��1�H���\��1�H���]�������H�ōB�<�g��
u$�]DH�������H��€�v<
t�E�� u�< t<	u��E��tOH�&H��1��@�E1�H��H�����t&< w�H��s��u�H���E �H�����u��E1�H���H\��H��H)�H�u�YB��E1�H�-��L�-E�L�5B�H�CL�H��tZH�H�H��L9�v4A�|0� H�F�t ��A�|� H�P���H��I9�u�L��H9�tH����A��1�H���N[��L�I��M�E1�L�$A��� uI�@I��A�H�$A�PI��L���fDL���������H�$���[t�H��H����€������H��L����€���uZH��H�$��� uH�HH�$�PH�Ȁ�[����:uEL)�A�$H�3N�|8L�H�4$�>[�L��%���D�H��L����€���tq�H�3L�H�4$�>[tqE��u�L��H�=��K�8H����€���uH�SA�|�]H�r���H�\$dH3%(��H��[]A\A]A^A_�H��H�$����L���h�����t�H�$�8�v���H)�I��7���@L���@������H���H�$���H��f�H��vH�p�I�0�:(FWDtJH�����f�L�����A���������A�$H��I����?��1�H���-Y���w�����z)u�A�$�r����������4��@H��t#SH��H�CPH�{���H�[H��u�[���ATI��UH��SH��H��dH�%(H�D$1�H���W>���Ä�t]�E��t!������tl�H�="��;+���"L���kX��H�,$H���O2��H��L��H���a���"L���DX��H�L$dH3%(��ukH��[]A\�f��H�5�L����`����f.�H�<$��1��H�5��L��H��1��m��H�,$H����1��H��L��H���`����R3��f�AVAUA��ATUH��SH��H��dH�%(H�D$1�I���fDA�<$t
� H���|W��L��;t\H��H��L�c0�����u�L��H���&O�����.���(H���AW��H�<$1�H���s����)H���&W��E��t���H�D$dH3%(u
H��[]A\A]A^��2��fDAWAVAUATI��UH��SH��H��HdH�%(H�D$81��?���(H���V��H���x��L��H��H��H�D$�����xt�)H��H��0�V���;t�� H���qV��H��H���������E1�H�L$8dH3%(D���-H��H[]A\A]A^A_�H���I�$f.�A�������H�t$(�&�����eL�k0H�t$0L����%�����LH��H���
�������,��� H����U��L��H���������,��L�t$(H�5(5	L�����H�5��L��A������D$��uH�|$0H�57	����������D$H�t$H�{`�%M����ua�S`�����H�5<�H����]��L���L�� � H���U��L��H���<������?I�F0I9���I����f�H�5V��H���]��H�t$�>uc��D� H���T��H�D$H��H�p0��������H�D$H�P`�x`H�T$��� H���}T��H�t$�>��H�������u�H�(�A�����I�$��DH�D$ L��H��H�D$蓄������H�T$ H��1�I��`H�5�	��i��E�����D$�������� H��L�l$��S��L��L���K����������(H����S��H�|$�H�����H�5�H���d\��H���L���eK�����bH�|$L��H��������U���H�5��H���!\��H�t$H���调�����H�\$ H���+-��H��H��H����[�������H�t$L���s�������� H���R��H�\$ H����,��H��H��H���[������H�5��	H���[�����H���A�����I�$�T���H���A�����I�$�>���H�I�A�����I�$�(���H�4�A�����I�$����H���A�����I�$���H�W�A�����I�$���H�{�A�����I�$����H���A��I�$����-��f�AWAVAUA��ATA��UH��SH������A ���A��H���(H��A�ωL$��Q��E���H�H����(��H�{��(��H��E1�E��tH��H�5<�H�$���H�$��ED�H��H��A���ȅ��� H���kQ��H�s�H��诅��E9�tbH�;�k(��H�{�8(��� H��H���4Q��H�S�E��t��f�H��H��[H�5�]A\A]A^A_�Y��fDA��t(�|$t!� H����P���H�5|�H���Y��H��H��)[]A\A]A^A_�P���|$u���fDAUATI��UH��� SH��H���P��I�|$8���(H���jP��I�t$8H��譄��� H���PP��A�t$H1�H��I�|$@�,����)H���/P��� H���"P��M�l$XM����I�}�L'���(H��I�]�O��I�uH���<���I�}t(D� H��H����O��H�s�H������H�;uݾ)H���O��H�� �O��I�t$`H��H��[]A\A]�\h��@�H�5�H���4X���@�����H�5_�H���X���f�AWAVAUATI��USH��XH�$H�t$0H�T$,H�L$dH�%(H�D$H1��'F�������D$,���������L��D$�p��I�$H���PH�D$����H�ōC�L�t$81�L�l@L�|$@I���M�H�D$0L��H�|0�����tCH�t$8L��H��`H���_��L��H�E�H�t$@�t_��H�E�L9�t;H�|$0L��H��[����u������H�L$HdH3%(u-H��X[]A\A]A^A_�H�$H�L$H�H�D$�L$�1����)��AWAVAUATUSH��HH�L$dH�%(H�D$81����tXI��I��H�Ӆ��U�C0H�k0��t;��ueI�D$X�{`t(I�t$`H�{`�X3������I�t$`L���^��I�D$`1�H�L$8dH3%(�H��H[]A\A]A^A_�f�H�D$(H��H��H�$�2�����$H�T$H�t$0H���BD�������D$���|�pH������H��H�V�H9��k$��I�EL��PI�NjD$����1��$H�t$(L��O�4�����]��I�;l$��A��H�4$K�<vH��H|$0�����u�H�D$H��H���������f�H�t$ H���CD������H�|$ I�t$8H�G0H�D$ �S������I�t$8L���>]��H�|$ I�D$8���u>I�D$@�K���I�E�L��PH�t$(L��I���]��I�M�|$X�8���@I�L$HI�T$@L�����������H�D$H���H����3���H�D$H���H����������H�D$H���H����������H�D$H�N�H����������&��ff.�@��AWI��AVD��AUI��ATA��USH��H��(�G\H�oP���H���A#��H�H��tED��������� H���K��H�uH���D��E��uL1�H��([]A\A]A^A_�fD�����JH�5T�H���|S��� H���J��H�uH����~��H�߾ �J���uH�}H��1��u���H��H������H��(1�[]A\A]A^A_�f�H���J"�����H�5q�H���R���D$�D$� H���!J���L$�uH��H�}���� H���J��H�u(H����b��� H����I��H�u0H���b��� H����I��H�u H���RH���
~��I�W@1�H�5'9H���u_���|$uA�G\��I�GH���Q!��H�x�!��H�@P�H�5��H��H�D$�R��H�D$H��H�xh�+���H�5��H���Q��I�L��D��H��������A�WHH�5�8H��1���^��E������H�߾ ��H��H�uPH���a��H��H���=���������C ��H�E�D$H�D$H����H�5��H���	����uH�}H�5S
	�	������H�|$H�5b
	�	������H�|$H�5�'	�y	��H�t$H�߅��D$�|��� H���8H��H�uH���||��A�G\����:D$���D$�D$����f.��:H��H�5A��P��H�߾ ��G��H�uH���#|��H��(1�[]A\A]A^A_�f�H�H��t�@\u"�H�5�H���^P���D$�h���@�H�5��H���<P���D$�D���f��H�5��H���P�����H���I�E������U���f�H��txAUI��ATD��UH��SH��H���f��)H���G��H�[H��t:�(H���F��L��D��H��H���L0����y�H�������[]A\A]��H��1�[]A\A]�1����AWI��AVAUI��ATUH��SH��HH�dH�%(H��$81�H�H�@H�����pH���I��H�CP�C\�QH�CA�?H�D$(��E1�H�t$@L���>������H�t$HI�0�(������H�t$@H���W��H��I�$H�t$H�W��H�T$@H�5x%	I�D$H��H�$���H�$H�5��D$H�������$��uH�|$HH�5z
	�����������$E����C\����;$��A�O`M������	I�D$I���I�t$(L��H�D$�+�����\I���I�t$0I���H�D$��*�����aI�� I�t$ I���H�D$�
�����'I�t$(H���U��I�t$0H��I�D$(��U��I�t$ H��I�D$0��U��I�� I�D$ I��PH�D$H�D$8H��H�D$�
u������H�|$8H��$��p%�����kH��$�E���WH9C@��T$�����$���vE��uH�CH������H�x����H�D$0I���H��H�$��;������H�|$0H�SL��H���E������mE��tH�CH���~��H�x�s��H�H�4$I��P�;�����uH�CH�|$0H�L$PH��H�PPH��h�R�����wH�t$I���I���H�D$��s������H�|$8H�t$$�.�������D$$E�����CHH�|$�?�I�t$PL�w0��(������I�t$PH���"T��I�D$P�e�H�CA�H����H�D$(���SL�t$(DL����d��L��L��H��H��H�D$0�
������2H�D$(I��0A�?H�@H�D$(���C\tH��u�H���I�E������fDI�ԾhH��оpH��H��I�$H�EL�s�PH�CPA�?I��� L���0d��L��L��H��H��H�D$0�j�������I�I��0H�M�6I��A�?tÃK\H��	I�t$L��I�$��������I�t$H����R��I�D$A�G0����M�w`����I�D$H�{PL��L��H�����H�8�I�E@�����H��$8dH3%(�iH��H[]A\A]A^A_�f�H��$���H�H�
� 	H�|$XH��$�H�
��H��$�H�
��H��$���H�H��$�H�\$PH��$�H�D$PDŽ$�H�D$H���YA�0�NL���b��H�T$HL��H��H��H�D$0������ ���H�D$(I��0���fD�|$��u�K\�4$��������K\����I�L$I�T$H��L�L$I�`��L�L$������H���I�E��������1����f�H�C@����H�������g���f�I�L$I�T$H��I�0����/����H�{����D$$E���q���1��g���DH�t$H�|$I�ǀ�p������H�|$8H�t$$�*������H�{�3���D$$L�|$E������9CH�
���H���I�E�����f.�H���I�E��������A�����H��I�E������}���H���I�E������h���H���I�E������S���H���I�E������>���H���I�E������)���H���I�E���������H� �I�E��������H���I�E���H���I�E���������H�N�I�E���������H���I�E�����H��I�E��������H�t$PH�=O��7h��I�E��������fD��AUI��ATI��UH��SH��H��8dH�%(H�D$(1�H�H���ZH�����H��H���k��H��H�D$�:���H�|$H�����1���R��H�L$ �1�H��H�D$�������urH��������I�$H�EH��tH�@PH�x�H�H�@H��u�H�|$�5-��H�|$�d����H�T$(dH3%(��H��8[]A\A]�f.�H�=���l��H�|$ L��H��L��D$��"����xG1�H�|$�{����u�����f�H�|$1���F��H�=�H��1���f��I�$�8���f.�H�|$L���3�����������fDH�x������C������ff.���H��H�T$H���S��H�T$� ��H���ff.���ATI��UH��SH��H�� dH�%(H�D$1�����H��H����i��H��H�$�o���H�<$1�H������Q��1�H�L$�H��H�D$��
����xHtnH�|$H��L������H�|$�+��H���zb����H�L$dH3%(uJH�� []A\��H�|$1����E��H�=��H��1��ie��H�E�H��������H�E����f��NA�gfff���A��)ʃ�0��N�G-��A������)��)�H�1s/��0�OHcVH���f�W�@��Mb�G-�G�v��l��A���A����D)ʃ�0�W���Q����D)ɉ�A������)��)���A��0�O����D)ɉ�A���A�Љ�A����A)�C���)‰Ѓ�0�G	���)ƃ�0@�w
�ff.�f�UH���S��H���{��H��H��I�������u�gfffA�B ��A�B:���A�B:��A�B ��)B0A�B���)ƃ�0A�r
�u������)B0A�B���)ƃ�0A�r�u������)B0A�B���)Ƹ+��0A�r��y�۸-A�B���N�ؾ������A�B����0A�R����������ȉ��k�<�������)�)lj���0A�B�������0A�R������)�L�Ѓ�0A�ZH��[]�fDf�AVAUATI��UH��S))F)F H�F0��� u�_H���q��H�I����DBtn�E<-t
�DBt_�}-uY�ۃ�0A�\$�E<-tV��H���DP�A�D$1�H�=V(L�-�p/�	@I�|��H���=����t"H��H��u�[1�]A\A]A^�DH���f�A�\$�}-u��UI�H��DQt��uH��Dqt��}H���Dyt�D�EB�DAt�����@��A����0��0[k�di��Ѝ������P��8d���A�D$H�E]A\A]A^�f���USH��HdH�%(H�D$81�H��t�?tH��H��H���n���H��t�8t1�H�L$8dH3%(uRH��H[]�H���D$ �����X��H��H�E�H���uă|$dH�E��DH������H�U��k��ff.���AUATUSH��HdH�%(H�D$81�H��t#�?tH��I��I��H�����H��H��t�8 t*1�H�L$8dH3%(��H��H[]A\A]�f��n���KH�H��DHt��s�Dpt��{:u���@�΍������TQЉT$�KH��DHt��s�Dpt��{:�v�����@�΍������TQЉT$�KH��DH�N����s�Dp�?����{	 �5�����@���s
E1ɍ������TQЉ$�VՁ�ul�KH��DHt^�KI��DHtP�{
H���DxtBD�SB�DPt5��A��A����0��0k�<i�X��у�0k�
�D�L8�@��+tA��E�MH���D$ �����X��I�$H���tAkU<Hc�H)�I�$��m����|$dI�$���T����g��H������I�$��7���ff.�@��SH��H�|$H�|$�x���H�t$H��H���c��H�߉��^���H��[����S��H��dH�%(H�D$1�k�<H�H�H��H�$�T����H������H�T$dH3%(uH��[����ff.����UH��SH��H�|$H�|$�����H���W
��H��H��I�����L�U�C��uH�;��H��[]�H��1�[]��AUATUSH��H��H����H���(L�-���3���{@L���h
��L��H��H���*,��� H���]3��H�uH���a��� H���D3��H�u H���H��� H���+3��H�u(H���/���)H���3��H�mH��t9�(H���2��L�eM���o����L��H���;���p���f.�H��H�߾)[]A\A]�2��f�H���H�5��[]A\A]�U;��DAWf�AVAUATA�USH��hdH�%(H�D$X1����u/�H�L$XdH3%(D����H��h[]A\A]A^A_�f�H��H�t$(H����)��A�Ą�t�H�|$(L�l$$L�t$0�?t�H�D$8H�$H�D$@H�D$H�D$HH�D$H�D$PH�D$fDL��L����(����tI�|$$vBH�4$H�|$0�d����t0H�D$0H�t$H�x0�M����tH�D$0H�t$H�x`�6����uf�E1�� ����H�D$0H�t$H����
����t�H��8H��PH�t$8H��I���8B��H�t$@H��I�G�'B��H�t$HH��I�G�B��H�t$PH��I�G �B��I�G(H�EI�GI�H�EH��t)L�xH�D$(L�}H�x0�x0H�|$(���l���@L�}���E��D��ATUSH��H���\H�7H��H���^I��� H���0��L�eM����L���\
��L��H��H���)��� H���Q0��H�uH������ H���80��H�u H����H���s���� H���0��H�u0H����H���Q���H�߾ ��/��H�u@H���8���H�߾ ��/��H�uPH������H�߾ ��/��H�u`H������H�߾ �/��H�upH���mH��H�߾ �/��H�uxH��[]A\�PH���H�5w�H���,8���	����H�u�N����H�u�����H�ߺ'H�5	�[]A\��7�����AWI��AVI��AUI��ATI��UL��SH��H����PL��H��H�������u"��H���I�H����[]A\A]A^A_�DH�uL���?��H�uI�}0H�E�S���Ä�u
H���I�뻐H�uL���?��H�UI�}`L��H�E����Ä�uH���I��fDH�U I���L������Ä�uH�n�I��Z���H�U0I���L������Ä�uH�[�I��2����H�U@I���L���]����Ä�uH�B�I������H�UPI�� L���-����Ä�uH�#�I�����H�U`I��PL�������Ä�uH��I����H�upI���� ���Ä�uH���I����H�upL���O>��H�uxI���H�Ep�����Ä�uH���I��P���H�uxL���>��H�ExI�/�8���ff.���AUI��ATI��UH��SH��H��(dH�%(H�D$1����H��H����Z��H��H�$�J�H�<$1�H������A��1�H�L$�H��H�D$������x[uAH�K�1�H�EH�|$�r��H���ZS����H�T$dH3%(uMH��([]A\A]�DH�|$H��L��L���;����뵐H�|$1�1��R6��H�=|�H��1��1V��H�E����fD��AWAVAUATUH�-�SH��8dH�%(H�D$(1�H��t]H�����H��H���Y��H��H�$�C�H�<$1�H�������@��1�1�H�L$H��H�D$������?H�|$�}��H���eR��H�L$(dH3%(H���jH��8[]A\A]A^A_��L�d$A�<$���I�\$0L�l$�_���(L�5�,H��H���
+��A�<$u"����;I����H��`A�|$0��H�{�L���7����t�H�}v
� H���*��H�t$H��I���`L��� H���*���;�JH�t$ H���7����u1H�D$ 1�H��H������z���fDH�-d�����@H�T$ �L��H�������u�L�|$H�5�L���I�H�"�����H�5�%L���+�H������H�54�L���
�H������~H�5�L�����H�����tdH�5�L�����H�����tJ�=3�/��H�5V�	L����H�7�/��t#H�5��L����H���/���HE�f�H�T$ ����fD�H�5G�H���1��H�}����H��)�$)��H�����H�����H�=��/���/������\����5�����ff.�@��ATI��UH��SH�H��ux�H���T��H��H�����H��H��H�-��H���[1���=H���(���M��t�PL���GT��H��H���\��H��H��H��[]A\�1��f.��H�5b~�0���r���f.���AWAVAUATUSH��HH�|$dH�%(H�D$81�H���0�>H���$H�|$H�t$������
H�޹H�=�)�@��@���J\��H��H�5&@��I��H�\$(�o��H�|$H�D$H�D$0H�D$�?���0��H���m�������L�l$L�t$(M�}0L��L�|$�:��H������tH�|$L���O2����t,L�|$H�t$L����������H�T$0H�t$(L������H�D$H�x0H�|$�?�i���I�|$tL������fD1�H�L$8dH3%(uRH��H[]A\A]A^A_��H�D$H�x`H�|$�
���DI�}`H�|$���f�H��
H�D$0H���`���������U��SH��H��tW�f��tOf��tf��
tkH��������>��F��������v��X?����v���S����w;��2����1��Z%����H��H�[H�H��)�i��]�F-���w���-=����u����f.�@AWAVAUATUH��SH��HH�L�*H�t$H�T$dH�%(H�\$81�H�D$(L�l$0E�}H�D$A��*��H� 1�L���tH�|$L�$E�4$E8�t(��E��H�8A��B��8���L;e���CI�tH��D�>A��*w�H� L��s�H�\$H�t$0L�4L�t$(A�>D�>uL9�t�EA8F���1�H�D$(L�l$0H�D$A��%��H�~H�|$0D�~D��E���CE�&H��E��u0��DH�D$(�M8thL�pH�t$0L�t$(D�`D�>E��t�E8�t���A��A��H���8�u�L9uv�H�t$L��H���c�������	�H�D$(�M8u�H�t$0I��D�>A��%�H���A��*��A�����E��u
8E�:���H�\$8dH3%(�5H��H[]A\A]A^A_�1�1��G����E�����ED8�����t��S�1�A:D����DH�t$0L�t$(D�>���DA���t3�M8���I�V�fDH�R8�tsH�T$(�I�ք�u��FA��H��<*tE��u?L�t$(H�D$�L�0H�D$H�0����L�t$L�������E���������D8}���������FA��H��<*t�A����1����������������AWAVAUATUH��SH��HH�|$ H���T$�L$8�L$�Z���pA��H������H��H�V�H9������H�|$ H��PH��H�D$0E����H��A�D$�E1�D$<H��H��L�$$H�H�D$fDL�mL�����I��H��A�E��t$H��<*�<%�I���B�A�E��u��1Ҁ|$L�;�6�SL��H��H���[���H�$H�DH�$H9\$u�I��H�pH�PH������H9������H�\$ 1�H�H��PH�t$0H��H�H�D$�D$8I���A�D$<H��L�tH�AH�$f�I�H������H�PL�lM9��L���H,$H��I��H�����I�o�L��M9�u�H�D$H�L$0H�HH��H[]A\A]A^A_��<%u$@I��A�E<%t�<*t�B�%���fDI��A�E<*t�<%t��B�*���fD���M���IH�=2�L� ������H���7I��A�H��A:4�t�%��|$%tZH�\$(L��M��D�d$�*DA8�t8<%tA�4����H��tX�xH�xt^L���CL�k��@��<*��@��u�H�\$(�T$����@1�8D$��@�����@������H�\$(1����@A�EI��H�\$(<%t����<*@��!�8D$��!ƒ����A�F��f.�H�\$ �H�H��P�L$8H�D$H��H�D�����*@���^���ff.��AVI��AUI��ATU1�S����@H�����H�����I�]I��H�;t*��CH�޺L��E�H���C'��H�;uݾL���,��H�I�|$A�M�	���I�4$[��L��]A\A]A^���f���AUI��ATI��U��S��H��dH�%(H�D$1��GuXH�=���M����L���L��D$���H�|$H���4��������H�t$dH34%(H��uH��[]A\A]�fD�ډ��O���H�����5���D��H��(����dH�%(H�D$1�H�4$H��H�D$�]��H�|$dH3<%(uH��(������H��tGH�H��t?SH�pH��H��tH�8H��P H�H�@H�3H�>H��P H�[�f��ff.�@��UH��SH��H��dH�%(H�D$1��GuJH�=a��NL��H��H��D$����H�|$H������������H�T$dH3%(H��uH��[]����H�����������1��V8WuaUSH��H�_H�nH�;H�uH��u=H9���H��[]�f.������u/�E8Cu&H��H�;H��H�uH��t�H��u����H��1�[]�ff.�@��AWAVAUATUSH��xH�|$0dH�%(H�D$h1��G�D$XH�GH�8�"H�NH��H�t$@E1�H�L$8H�L$HH�t$H�t$P�D$,H�L$H�t$ fD�P�T$YL�H�l$@L�D$HH�l$P��t:�H�5<�H��L�$� ��L�$��u�E����:D$X��@E�0A��*t1H�T$H�t$H�|$ �R����Ã���L�D$HE�0E���5�A��*��fDM�xL�|$HE�pE���	H�|$@D�/I��E��u%�H��L�GL�D$@D�hL��E�7E��tlH�|$L�$E8�t)����A��A��L�$H�H�|$��8�u�L9D$Pv�H�T$H�t$H�|$ ���t	�L�|$HH�|$@�DL�|$HE�7M��A��*�:���H�D$@D
0tPH�L$0A�D$	\$,I��H��HAH�8�e���H�L$hdH3%(�D$,uBH��x[]A\A]A^A_�f.��D$,��fDH�D$8H�D$P�q����D$,�����f����<{t@��)wAH�������H��H�Ѓ�u"H�G���G(u�Gx1�H�����H�8�@��xѸ�ff.�SH��H�81�H�K@H�GH��H�ʍp�H���/������[�AVAUI��ATA��UH��SH��H�dH�%(H�D$1�H���O��I��H�$H����1�A���*����(sZ�� t����
t	��
��1��� H�}@��H�Hu0H�4$�T�H�}H��L����"��I�E�H��u������H�L$dH3%(ugH��[]A\A]A^�fD��]w#��\s΀�+uE��u�H��H9��J���1����{t��� ��_w�H��H9��)�����@��"t���%u���/�ff.�@AUH��1�ATI��1�UH�o8SH��H�8H�GH�q@I������A���O�A�U�I��H�RH���<t-�5��uSH�~1�H�nH�GH�v 1�H��A�������t0A�U�H�RH��H�4��H���w�I�,$H��H��[]A\A]�@H��1�[H��]A\A]��H������UH��H�rSH��H9����H�H��PH��H��H������H��[]�f�AVAUI��ATI��USL�wHH��I�vI�>�$��I�V1�H��H���>���H�CPH�E�KX�����H�5���Hc�H�>����C(��L��L�������EH�{�=���H�E���L�e�������E(��	ЈE(�CX[]A\A]A^�f.��C(�t�����EȉMH�CpH�E����������E(��	ЈE(�CX[]A\A]A^�@M������EH�{I�T$�I�u����I�ċCl��x�C(t~L�eL���2�H�E�CX[]A\A]A^�fD�I��t-�EH�{L��L���;���L�eH�E�CX[]A\A]A^��H�5�L���<���������f�L������u���AVI��AUATUSH�G8H��H�w`L�o@L�`Hw0H����H�kP�ChH�C`H��tl���u�C)��D�}���H�u H�}�a"��H�U 1�H���#���1��H�}H�M H�GH��H�ʍp�H���=+��H�mH��u�L��1�H�s@H�{8I��I���"��H�S@1�H�������H�C8���@H�I�[D��]A\A]A^�H���CxA�����H���I������AUI��ATI��UH��SH��H�M�/H�8H��P�H�=���H����L�k�PH����/L�cH��H�k H�C�3��H�C@0H�C8H�C8H�CHH��H��[]A\A]Ð��H�����������H���@��SH�H����������u0H�CH��t
H�H�{�PH���/H��[H�8H�H�@ ��fD[�ff.�������@��SH��H�H��P0H�C0H�{H����/�P�N��H�C@0H�C8H�C8H�CHH�CP�CXH�C`�ChH�ClH�CtHǃ�����[�ff.���H�wH�W���H��t�Gx�H����f.���AWI��AVAUATU��SH��8H�L$���dH�%(H�D$(1��W(��@�)��� ���t+A�wX��u#M�OHI�8I9��
A�G)���H�\$ I�H������H�L$ H��H����A�WX����M�o`M�g8N�4(L9�vA�> t
��B�<( u
I��N�4(I9�r�Mo0I�L������H�L$ I�G`L)�H�L$ �QA�h�.A�6@��(����@��
�x@��"��@��
�|L���������H�L$ A�GXI�G`H���.��@I�w81�H�FI�w@9���A�Gx���,I9���A�G)���5D@��{�@��~��@��)�n���I�P��M�oHI�uI�}����I�U1�H�����H��I�GP�H�AI�GPH�@I�GPH���H��A�GXI�GH� DM9gH����I�w8I�@1�H�FH���P�H9��y�H��H��H�8�����L�hH�L$L���-�H�L$H���y���A�|�]�m���A�GX1�A�<
�4<
�,H��H9�u�I�O`A�x����	A�����0��H�t$L���
���H�\$(dH3%(��	H��8[]A\A]A^A_��A�GXA�Gl����I�G`I�w`H��H9��$I�_`@A�Gx����	A�WX���p���I�G8I9GHtA�G)�[������S���I�w8H�F1�I�w@9��=����I���H��t�A�~
���A�G( ��A��� A�Gx��M�oHI�uI�}����I�U1�H����PH����/H��I�GPH�AI�OP�I�M�oP���I�E 0I�EI�GPA�GXH��I�GHA�G)��I�G`H�L$ L�hL��M�o`�B���@H������A�~{�kA�GXI�G`I�_`H9�voA�< wH�$H��rHI�$�<)�0I�Pu(A�G(� u ��LH��H9�tA�< w�I��s�H��L��L���#���I�_`A�_X���3���A�G(���I�_HI�G8H9���H�1�H�@H�s��uoI�w8H�FI9G@�{�H��8uUH�XH�5�{H���h����t9H�50�H���U����t&H�5�H���B����tH�5٫H���/����uA�GhI�G0I;G �uA����k���A����A�GXI�GpI�G`I�w`@H9��\A�6<}�,A����N<+�3�PЀ�	�sH��������I�pH9����P�H�<�Hc�H�xI�GpH���f�A�G( �5A��� �A�GXI�G`�!����H���A�Gx1�I���I�G0I�G0I����H�D$I�G`H����������f�A�G(@��A���A�GXI�Gp���I�G`��A���I�w`H9������A�<6{�H�g�A�GxI���I�G0H��Z���fD�S�A������A������@H�p�A�Gx1�I���I�G0�����H���A�GxI�w`I���I�G0H����f.�H��H9�u�Ѓ�0<5�[���I�G0H�ѩA�GxI�w`I����f�I�G8A�GXI�GHI�G`H���S���I�w`H��A�GxI���H��]���A������A�6<"u2�fDA�<
tO<
tKH��H9������A�<"�����<\u�H�CH9������E�WlE����H���fDA�G(u�H���A�GxI���I�G0����f���L��H�L$�@�H�L$�������.���fD�����H�=x�Hc�H�>��I�G0I�H�DH��I�G0�t��A����ȃ�<��A�G(u0I�G0I�W H9��r���H)�I9Wp�e���I�H��t	���3A���I�H��A�GXI�G`���H�t$ H��A�����H���e������
����
thH��A�GxI�w`I���I�G0���I������I���f���I������I�����I�_`H9���H���q���@A�_lH������I�G0I�H���H�D$H��H�D$�G��A����I�`�A�H�D$A�G(tA�X�[I�WpH9������H��L���e�I�GpE�OXI�G`E�������H�H��L��L���:�E�GXI�_`E����������@I�����A�Gx�-���H��L��L��H����E�_XI�_`E���p��������H��A�GXI�w`���I�w`A�Gx���H�B�A�GxI�w`I���I�G0�9���H�D$H�������K���H�?�A�GxI�w`I���I�G0����H���A�GxI���I�G0���H�S�A�Gx1�I���I�G0���H���/A���1�L��H�0��A�Gx�!���H�'�A�GxI�w`I���I�G0�x���I�p�
���H���A�GxI�w`I���I�G0�G���I�G0I�H�^��H�D$�-��H��H�D$������PH���9���I�w`I�G0H�����}�I�������H�5��4��I�����������I��j
��I��1�����I�w`I�G0���ff.�@��SH��H��dH�%(H�D$1�H�����H��1�H��tH����H�T$dH3%(uH��[�����ff.�@��SH��dH�%(H�D$1��������@����H��H���e�H�������CXH�@H9Cp�l��H�����H�$1�H�8H�HH�GH��H�ʍp�H����������H�D$dH3%(uH��[����f.���UH��SH��H��dH�%(H�D$1������t���t)H��H����H�L$dH3%(u1H��[]���{Xu�H�{H������H�$H��H���w�������ATI��USH��H�dH�%(H�D$1�H�����H��H�$H�����U1ۀ� vrH�$H��H9�tw�T�� w�H��s�1��� I�|$@��H�It$0H�4$���I�|$H��H�����H�L$dH3%(u,H��[]A\��H�$H���z����f�1���������H���?�ff.�@��H��1��"�f�����f.�ATI��UH��S��H�<���H��H�5[�H�1�H�����H��L��[H��]A\�b
��f���UH��SH��"H������3@��u*�U@�\H���k���3H���`��H���3@��t-@��
t�~<@��"t�@��\t�@��x�H��H���/���3@��u�H��H��"[]���@@��
t������H��tG�1�1Ʉ�t$<
t0~&<"t<\u"�A��w��H�����u��s"��<
t��y������H�5���_	��ff.�@��H��H������H����fD��USH��H�������H��H��1�H����u�-f�<]u'�BH�����t.�H߀�]w�<{t��"<:w�H��s�H��H��H��[]�T4��@��t�H�5��H���
�����t�H������H��H��H��[H��]���ff.�f�AWAVAUI�&ATI��H��USH��H�����H�xI���4��N�4;H��M��u�?@��
tH��H���n���I9�t(�3@��
u��C< v� �אI��s�H��I9�u�H�����H��L��[H��]A\A]A^A_�0���UH��SH��H��dH�%(H�D$1�H��t{H�5��	H���
��H��tgH���O����@uIH�=��].��H��H�މD$���H�|$������1��H�D$dH3%(u)H��[]�DH��H��������H��H���������ff.���AWAVAUATUH��SH��H��H����I��L�<H��1�A�E1�A��@���D@I����H��L9�t9�<
��<"�(<\� < t���AH�H��1�E1�L9�u�@��t	E���*@���QL9��%L)�1�H�56�H��H��A�I�&�Q��H�CH�D$�� �@����H��E1��\���1�I��M9�t1A�6@�� w�I��sф�u� H��I���,����M9�u�f�H�s��t	E����H+t$H9�����H��[]A\A]A^A_�f���t,D�@�A�������@�����������fD�1�E1�������H��E1����1��?���f�I��L9�����H��H�ߺ[H�5��]A\A]A^A_�!���H�߾"H�T$�N���H�T$H��H�����H��H�߾"[]A\A]A^A_�#���H��r
H�t$H������H����H�s���f.�f�ATI��UH��SH���>4���H��DPt9L��H����"���¸��u[]A\�fDH�|�[H�E�����]A\�H��H�=ơ1��%��[H�E�����]A\�f�ATI��UH��SH���3���H��DPt9L��H���&���¸��u[]A\�fDH���[H�E�����]A\�H��H�=F�1��'%��[H�E�����]A\�f���AWAVI��AUI��ATI��U��SH��L�D$dH�%(H��$1�����@����H�\$p1��H���H����L��H��H������������L�D$hH��L��$�Hǀ�����L��H��$���$��4/����~0H�|$hH�5����J�����t(H�r��1f.�H��$�1�H��$�L��$�H��$�H���������H��$�H�����8��L��$�M��tWA���tO<;�<:��L���f.�<;�<:��H���E��u�M��tI9��`fDM��t)�o�$�AE�o�$�AM��$�fA�E H�h���$��4H�T$@H�t$0H������Ņ��������$���1�L�D$hH��L��L�$�E��L�$��tu��H�ȡ@����H�t$hH����>��H��$�t?1�L��H��L�$�������H�t$hH�|$pH��$��g	��L�$H�E`�L��H���������H��$�H9�$�����H��$�I�$H��$dH3%(��H��[]A\A]A^A_�f.�tH�D$xH�\$H�������f.�H��@��u�H�T$@H�t$0H��蒸���Ņ�x�L��$�H���M��t�L��$�M��t>H�|$pL��L�����A�E H�|$pfA�F I�u(���H�|$pI�F(I�u0�q��I�F0��$��?���H�D$@�L$0��D$4�D$8H�D$H��$��L$I��H�D$ H�D$HH�D$P�+��H�$M���
L��$��L$M��A����A ��H�D$H�����D$L�8H�l$L�t$XM����
fDA�?t]H9l$rE��uH�$H�xtH�<$�/�e���H�u1�L��H���������^���L�l$XL���/��H�<$L��E1�H�����H��L�}M�����;L������H���v����
H�5ޛH��H�D$(�]���L�L$(����M9�tqH9l$rE��u#H�$H�xtH�<$�/L�L$���L�L$H�uH�L$XL��H��L�L$����������L�l$XL���n��H�<$L��H���/���L�L$M�i
�;L�L$L�����L�L$H����
A�y
H�F��K���H�T$8H�{L���3������-���D�T$8E����
H��L�uM���l�H�5��L���X������D�L$4E����H�l$M��E1�E1�A�?�H�D$H�x��
�t$4��@��H�|$ �����H�$H�x�5�D$8L�|$ A�G@�D$4A�GDM��tL���C��H�|$pH���V��I�GHH�L$ A������$��A	�H�D$HD���H�APH�D$PH�AX�2���M���I9��vL�D$hH��L��H��L��L�$�\���������H�t$hH�|$p����L�$I�E(�};�h����}�H�u�BL��H�=�1�������f.�L��D�H�5n�H����������EH�uH��u�@����H������)����Hƀ�w���L��H�=՘1��E���7���H������@���h�������H���?H�\$pH��H���H����L��H��H���A�����7����$��I��H��$�Hǀ�����HDŽ$����@�};�&����}��
M���A���L�D$h1�L��H���������k���H�t$hH�|$p�J���o�$�I�E0AU�o�$�A]��$�fA�E �����T$4H�$��@��H�x���D$8H�L$ �A@�D$4�AD����H�D$H���ZL�8�D$E1�����f.�A���E1��t��uA��I�GPH�D$HI�GXH�D$PM�wH�D$M��teL���L$�\���L$I�,I9���	��u�	f�H��I9�t�}/�A�u����Q�������D��L�������D$E1�A�GDI�o8���������D$4H��tcA�G@H��L$(�D$8�����L$(H�TH9��M���@H��H9��3�:/u��D$8��u�H9����1�H�|$�"H�L$L�9A��t	M����M����|$4�������M���u	L�|$XH�l$H�D$(H�D$XH�D$�fDH��L�}M���6L�|$X�;L������I��H�����|$uI�~ukA�?t�H�L$1�L��H���C��������L�|$XL�����L��L��H���p����D$끀z�/H�<$H����H)�D$(�O����D$(���D�/L���s�L�|$X�@���q���H���j���E1�H�<$�'���H�|$pH���:��H�L$ H�A8���@H�!�M9������*����L$(H���s���A�G@H��D$8�����L$(H�T�z�/�
�������<������I���;L��L�t$X�z��H�D$(H��t'H�}H�t������H�t$(L�����H�D$XI��A�>H�_������H�T$4H�{L���w���q���D�D$4E���IL�uE1�H��M���GH�|$(H��������H�5�H��$�H�D$h�����}����H�n���$�����H�D$(�;L�HL��L�L$���I��H��teL�L$H��H+t$(H�L$<H��H�T$hL���	�����*�	H�5j�L�������H�|$h���H������fDH�|$(�	H�5+�������H��tH�D$hH���H�*���$��;���H����$��&���H�D$(�:H��	H��H�D$���I��H���|H�i�L9|$���H�|$�+���I��H���uH��L9L$���I�qI9���H�L$`L��H��L�L$��������H��thL�L$H�t$H�|$pL���s��H�t$`H�|$pH�Ep�P���H�ExL���4��H��$�H��$�H)��$��H��H�|$p�&��H�EhA�?�^���A�H�E��
�M�G�:L��L�D$���I��H�����xL�D$��H�׏M9����H��tH�|$pL��L�����H���I�GH��H�D$�x��H���H�x���f�L9���H�}H����l�L��L��L�L$�E���|$L�L$H�D$XuI�~�01�H�L$XH��H��L�L$�������L�|$XH��L������L��L��H����L�L$L�L$(I�~��L�}M��������	H�5ސL���%����I��	�;L��L�|$X�W��I��H��tL��H�����L�l$(H�D$XI��A�?�}�.L��� ��I��H��t]A�}H�ߎ�]�H�T$PI�uH�{������>�H�|$PH����0�H�|$XL������8I��H�D$X�H�T$HH�{L���z������L�}H�EA�H�D$M�������H�|$(���L���P�}��H�=^�H��1�������E1�E1����D���������f��D$4��@���x��L$4��@��������I9��(����}�/��L$(�D$���I�wHH��H��I��H)����L$(���H�����H�D$(E1�	H�5�L���R���uR��d��I��H�EL�x	L�|$X���L�}H�l$���H�|$(�P�r��H�=��H��1������L�}E1����A�����H�����L�|$L���O��M�<H���|���H���]�H���+���H�t$H�|$pL���;��H�Ep����H�����H�|$p1�H�5�H��1�����H�Eh����/L�����H�D$XL�L$���H�	�����������������H�|$L�����H�=��H��1������H����L��H�=�1������H���������@H�����H�|$H��I�������xLH�����I�H���I�GH����{����H�
��+�H�Nj��H�ϋ��H����H�����H�?����H�D$(M��H�l$����L�|$(�n��������ATUH���S�+��H�5�H��H��蹤���H�5��H���5�H�U(H����H�5Z�H�����H�}0���@H���A�H��H���6���u H������/H����H�U8H��tHH�5H������U@���z�UD��usH�}`t �?H�����H�U`H�5�H����H��[]A\頴��H�}0�t���H�ߺH�5���a�H�U0H�5��H������;���f�1�H�5��H���?���H�}Ht'�
H�5q�H����H�UHH�5SH���Q�������H�}p�]���H����t9�H�5ފH�����H�������H��I�����L��H��H�����	H�5��H����L�epL��趾��L��H��H���x�H�}x���H�߾+��H�UxH�5�H���������H�5u�H��1��?����UD���q���������
H�5l�H����H�MXH�UPH��uH�5�gH��1��������H�5D�H��1���������f.���ATI��H��USH��H�����L��H���\��I��H��E1�H�
=D[H��]H��1�A\���f.��L�A�<*tu���=�HЀ�	�1I��E1���D�P�L�IA��	��C��L�D�DH�A�L�Ʉ�u�A�����E�����E��<:t#D�1�D�
ÐI�IA�����H�A�AE��<:u�H�AH��A<*tpD�P�H��E1�A��	��G��H�H��F�LH��A�D�P�A��	v�A���tZE��tgE9�v�D�1�D��f�A����Y���A������Z���H��A�����1�H�D�D�
�f�A�����E���8���A������f.�������f.���AUI��ATUSH��(H�|$L�d$H�l$H�\$dH�%(H�D$1����t3L��H��H���V�����xB�T$�t$L������H�D$���,t5��u!1�H�L$dH3%(u.H��([]A\A]�@�������f�H�PH�T$�@��,���ff.����SH���ö����xH�߾������[����ø����[�@��H��H�<$H�������xH�$�8������H��ø������f.�AUATUSH���*������H��I�ԃ�����ǍE���	���(f���wnf=���������U���<�U�����<��	ύ�$f������
��H��%�	�������1�H��[]A\A]�@L�kf��tG��H�����H�CL)�H��uH�B�(�� <^v �U1���A�$H��[]A\A]�f�������f�AWAVAUI��ATUH��SH��X�7H�$dH�%(H�D$H1�@����F�H��<^�N@��&u)�,H���3@�����F�<^�%@��&t
L���W���H��t�H��H)�H�<$H��L�=Ί�9�H�D$@D�#H�D$H�D$DH�D$E��tIA��L��L�s���
���A�T$�^wH��tSA�UH�<$A��1�H�5̉���D�cL��E��u�1�H�|$HdH3<%(�mH��X[]A\A]A^A_�fDA��&���C<-�2H�<$A��D$@H�H�|$8<��7�SE�$A����$E1�H�\$ 1�E��L�l$0D��M��L�t$(�A�UE�$A����D��A��D�s��A	�D�D,DD����;l$@�A�EH��A�<��QA����A	�D�d,D�݃�;l$@�I��A�E<-�IA�<�tiA�UE�A���tY�T$@D��D�s���@��D����	���DD9��>���H�T$H�t$�D�D$H�<$�y���D�D$������H�\$ L�t$(L�l$0A�U����H�$H�|$8H;x��H�<$H�5��1���D�cL������f.�H�T$H�t$�H�<$����������fDH�T$H�t$�H�<$�����������[���H�<$������D�cL���g����H��訶��H�<$H��H���i����@H�<$�&H�����D�#�$���DA�}���������Z���H��H������A�U���E��M��H�\$ L�t$(L�l$0��-�����I��E�ًD$@9�t-D��H�T$H�t$L�T$)�H�<$�����L�T$�������E�bA��&t	I�Z���A�z-t��c���@E��M��H�\$ L�t$(L�l$0��-�A���I��E���A��M��H�\$ L�t$(L�l$0�f���1���������ff.�����B�<	v�J��������w)�B��O���A�<	v�y������@��w�D��1�����@AWAVAUATUH��SH��H��8@�t$dH�%(H�D$(1������<&I����<��	�<�����@8�u�fD8D$t(I��A����J<&��<@��	�<@��@�t�L��H)�H��H��L�%߆�J�L���r���H�<���H�D$H�D$$H�D$A�7@����@:t$��@��&��F�<^��L�t$@��uM��fDfA�I��A��<�vH��~/H���>���I�A��P�^������H�t$L��������~e�T$$�D$$f��=��v�����f%�I����
f-$f��(f��f��fA�F�fA�v��p���H��I�����A�7@������1�������H�L$(dH3%(�'H��8[]A\A]A^A_��H�\$�&H��I)��+��I�����D�H��I��H��D��D�D$����?A�4���D�k�D�D$H��D��A��@��A��0@��A	�Mc�C�4����D�C�B��H���<D��D�D$@��@��	�H�A�4���D�D$H��A��?C�4���I���V���M��ua�-H���d������H�t$#I��J�������A�7@��&���@�H�5ׂH��I���������H��ƈD$@����?A�44�����D$����0I��tX�[H��������<��	�H�A�4���A�4H������-H������6����t$#H��I������ ���H�H��A�4�{������fDH���X���H��H��H����1����1�����&H���?������H�\$���軲��ff.���H��1����f���H��@��&�1���@��H��������ATUS���t@<��<&���uC<t?H���f.�<&A��<��A�u <tH�����u�1�H�>��[]A\�DH���@H�����H��I��H���2�L����H���H�E��[]A\�ff.�f���H��H�5��	�-���ff.�f���H���>&�z����
����������H���ff.�f���ATUSH��dH�%(H�D$1�������P�H��H�l$��^v�_�H�����tm�P�^wE<&u�H�=���-�����D$�
��H��H���$���H��A���ɛ��������E��y�@1�H�L$dH3%(uH��[]A\�D����̰��f.�f���AUATI��UH��S��H����L�o�������������������� ��H��u2�9f�H��H��贮��H��L��H���v��� L�����H�]H��u�I�t$I9�t
H����H��[]A\A]�
H�5��/�����b����	H�5��L��������N����	H�5�L��������:����H�5ЀL���������&����H�5��L������� �����H�5��L��������XL��[]A\A]�Z���f.���SH�5|�H���̔�����tyH�5n�H��贔�����taH�5_�H��蜔�����tIH�5P�H��脔�����t1H�5>�H���l������tH�5-�H���T���1҅������[�fD��AU1�ATUSH��H�H�AH�H�v��t[��H��L�%��L�l��f.��,H�������L��H��1����S9tH�5��H��1��|�H��L9�u�H��[]A\A]�����>tGUH��SH��H��H��H��H��0����;t� H���Z�����H��[]�f��ff.�@���>�CUH�SH��SH��H���Hc�H�>��@H���(���H��H��H�5�~H��[1�]��fDH��H��[H�5�g]�~��fDH���@��H��H��蕫��H��H��H��[H��]�Q���H������"H��H���x��H���`���H��H��H���"�H��H��"[]�O����(�>��H���&�H��H�����H��H��)[]����H�����H��H�����H�5�fH��H��1����7���@�ff.�@�������AVAUATI��UH�-~SH��w/HcD�H�>��@H�����H�5�}L��H��1��L�@H��0�;tM� L���b����fD�(L���K��H��H��0�/�L��H���d����)L���'���;u�[]A\A]A^�f�H�����H�5��	H��I������L��H��tn�٩��H�5�|L��H��1����X����H�5�eL���|���?����H���8���H��I��荩��L��L��H���O������f.��k���L��H��� ��"L��I���`��L��M�t$�C���L��L��H��������uJL������1�L����tD�� ��^v�?H�����u�"L��������fD�L���ߨ��L��L��H������ff.�@��UH����SH���I��H��H��H���k���H��H��[]�}���f.�AUI��ATUSH��dH�%(H�D$1�H�G(H�H�hH�H9�t I��DH�L��H��H�$�Ջ��H9�u�I�}�Nj��I�EH��t	H�L��PH�D$dH3%(uH��[]A\A]�蕩��D��AUI���ATI��H�=^{USH���{����8H��H�H��PH��@H�����H��H�(L�`I�$L�kH�C���H�C0H�{H�C(���H��H��[]A\A]�f.���AWAVAUI��ATUSH��8H�o dH�%(H�D$(1�L�t$pH9���I��E��L�GH��J�"H��H)�L9��WL�t$H����L�H�k E����A��B�4�L��D�$裙��D�$H�
H�	L��H�-czH�D$E��HD��-��H�=[zD��H��H��1�����H�|$H���ɏ��H�|$L���<��H�S0H�{(H�t$ H�D$ �5��L�����1�H�\$(dH3%(�H��8[]A\A]A^A_��L��L�l$�S��또H�wH�H��D�L$H�$���H�{H�D$�y��H�=�yH��1�����H�|$H������H�S0H�{(L�����H�$HKHK D�L$H�����H��H�T$L�$�!��L�$L��H�T$H��H�=�y1����I����������H��H�$����H�$H��H�=5yH��1����I���������������SH��H�dH�%(H�D$1�H�H�sH�SH9�tW�ި��H�{H�����H+S �#���H�{H�$�f��H�=�xH��1�����H�<$H���	���H�S0H�{(H�����H�s0H�{(����H�S01�H��莱��1�H�{(�C���H���K��H��H�$���H�$H�L$dH3%(uH��[�D苜��H�$�����H��H�?H����f.���U��SH��H��dH�%(H�D$1�H��(tH��H��(���H����|���H���H��t
H�H����P@��uH�D$dH3%(uH��[]��H����$�����=���ff.�f�ATI��H��UH��SH���+�H��L��H�����H�x[]A\ÐH����1�L�
.z� D��H���O Ic�L�>��A��=�RH�W@H��G H�D�W$H�G0�G(���G(9�v���#H���f.�A��
�
�8�O$������G8D�G(�G E����D�G$�H�O@L��o/H�	H�LH�O0A��A�|
@���G(�G fDH��H9��l���� D�������f.�L�1o/A��A�|
@����G �H�
o/B�|@�tE�G ��L��n/A��A�|
@�t
�G �y����A��
��A��
���G9H���H��H9��e����f�D�G(�G A9��������A9�u��G(����A��=u��G ����fDA��=u��G(�W$�G ���G(���X���9��P����n���f.��8�Z���D�G(�O$A9��z���fD�G ����@�G ���@AWI��AVAUATUSH���dH�%(H��$�1���H���1���I��xI��8ALJH����I��t1�A�$L�vH�
�wH�Wu����L�%Am/I��8I�<$H��t
H��P I�<$I��@ILJ8H��tH��P ILJ@I����c���f�A�8CC C0C@I���ALJt����� �����H��$�dH3%(��H���[]A\A]A^A_�DL��xL��pH��H�D$HH��x�*������2I��Pf��HDŽ$�)�$�H��$�I��h)�$�H��$�����I���H��H������H������E��qH��$�E���A��X���XI��hH���@ALJXI9��I��xH�D$H�H��H9�A��\��uA��`A��\�����I�� A���D$4�����H�Mk/�H�8谺��A��t� H��$�����I��hH��H�D$`�����|$41�1�H�D$h���H��H�D$p���H�k/I���f��$�H��$��-���H�T$xL�t$H��$�H�l$H��$�H�|$hH��H�\$�H��I��H�L$(H�T$ L�$$�H��$�1�M���.���H�t$xH��L��L��$�H��$�讐�����4���H��$�H�|$h�t���H��$�H�|$pH�PH�0諜��H��$�I���H�PH�0�P���H�|$h���H�|$hH�������H�H�H��H���8�H�H���M���L�$$L�t$H�l$H�\$H���tqL��	H�
ft1���H�5HrH�=���l���@H���1�H�����H�PH��u1�H��@�������H�0���I���H�P��H�|$h�O���DH��$�H�D$H�|$�������l���H�|$p�ʪ�����QH��$��e���H�|$h���H�|$p�1���I��xH�T$`H�H9�0E����H�|$`�v��H�|$4A��1�L�RqH�
[sH��p�_����I��xI��0AƇqH��$�H�H��$�I�� H�t$@H��$�H��A������� L�l$XH�l$PA��t���H��H�D$8�,@H�T$XH�t$PH�|$@茚��H�|$8H�t$X�-���H�|$81�L��H���;����C������H�|$8�G��uzH�|$8���I�� H�ھH�|$@A������H�|$H����������������I��h���I��0H��$�I��x���D賀��H�|$8H���ּ��H��H�=�H��1��r�H�|$8H��5�H��1�H�|$@I�� A���c����H�D$HH��t	H�PH��u-H�|$H�C��I��xM)�A+�pD)��+���f.�H�0L���5���H�|$H�����H�|$`�O}��E������I��x����1�I��tA��L�oH�
qH�`n�!����D$4A��qA��tI��0H��$�����A��\��$�A��p��$�H�}u%I���H������H�����H��$�����1�H��薥����H��e/�H�8�0���H�$L�l$(H�D$HH�\$ �,H�t$xH�|$HH��$����H��$�H�|$`迈��H�|$`1�L��H���������՜��H�H���H�$H������H�|$`�W����H�|$`�{�����I��x�4���I��xH���E���H��H�=�������H��1��L�H��e���诙���Z~��H�|$hI���}���L��H�=�mA�H��1����H��$�H�D$���H�|$p跻��H�|$pH���ʑ��H��H�=�mH��1���H��$���|��H�|$h�/{��H�|$p赍�������}��H�|$`H�����H��H�=\mH��1��Z�H�|$`��z���u���ff.���AWI��AVAUATUH���SH��H��xH��pdH�%(H��$�1�H�D$8L�d$@H�D$H�D$`H�D$H�D$4H�D$DH)�H��H���Z�H9���I��(L��I��xI+�p������t?��uk1�1�A���H��$�dH3%(�	H�Ę[]A\A]A^A_��H�t$8L���c������I��xI+�p1�)�H��DH�D$@I��0H9�tH��tH�t$L���������_H�D$@L�t$HI��0M����A�FPuI�VH����I�V8H����I�VH���5A�FP�u!��<�H�5C�	L����A�FP���M�.H�5��L���|������H�5�jL���|�����
f.�I��xI��pH��H)Ή�)�H�H9���A����G�����~���DH�T$XH�����@\u�I��H��t3H�D$`I��8I�� H�|$H�D$hI��@H�D$p�҄��m���I���ALJHH�I��P�L���@A�NP �>���fDI�vL����������H�5�	L�����A�FP���f�I��@H��tH�a/H�8H��P ILJ@I�v(I�~ �\���I��@���A��HM��8���y���Y�������A��qH�t$PuA��XtL���g�H�T$XH�t$PI������H�T$XH�t$PI��x�����F���fDI��8�2���I�V(I�v 1�L�t$L��蛿��L�����H�=�i���@�D$4���L��H��I�����L���#���H�����H�|$I��8�z��������H�D$hH9D$`������
���DI�v0L���\������I�6L���E����H�����1��+���ALJHH�QH����H�T$XH���L���@H�t$PL�����6���fDI���I���H���H�AH�H9�sLH�t$PH��� ������I���A��� �RA������ILJ0H�����1��z���A��t��8���H�L$(I�� L�L$ A��L�L$ H�L$(�������A��t1���H�L$(L�L$ �>��I��xH���?��H�L$(L�L$ ALJHA��qH�QH�1u-A��Xt#L��H�L$(L�L$ �
�H�L$(L�L$ H�QH�1I���L�L$(H�L$ �v���H�L$ I��xH�QH�1螐��H�L$ 1�H��违��H�T$XL�L$(�(���H�T$8H�5|:L��1��
��ALJ����H��]/L�L$ H�8�&���H�T$XL�L$ H��I���I����M���H�1L�������H�T$81�H�5:L�����H�����1�ALJ����1���������ff.���AUf�ATUSH��(dH�%(H�D$1�H�>)$H�D$�D$��H�~H�������H�~(�����H�~0�X���H��\/I��I�վ�H�8H��P�H�=Peǀt�����oMH�����oU���o] �H�E0L�� H��ƃ�H�EI�D$H��XH��XH�(���H�CHH�-�H�C ����ƒ�����A�T$��	Ј���ތ��H��L��H���H���9���L��H��(���1�L��H�߉�苷��H�L$dH3%(uH��([]A\A]��{���ff.���H�G������U��SH��H��dH�%(H�D$1�H���tH��H������H���H��t
H�H����P@��uH�D$dH3%(uH��[]�H����Ķ�����ݏ��ff.�f�SH��H���dH�%(H�D$1�H��H�$H�������HLJH���B\uL�#H�5xf�[H�$H��H��H�PH)�H0�>H���s��H�D$dH3%(uH��[�HLJ�H�PH�0�	���"���f�H��t[ATI��UH��SH��H��H��tH�GH�H=�v;H������H��H������H��L��H��肮��H�x[]A\�fD��[]A\�߻��ff.�@UH��SH��H���FPtH�SH�sH���^����CPt(H��[]ÐH�VH�6�D���H�S8H�s0H���4�����f�H��H��[H�5?�	]����fDAWI��AVI��AUATUSH��H���D���dH�%(H��$�1�E���H��u
A���H��$�D��H���H��H��H�D$����M��t5���D)�I��L9��&���H�D$L��L��M�M)�H�<(��2������u�H��L�l$`�s���L��L�d$ H���N��H�t$f�1�H��X/M��H��L��D$,D$<D$L�D$\H�D$ �D$(H�D$0�����Q��L��L��薺��H�D$h��H�xǃ�I���o��L�l$`L�d$ H�X/I���������H�D$�@I��L�LIF�H��I��H��H�,RH��I��H��A��ʃ�v
A�A)�C�,RH�UH��D�T$I)�H��I��H��H��H��H�T$�M��H�T$L��H���-��f�H�D$1�AD$L��M��H��A�D$<L��I�AD$AD$,H�D$ �D$(H�D$0�����-��L��L���r�����D�T$I���������H�D$hH�xD�I����vB��������H������
1�I���������f�ǃH��x����M��u+H��$�dH3%(��H���[]A\A]A^A_�f�H���D��E��t1��ƒ�A��9�r�D����D�H������
f�ǃH��x�_����LJ�����a���跊�����AWAVAUATUSH��H��H��8H���H+��dH�%(H�D$(1��d��H9���L��xH��pH��H���M��I)�����������u+1�H�L$(dH3%(��H��8[]A\A]A^A_�fDH���H9$tH��t1�H�5՞	H�����L�t$M����M�>H�5R�L���]o����u
��M�>L��H�5\`�@o��E�~P����A����A����I�~��I�~�H�5Bj	�?�����u{H�$�@\uqH;��thH���ǃ����H���ٍ��H�eT/�H�8�ȣ��H�t$H��H���d���H��H�@H���4A����H����H�������H�5ǝ	H�����H��xH+�pH��L)�H�I9��c���H������V����H������������1�H�5C�	H���+���H��xH+�pH��L)�H�I9���������fDL��H������d���H�T$H��uFH��H��t&Hǃ�H�PH��H�0����H���k����������H�t$H���H��H9$tC�������H������k���@H������ �@���H������D���D�C�������#H�5Z^H���:�������P�����UH��f� SH��(dH�%(H�D$1�H�cR/)$H�D$H�8�D$H��P��H�=�]H��H�EH��XH��XH�-���H�CHH�r���H�C ����ƒ������U��	Ј��赂��H��H��H���H�����H��H����ў��1�H��H�߉��b���H�L$dH3%(uH��([]��V���fDATI��US���H��H���txH;�Pso���H�NH��H9�PvH��H��HH�h���3���uӺH)�H���H��<��I�,$H9�P��[]A\�f�H�ź1���@���1���uƇ�
������t+����Ƅ�1���������������vىƒ�Ƅ�
��ff.����AVAUATUSH��H�� dH�%(H�D$1�����H��xH�$����XE1�H����ɷ��H���pH�l$H��H��H���-e������H��xH���H��H�$�˜��H�l$I��H����H��P1�H9$��I���wf���u$A�<,
��L��H��������������u0A�,<
�^<
�nH�$H��HH�HH�$A�,�H��H9l$vXH�$H9�PvK������������m���A�,<
�0<
�h�����������H��H���H���1r��H�$H��xH9�t�È��H��xH)�I�M���u���ψ��f.�H����t��H���H����Έ��H���Hc�Q�������H���{�������M��u~H��xH�$H�����I���dH�T$��Qc������H��xH��H��H�$���H�$H��x���tG��� H9���ч��H��xI��I)�H�L$dH3%(L����H�� []A\A]A^�H9��w��������I��H��xI)��b����H����$���H���[����c���fD������A�<,
�����ǃ����DA�<,.�����ǃ�����fDǃ��������f�ǃ�������f.�ǃ��~������� I�������DH���R����A �?���H�5YH��1�����ǃ� ����D������=���H��H�����H�$H��xH9������t����@����H������I���d���I������X���ǃ�H��H���/�������������3���H�����M�����������貀��H�l$������H��K/ATI��U����SH�8����H��PL��H��I�D$���H��X���H��XH����	�H�CH������ƒ�����A�T$@���ǃ���	Ј���Y���L��H��1�[��]A\���fD��������9r�����f.�UH��SH��H��H���H������H���H���H���H���H�@������tH����F�����XH��0ǃ@f%�o��f��XH��[]�f���SH���H��tH�����H��HtH��H�b����Zt+H���HǃH��t,H�H���[H�@��H���|b��H���H��u�[�ff.�UH��S��H����X� u"@��t�@uH���
���fDH���H�5h�	萫����Y������	ރ�@��YH��[]�ff.�f�H��H��H�PH�H��@H��H+�xH+�pH��H��?��������H��xH���f.���SH�G H��H�O(H9�t'H�(�na��H��H/H��[H�8H�H�@ �����Z���r������Z��DUH��SH��H���H�@���9��t1������Xu8H����!DH������H��H���k����XuH���,��H���u֋��1�����H����[]�U�SH��H��H��H�$H/H�}H�8HCu����H��H�UH��H�u���H����Z�H�H��@H��[]�f�UH��SH��H����Zt�v���H���1�H��HǃxHǃpHǃ@H��[]�:���f.�ATI��UH��SH�� H���dH�%(H�D$1�H�t$�!���H���H�T$H�H��H�H	�tWH��H9�8t"H��tY�T�I������
H�����HE�H��8L��H�L$dH3%(�@H�� []A\ÐH��8H���t�H�����I���tH������D�A t�Y���Z��H��1�H�D$�5���H�D$H�T$H��H���L�����X ��H���
�n���H����YH��8HDžpH�PH��xH�H��@1���X ��H������@�A �����
�����Y�;���镀��H��H�D$�{���H�D$�)����H���
�Ϟ���K����Uz���Z�����U��@��SH��H��H���dH�%(H�D$1�H��莚������H�$�o���oH���oP ���oX0���o`@H�������ohP���op`��oxp��o���(��@������XH����uH�������0��X��x0��Y��t~��to� H������H��H���
H��H��H+� H���H��H)�H����V���1�H�L$dH3%(��H��[]�f�H��8�tH���H���fD1��@H�$H���H�p0H����H������H����P��uZ�@ ��~��H�����H���=���H��~�H��H���/���H����@���������7���������-����,x�����������ff.���AWAVI��AUATUSH��dH�%(H��$�1���Y��	��X��H���H�� H9�rx��X��	H��H�H���H)��޺��I����¸��H��A��Y��H��$�dH3%(H���-
H�Ĩ[]A\A]A^A_�DI�����A��ZtL��� ���I��I��pI�����1�H�����I��xI+�pIdžpI��xI���Ձ��A��X�t,I��p��}��M�� I��xI��L9���I���聾��H��H�D$I��H;X��H�D$8H�D$H�D$@H�D$@I���H�t$����Å��UL�|$8A�GPL���u
A��@A�GP���A��X�D$@��A��X�tl�uhA��Y� ���rPL��@�����-����x����H�|$H������L����b|���H��L���u���H���,���DI��H��t�I��H�T$L��L����A��Y��@�|$@A��Y�6�� A��Y���@���A��Y���D$@I��A��XH������������A�GP��I��H��I��@I��HH����i���L$@H����A��XA��YfD�΃���I������	�A��Y8�tbH�D$8�@P�_H�pH�P袡��H�D$8�pP@���'I��I��0H�GH9���H)�1�I��0�3��I��H�GH9D$�����H��u8L�����H��H�|$8��H��������uz��I��H�GH��t$H��|�
������A��Y���	�A��Y����I����P���2A��X��z���A��Y@���h������D$7A��X@����A��X�������D$7A��Y t���D$7f����LA��X�����A��@I��L��L���l$@A��DH�T$��A��Y�L$@��@A��Y@8���H�T$8�BPA��X�
���������I��HH���	I��PI��@辟���L$@A��XA��Y����@A��������D$@�&�����L$@A��Y���fD@��L�����y�����@H�PH�0�D���H�D$8I��H�P8H�p0�+���H�D$8I���k���f.�A��X�#���I���A��E1�H�D$ I�H�D$(fDH�D$ K�T%H�|$(H��H�,�H�$H���N���H�$��xtDL�jM9�r�1��D$@�?���L9�v�I���fDI���1�1�� b��I�������@H������L����H�Ņ�����������I��M)��L�|$@I���L������H�L$@I9����BI�������I���H�ŋGA���A����W��߃� 	�A���H����I��H�WH�H�T$@H����w��A��Y������|�
��H������� ����A��X ��
觔��I��H�I��@H�hI��xH+l$@�������L$@�>���@L������H�L$@L��I��J�4 H)�H��
���I��H�BH�D$@H�H��I+�xI+�pI��@H����v��I��x�)���f.�H���j���I��pIdž0H�G�O���@I����,���Idž�A��XtfA��X@t=I��H��t11�L���D$@H�T$@I����L�����A��X�UH�A��Xf%����fA��XI���H�I��I��xI��I�� H���G���H�|$8�.u��L�����H���+���@H��9/� H�����H�8����IdžPH��I��H���I��H��tRf�H�!�	H�T$7L���$�I��H�t$@D$HD$XD$hD$xH�\$@��$���A��Y@�D$7���A��� H������k���A��YL��@���������@��L�������E���H��������s��fDA��Y��t��H�QI9�������rt���A����@H������� ��A������	�A��������
覑��I������%m��H�T$8�+���ff.���UH��SH��H��H9������Y�H��tw��Xu	�Y���xUH��H���:�H�� H9�sH��H��H��[]���DH���H�H�H)�H���H��[]�ү��f�H��[]�f�1����H��H��1�[]��f���H����f���H��H�H9�@t	鴪��@UH���0SH��H��H�H7/H�8H��PH�
�H�X H��H�HH�P(H�(��ZH��[]�@��AW��AVAUATUSH��8H�|$�t$L�D$ L�L$(��s��H��6/H��A�Ͼ`H�8H��P�H�=1EI���g��H�T$I���H�RH��XI��XE����Idž�H�y6/E����H�8�Յ���\$I��H�D$ I��H�D$(I�����������A��X���	Ѓ�@A��X���ƒ�߃� �D$D�A��X�\$L�������A��X����	�A��X������݉�A��Y�����T-��	�	�H�������I��8A��YH��H�t$I�F(H�9�I�FHH�.���I�FPH��o��I�FXH���I�F`H����I�FxA��������A����^�ك�	�A����^���و\$��	�1�A���H��8[]A\A]A^A_鲐��f�H�D��H��H���RI��I���A�G�E1�H�D�H�D$�
M���L�eE��tA�G�L��I�|��N����t(��p��I���D��L��A�_M�l�A��跞��I�EH��H;l$u�����@A��X�_������SH��H����ZtH�T$H�4$��H�T$H�4$H��������XH��[�f.����ATUH��SH�� H���dH�%(H�D$1�腛��H���H���H�t$諀��H�t$H�T$H��I����H�����[H�\$H�D$H9���H���p��L��H��1���{��H��xH�HH���L)�L��H��H���͇��H�t$H9�v4A���u���H��HH�H�xH���H�t$H9�r�H�xH����LV��H�D$H�L$dH3%(��H�� []A\�f.�H�D$H���8���蛾��H���H��H��~�W���H���Xo��H�������f��G�������O��߃� 	Ȉ��Hc…��l������fDL��H���͆��H�t$�4���H������@����g��f���H�52/ATA���UH��SH�8H��PH��H��H�EH��X���H��XH���H�CH����ƒ������UD�����	Ј����~��H��H��1�[��]A\�`�����ATI��U��SH��H��dH�%(H�D$1�H9��w+@��L��H����H�D$dH3%(ukH��[]A\�H���1�HLJxHLJpH���HLJ�H����+���H���H���|v��H���1��p���v����e��@��AWAVAUATUSH��H���H��8dH�%(H�D$(1�L�l$L�d$�e���L�|$ L�t$H��H��pH���H����H��xH�H��@H�GH9��Em��H9���H����H���L��L���K������H�T$H�t$M��L��H����t�����#H���H�t$�RS���e���DH;W� m��1��G���H��xH+�pHǃpH��xH����A���H�����H�L$(dH3%(�H��8[]A\A]A^A_�fDH9�HG�H��xH)���DH����r����R������� ���	ʈ�����u@��u<H���H�t$ �t������H���H�����H�z�Y����l��DH��H���f�H�D$H�t$H9��7l��H)ƺH�l$ H��HG�HD$H���ۄ��H��H�5)?H��H��1����H�����ǃ������Yc��H�T$ 1�H�5�>H��賨��H��ǃ� �����U��SH��H��H���tH���諡��H����F��@��u
H��[]�H���H��[]龉��ff.���ATL�%./��UH��SI�<$H��PI�<$��H��H�EH��XH��X�<}��H���H���}W��H��H���H�<���H�C H�����H�CHH���H�CP����ƒ�����U��	Ј���U����	Ј���gz��H��H��1�[��]A\��@��ATI��U��SH��H9��w@��L��H��[]A\锼��@H���1�HLJxHLJpH���HLJ�H������H���藗��H���1��yl������ATUSH��H�� dH�%(H�D$1�L�d$H�l$H��pH���H����H��xH�H��@H�OH9���i��H��XH9���H����H���L��H����F������H�T$���u	H����H���H�t$�{[��H���H�t$�*O���^���DH;W�pi��1�����H��xH+�pHǃpH��xH����:���H�����H�L$dH3%(uxH�� []A\�H9�wH���H��F t��� H��xH)���1��@H����P����@�� ��������	Ј��H������x�����_��ff.����U��SH��H��H���tH����˰��H����?C��@��u
H��[]�H���H��[]�N���ff.���AUA����ATUH��SH��L�%�*/I�<$H��PI�<$��H��H�EH��XH��X��y��D��KH���H���K��H��H���H�+���H�C H�p���H�CHH����H�CP����ƒ�����U��	Ј���U����	Ј����v��H��H��H��1�[��]A\A]�m���f.�H�GH��tH��D�< t<
u�fD� 鶂��fDAWAVAUATUSH��HH�$dH�%(H�D$81�H���BH��I��I��E1�L�=�?f�K�|5�{
�w�CIc�L�>��D��<�OI��M9�w�H�t$8dH34%(L���CH��H[]A\A]A^A_����<u�L��	H�5:L)�H��	HF��L�����u�H��v�H�<$I��	����C�@I����>���� wH�&H���_���f��C�Q���@I�F��-�cI���8����CI���%����I����"����'���>������S�C���h�{���CH�<$�8���������]�_�CI����t	������H�<$��������f�I�n��<��s��t|�twI���|�����CI���e����I����"t7��\�K����C�?���f�I����'t��\�+����C����f��C����@��&�H�<$��I���8������C���@I9�����A�|-������CI�����L��H�58L)�H��HF��9���������H�������H�<$I�������C�k���fDL��H�5�7�L$L)�H��HF���~���L$���q���H���0����CI������fD�C�	���@�C���@I�T$�I�t-L)�����E1�< �7<;���I��L9������B�< �^H�&H������I��
u������I�L$�M�\-L)�H��v}fA�;!-�KH��vaL�ߺH�L$H�5�6L�\$��}��L�\$H�L$����A�C<>��H�&@H�����CI�����H����D�CE���?H���Z�H�5(6L��D�D$�h}��D�D$���A�@��C���C�f�H�&H����������������H�<$�H�5�5�i�������L�ߺH�L$H�5�5L�\$��|��L�\$H�L$��u)A�C<>w H�&@H��s�C	I������H���
���L�ߺH�L$H�505L�\$�|��L�\$H�L$���>D�CH��
����L�ߺ
D�D$H�5�4H�L$L�\$�D|��L�\$H�L$��D�D$�����A�C
<>�����H�&@H���x���A�@�CI��C�S���fDI��
�����<;�v���L�H�|$.�
L��E1�H�|$L�\$�Lt��L�\$H�
�.H�=24B�D.��I��I�����H�9H��H�t$H�L$�p��H�L$��u�L��H���.H���|H�4$�U��H���%���H��v�CI������C
I��	���H�������A�1���>wH�&@H��r�H�&@f�H��H9��E���A���>w�H��s��H�<$�
�c{���9���A�{-������CI������E1�����|$.#�;����|$/xH�T$(tEH�|$H��H���3����������|$(��%��=���������������oV��H�D$H��H�T$H�x�i���H�T$��u��ff.���ATA���UH�-j!/SH�}H��P�D� H�}H���p��H�CH��[]A\�ff.�@��AWAVAUATUSH��H����^��H��I��H��I��f�H�}L�M��tH���A��L��LF�L���ǂ��H�EL��H��H�PH�0�A���H��uM�L)�u�H��[]A\A]A^A_�DH�}I9�wWH��L�1�L)�H)�I��A`��H�}L�M��u�H��L��H��L�����H�}H��H)�I�tH��[]A\A]A^A_�1����L��H�D$��_��H�D$H�}1�H���p�������ff.���SH�H��t+H�H�{�c8��H��/H��[H�8H�H�@ ��@[�fD��AVAUI�͹ATI��H�=�`UH��SH��H��dH�%(H��$�1���������H�=[6H��������EH�=Z6����L��@L�d$�D$H��T�D$uH�D$ �D$(n�=w���@L���D$@dH�D$0H��^H�D$8�V�����D$XH�D$`H��H�D$hH��H�D$HH���H�D$P萬��H�T$L��H��H��I��蚍��A�ƅ���\��I�t$I�<$H�\$pH����O��E���H�|$LE�L���`C������\��E����H��H�{1��2��H��	�H9�u�ɺDʉMH��$�dH3%(��H�Đ[]A\A]A^�@H�=5H�\$p�Ϧ��L��D$�#Q��L��I���n��H��L��H���*O��H�|$�`=�����f�����[��L��H�\$p��P��H��L��H���N����9����fR��fDUH��SH��H�������UH�0�DVta�MH��H��DNtP�}H���D~tBD�EB�DFt5��0��0k�di��Ѝ������PB��d����1�H��[]���������f�AUI��ATL�%¾.UH��H�=(fS1�H���
fDI�<ܺH���gu����t#H��H��u�f�}??t1H�������[]A\A]ÐA�]1��} ��H��[��]A\A]�fD�}?u������AWI��AVL�47AUM��ATI��USH��hH�L$dH�%(H�D$X1�H�����I�L9�sa�H��<"��< t+�<
�<
�H��I9���< u�I��f�I��M9�vA�8 t��
�H��I��I�@I9���f�I�xH�D$ L�D$H�t$0)D$ )D$0)D$@H�D$H�D$P�|�����������L�D$H����A�pA�x	I�h@�� u
@��A�x
I�h	H�D��F�@fA��@�� ��fE��t2D��B�D@t&�} u D������@��H��1�B�tFЉt$,������H�T$XdH3%(��H��h[]A\A]A^A_��H�8A�pH��Dwt�E�P��0I�h�D$,L��B�DW��H�L$@�� u�H�D$H�}H�p�r������z���H�D$H�}H�p�������`���H�L$�t$,H��
�H���u�D$,D�EL��B�D@�+���D�UM��B�DP�����}:�
���D������A��D�EB�tVЉt$(L��B�D@���D�UM��B�DP����D������A��B�tVЉt$$�u@��:��@����@�� �����H���}H���Dxt(D�EL��B�D@tD�UM��B�DP��@I9�v?@�� t9@��
�K���@��
u�@����E< t<
�0���<
�(���H��I9�u�L��H�EI9�����H��H�D$H��H�L$H�p�U���H�L$�����H���D$@����I9�t"�DH���D$@����L9�t
�} �6H�|$�k}��L��I�$H���3��H��H�����H�T$�H��L���?���I�E1��y���@H�O1�I9�w(�2<
�X���<
�P���<\@��H��I9����<"u�@��u�H�YI9��-�A����I�hA�pA�DBЉD$,�_���fDD�EL��B�D@���D�UB�DP����������A�trЉt$ @��u6�} �����H��	����fE���������0H��1��t$,�A���@H������E�PՁ������L��MH��A�DH������uH��A�Dp������}H��A�Dx�{���D�UC�DP�j�����0��0i�iҠ�ʍ������JB�LЉ��<-D�H�|$�L$�UI��H�������HcT$H��H)к����I�$���H�D$����)ʉ�#���L���t���D�]M��B�DX�1���D�^�A���u���D�]B�DX�d����} �Z���@��A��H�}��0��0i�i����C�������PA�ÍLЉ��@��-D�H�D$H�p�L$�u����L$���	����D$@�����	����J��I������ff.�@��AUATUH���SH��H�t$耣���H�5�,H��H���w��H���H��H��H��H���w��H�5�,�H���ow��H�|$�0��HcPI��H���.H�,�H���{H��H��H��H���=w��� H���pn��IcT$H��.H�,�H���HH��H��H�߽gfffH���w��H�߾ �8n��A�L$H�߉����)ʍr0@���n��A�t$H�߉�����)��)ƃ�0@����m��H�߾ ��m��A�L$H�߉����)ʍr0@����m��A�t$H�߉�����)��)ƃ�0@���m��H�߾:�m��A�L$H�߉����)ʍr0@���lm��A�t$H�߉�����)��)ƃ�0@���Cm��H�߾:�6m��A�$H�߉����)ʍr0@���m��A�4$H�߉�����)��)ƃ�0@����l��H�߾ ��l��E�d$��MbH��A��lD��E���A����D)�r0@���l��D����QH���D)�Љ�����)��)ƃ�0@���zl��D��H���D)��A���D��D�����)ōD��)ƃ�0@���Al��C�D�H���A)�A�t$0@���&l��H�߾
�l��H����:��H��[]A\A]�fDUSH��H��H�GpH�xu<H�{H���@]���Ņ�x:H�{p�:��H�;H����|��H�CPH����[]�f�H��1��6R��H�Cp봽������f�AUATUSH��H�GH;G�hP��L�gpH��I�|$���L�k<"���{ytX�����<.t<@tXL��L����1���Ņ�~GH�C�8.uB�.L���k��H�CH�PH�SH;Stz�@�<.u���L��L���m_���Ņ�x_H�{p�9��H�;H����{��H�CHH����[]A\A]�f�L��1�L�k�BQ��H�CL�cp�<"�I���L��L���g�����1��@�����벐ATUSH�G�8<��O��H��H�oH��A��H�GH����r����~JH�C���@tM��>uH��H��H�C[]A\�r��@H�������~H�C���@�<��>t�[�����]A\�DH�{pH��9f�H�SH9����8@H�{puZH�uC�@�i��H�spH���
[�����DH���r����H�C~��8,u�H��H�C�ᐾ,�vi��H�{p��K8��H�;H���`z��H�C@H�C�8:��H�SE����H9��2����8:�)����{xu=f.�H���q�����	���H�C����@E�����{x���H�
�'H�K@H9�r������H�������������H�C����@1��9O��H�C���H�C�H����H��H�C�c����{xt���D�E���CL�
�/H��D��fDD��C�<u<.u!��uH�����u�H)�H����p���AUA��"ATI��UH��SH��H��A��:wH�!E1�L��r2H�!fDH���������"<:w�H��s�I��M)�"H���g��L��L��H���cp���I�!��t2f���"<:wI��s
�\H���vg���3H��H���gg�����u�H��H��"[]A\A]�Ig��f�H��"�3g��H��L��H��L)���o���1����f�SH��H�?�8H��P�oK(f��oS8P�o[HX H�KXH�H0H�ShC(C8CHH�CXH�H�@H��tH�BH�Ch[�fDH�C`H�Ch[�fDH�Ht9H�GPH��t�8u�xH��V	H�$%�GXHE�H�GP�H�����xH��V	H��$�GXHE�H�GH�AUATUSH��H��L�gH�pH�� H�kH��H���1����~
H�C�8<��L�cL;c�MK��H�{H���H��E�,$�6���A�ą���H�CH;C���8@��H�����H�{����H�tf��[4��H�;H���pv��H�C8�{XtH�{8�[E��yH�CX�BH�{p�'4��H�;H���<v���8H�C8uH�C81�H�������x=E1�H�CH9CA��H���v���H��D��[]A\A]��1��yK��H�{p�����{xtH��#H�CP�CX�f��CX�����H�{H��'���H�{p� �d��H�spH��L�f�}��H�{pL;g��H�CH�N3��H�;H���cu��H�C8A��H�{8�CX�����H�CHA��H�����H�{P����H�C8H�CH�����1��J��L�c�5����H�CHH�������H�{P�����H�C8H�CH�|���H�u���� ���A���S���A���7���A��"�N���H�T	H�CP�>���ff.�f�AWI��AVAUM��ATA�̹USD��H��H�t$H�l$H�$H��L�udH�%(H��$�1��H����ɗ��H�$H�t$L��H���Ei����L�|$H��!H�D$0蚗����$���L������$���H��$���$��Lk������H�\$H�T$ H9��TH��foD$pAEH��$�dH3%(�H�Ĩ[]A\A]A^A_�D1��I��H��$�H��L���{����~H�D$�8:�|H��H�\$����A��H�\$H�T$ E���o���H9��f����;,�]���H��L��H�\$�j�����nH�\$E���1���H��$�A��H��p����\���@H��L��H�D$�?j���Å���H��$��0��H�|$H���r��H��H�D$X���H�D$�8;uQH;D$ ��f�H���D$h�c���H�\$H�T$ �+���@���,uwH��L��H�D$�i����~�H������H�D$H;D$ r��DH��$��D$h�/��H�|$H���	r��H��H�D$X������t���H�D$H;D$ �d������;�X����H��L��H�D$�/i�����7���A��H��E������V���f�����H������H�\$H�T$ ����<��ff.�AUI��ATI�̹USH��dH�%(H��$�1�H��I�$H��H�k�H�H���Hf����L�,$誔��H��H�D$p�}h����H�D$�
�8<��H���_����H�D$�8@��H�{�@h������H�D$H9D$�}H�|$HH�D$P��H��tg�8tbH�����H�D$H9D$�E��H�D$`I�$1�H��$�dH3%(�yH�Ę[]A\A]�D�H�������b���H���D$X����H�D$H9D$w=H�D$`I�$������f�H������fDH��u��Y���H9D$s��D���u:���xD����SH��H��0dH�%(H�D$(1��Gt�)���H�D$(dH3%(ubH��0[�H�=tL�L$D�D$�L$H�T$H�4$�
����L$H�4$H��L�L$D�D$�D$$H�T$����H�|$$�$����u���C����9��f���H��(dH�%(H�D$1�I���g��H�$H�T$dH3%(uH��(��9��f���AUI��ATI��UH��SH��H��dH�%(H�D$1��GuXH�=��T���H��L��L��H��D$�?���H�|$����#�����FC��H�T$dH3%(��uH��[]A\A]�fD���������8��f.���H����AVAUATUH��SL�n H��H�F(M����E1�H���M���PC��L�cM���H�5%L���c���H���2L����6��L��H��H���e��H�{�,H�CH��t	�8���<H���\��L�cM��t#L���6��L��H��H���[e���:H���\��H�s �>�)�H�5��H���-e��H�C(�8��>H���S\��H�[H�����H�5X�H����d��H�C(L�k H�������E��uZM��tA�}���H�5J�H���d���H�5MH���d��H�[H����H�{(L�k A������M����A��H���*��H�ME1�H��H��A��H����,A�ƀ�:@��A ��;A���x �1A����,�_��:�v�;����@1�H�����H�C(�8����@H���4[��L�c(L���5��L��H��H����c�����DH�{�>���A�}�3���H�C(�8��������� H����Z������fD�L��H���H�H�{����H�C �8����H�C(�8������;���fDH�5�L���ِ��H����L���X4��L��H��H���c���]���D[]A\A]A^��H������H�~�
@��[�H�5��]A\A]A^��b��M�������H���@�����f.�H��������H���ڐ�L��H���`���������UH���SH���9���H��H��H���{��H��H��[]�m(��ff.�f���H��H�oG�oO dH�%(H�D$81�H�G0H��H�$)D$)L$ H�D$0H�D$H�D$�o��H�T$8dH3%(uH��H��4��ff.�@��f�H�G0GH�wH�W H�O(�ff.����f�H�G0G GH�wH�H�G H�BH�G(Ð��ATH�5�UH��SH���.L�cP��H�3H��H�������t
L9�u�[1�]A\Ð[�]A\�fD��H��tWUH��SH��H��H�sH���Y��H�sH���Y��H�sH���Y���s H���yY��H�H��u�H��[]�f.��ff.�@��AWAVAUATUH�,SH��XH�L$dH�%(H�D$H1�H�t$ H9���H�D$0I��L�t$(E1�H�$H�D$8L�d$ H�D$H�D$@H�D$�~�H�$H��L���$������H�T$H��L���$����xvH�T$H��L���$����xbH�D$@�����H9�wSH�T$(�C I��H�SH�T$0H�SH�T$8H�SH9l$ tQI�E�(L��PL��H��L��L�8H���'$�����_��������H�L$HdH3%(uH��X[]A\A]A^A_�1�H�D$H�1����(2���ATI��UH��SH��H� H�u0H�CH9r;H�I�$H�C H�HH�M1�H��[]��A\��1���<��H�{ H�CH9s�H��H��������H�C H�I�$H�C H�H�����H�M��y�[]A\�f���AWI��AVI��AUATI��UH��H�=�SH��dH�%(H��$�1�H�\$0�K���L��H��1�H�߉D$L�d$(H�l$ �[�����#���f�H��HDŽ$�H�D$P)D$`)D$p)�$���]��L��H��H����������H�T$(H���H�B�H����H�$舍��H�t$ H�H�D$�>H���Dy��H�$��0�D$lH��u�v�Dqtn���DFЉD$lL��H��H���E�����~QH�|$(vIH�D$ H�=�DE1�H�$�@H�y�.J�<�H�4$��S������I��I��u�DH�D$0E1�H9D$8��:��H�|$�������:��H��$�dH3%(D����H�Ĩ[]A\A]A^A_��H�D$0E1�8,u�H��H��H�D$0�z\��L��H��H���l���H�T$(�������H�D$0�m���DL��H��H�߉$D�l$p�:���D�$���>���L�L$(I�A�H������)���M���H�D$H�t$ H�8�I��DG����H�N�D$tL��D�H��I��DW������A�DPЉD$tH9�u�I����=k�����-l�D$tL��H��H��D�$���D�$�������H�L$(H�D$0E1�H�Q�H���x���H�t$H�|$ H�6D�L��B�DN�X�����0�T$hH���E�D�$��:A�ŀ�.��A �� H��H��H�D$0�[��L��H��H����D�$��H�D$0�����H�|$(���H�L$H�1H�L$ �9H���D~�����y�D~�������0k�
�T:ЉT$dH9D$8v���:����.��L��H��H��D�$�m���D�$�������A�DŽ$�����H�|$`�+��I�H�������Ak<A�Hc�H)�I�H�D$0�-���D��E�n�����d�D$t�b����D$t�E���E1�������D~��k�
�T:ЉT$h�����,��H��H��D�$H�D$0�Y��L��H��H�����D�$���8���H�|$(�,���H�D$H�T$ H��2H��Dq�����r�Dq�������0k�
�D0ЉD$`����H�D$(H�\$ H����H��tcH��uU�{TuOD�$���D�$H������E�4���M�� �����Pu�S����D����SDD�E��z���D�$�����D�$H���<I��<Jt�<M��<Y�A�MA)�Ek�<���Aը�u�H�D$L��CH��A�DAt��CH��A�DAt��sH��A�Dq�x���D�SC�DQ�g�����0��0k�
k�
�T:�k�<�F�DЀ�+�D���A���<���D�C�Ek�<�/���D�C�Ek�<�"���D�@<�����\�������������C�����������������SH��H�|$H�|$���H�t$H��H���(~�������~�����A�+��
�������)�)�k�<)���HcKH��H���.D�CLc[D�KH�5g�.H�ʋSWA��lPJ�4�H�=�AR�P�CP1���x��H��@[�fD�ٺ����A�-���׉����k�<)������f�H���1�H���������	Ȉ�����USH��H��H���H����H��tH���H���7������H���H���pW��H���H��tH���.H�8H��P H���H�KHǃ�H��HD��p��H�sH��H���H���	y����x=H��[]�fD����)����������@H����l���@H�{�O��H���H��[]ÐH��H��[]�d��f���AUA����ATI��USH��H�-��.H�}H��P� D�(H�}H��L�`�>C��H�}� H�Cp�,C��f�Hǃ�H�CxH���.��H���H��ǃ�H��[]A\A]�ff.����USH��H�H�H���tH�����U��H���tH����f��H�{p���H�{x���H�-�.H���H�}H��t
H��P H�}H���Hǃ�H��t
H��P H�}H���Hǃ�H��t
H��P H�}Hǃ�H�H��H�@ H��[]��ff.�����ƒ��@��E‰H�GH�p\�-���ff.�f���USH���@H��8dH�%(H�D$(1����H�s H�S(H��1�H��H���qQ��H���S��H��H���>�����H�$H�UH��t?H����1�H��tuH9\$��1��H�L$(dH3%(��H��8[]��H�m�H�5��H���0J���¸��t��H�5	H���J����������DH�mH�5?�H����I���¸���i����H�5�
H����I���������H���DH�}�H�5�
�I��������!���fDH���R��H�$�;;���1��
����%��ff.�@��H����@��Uf�SH��H��H���dH�%(H�D$1������HLJ�H������H���H��tH����5��H�-X�.H���H�}H��t
H��P H�}H���Hǃ�H��tH��P Hǃ�ǃ�H�D$dH3%(uH��[]��$����AWAVAUATI��UH��SH��H��hdH�%(H�D$X1�H�GH9t	�gv��H�EI�$H�CL�mM����L�uM��uUI�D$H��A�I�D$H�uH��\�-���H�L$XdH3%(D���.H��h[]A\A]A^A_���������H��	Hc�H�>��@I�D$H�m�EP�t�� E1�EP��H�=��w���D$L�mL��I���H���EH�|$�;��A�ń���.��H�{p1��e.��H�SpH�u(H�} H�K�0X��H�SpH�CH�uH�}L�rH���[��H�{p1��G���oEC�oMK(�oU S8�o]0[H�oe@cXH�EPH�ChH�CpH�L�s@H�C0H�S8L;ptH�L�I��H�SLpL�s H��I�\$����E1��{����L�m�����M�l$M�t$I�D$A��D����H�{p1��e-��H���H���uH�UH�uH�L$L�D$��1��H�CpL�(L�p땐H�{p1��%-������H�CpL�(L�p�l����H�{x1��,��H���H���-H�KxH���L��H�T$L�t$��V��H�t$L9�t&L��H)�H���H��
��,��H���L��HA��H�CxH�I�D$H�CxH�@I�D$���f.�H�}H�5�^����������H�����L�����f�H�}H�5�����������H���r��������DL���H�UH�uH�L$L�CpL�����������L��� ����������������H�{p1��0E�����L���L�|$MH��L��L��L�D$��<���I�</L��H)�L9�IG�H��H�$�"@��H�$H�T$ L��H���H�H�KxH�l$ �nU��H���H�T$ H9�r5H��	��+��L�D$H��L��M�E1�L����?��H����)���fDH��H)�L9���+��H)�I�Hǃ�I����H�{p����H��H����s���H�U(H�u L�l$ 1�L���AJ��L���L���@�x��L��H��I���}��L��A������H����f��H���E��xqL��H�t$L�5u��y��L�l$I�}H��u�4fDI��L�l$I�}H��tL�������u�I�}�qf��H���H�D$(H9D$ �o*��H�E�r���H�D$(H9D$ �V*��L�m�������E1��?���f.����AVAUI��ATUH��SH�� L�aH�t$dH�%(H�D$1�H��tH��H���`����t=H�UH�t$L��M��txA��H�L$dH3%(�uH�� []A\A]A^��L�t$L��H��L���
n����x)H�|$H�MH�T$L���CS��L���K���f�H�UH�t$L���?����t�H�T$H�}L���K���l���������AWI��1�AVI��AUATI�&U1�SH�]H��XH�$H�L$dH�%(H�D$H1�H�D$(L9���A�</=�uA�<?�jH9���H�|$(H���+1��T(��L�l$(H�]L��1�1�H�D$0M�H�D$8H�D$@H)�u�H��H9�t#A�<?u�qH�T�0���WH����H9�u�H����ZA�8=�P����(��H�L$0L��L��L�D$H��H�L$��I��1�L���A��L�D$H�L$M�UA�T��Qt����b����q��L�\$@H�T$8L�T$I�s�I�|L�\$H)�L���oj��L�\$L�T$I����H�D$(L�H�pL9�vH�L)�H�L$H�$J�<�Є�t:H��fDH��H�]L9��p���L9�t��'��L��H�L$1�H�$H)�L���H�|$(�}���H�D$HdH3%(�H��X[]A\A]A^A_�f.�H�JH9�vA�|=�����H��H���x���DH��H)�L�H��H�>���� vP1�H�L$H�$�Є��l���H�|$(H������DH�i�.L��H)�H�8��5��I��H�D$(���fDI��s�H��H9�u����@��B�_���L�\$@H�T$81�L�T$H�='�.I�K�L�\$H)�I�TM���e��L�T$L�\$�b������f���H��(dH�%(H�D$1�H��H�$H�����H�L$H��H�D$�T��H�D$dH3%(uH��(��J��f.�L�7A���
tCv)��
tl��=u'H��uzH��1�H9�wfA�8=?���D1���	u� ��_���fDH��H��H9�t[��%���7��	���� ��!�H���fDH��H9�t�<7
t����L7��A�<���� ����k����@�붐��AWAVAUATUSH��8dH�%(H�D$(1�H���YA�@H��I��I��I)�L�|$H��<�|�
H�5�L���PF��H�D$$�D$H�D$�N�< uaH�|$�H�D$�A��_L���K=��I9��,%��L)t$H�I)����E<=��v�<?��<_��H�T$L��H���C���A�Dž��H�����D$D�4@Hc�Mc�L9t$r~f��U�� �k���E����I����H�DL�}H�$�	�A�I��1�H�5�L���WR��L9<$u��1���@�D$A��A�L9t$s��H�5��L���E��H�D$?�i���f���L���%<�������D$�A�A���L��1���H�5@��Q��L��1���H�5*��Q����L��1�H�5��Q���n���f��|$ti�} ���E1�L)t$H�I)��U���fD�H�5�L���,D��H�D$(dH3%(��H��8[]A\A]A^A_�f��D$A�	��K����H�5x�L����C��H�D$?�b���fD�T$$�J�^v$����"���D$A�����fD�D$A�������E1��V����9��f���AWAVAUATUSH��dH�%(H��$�1�H�����@I��H��I��H)�H�D$H��<�#�
H�5�L���B��H�D$@f�H�D$xH�D$H��.L�l$4D$HH�D$@H�����H�D$PH�D$H�D$8H�D$ D$XD$hH�t$H�|$�jB��H�D$8H9�HG�H��H����1��$f.�Hc�H�H9��DH�|$8�6H��L��H)�L�����H�T$8A�Dž��H���pH�t$H�|$��A��H����I�nH�|$L���vB������!��I�FH)�H;D$��!���H�5��L����A��H�D$PH�L$f�H�D$8H��HDD$AAA,�A<H�D$PH�D$?E���H������DH�|$L����A������ ���H�5�L���WA���H��$�dH3%(��H�Ę[]A\A]A^A_��H��I�nH�������H�L$ H�|$M��L���R�����~ ��I�VH�D$8H��H)�H9��� ��H9L$�" ��I�H)�H�D$H)�H�H�D$E�������H���(���H�����I�nA��~���H�D$8H�|$1�M��H�5��I�n�Q������ ��M�~�H�D$8L��H)�H�D$(H��w�,@H�D$8H�xH�|$8H9�vH��L��H)�L������~�H�L$H9L$(wRH�D$8L)�Hl$I�H)��^����H�5|�L����?��H�D$?���f.�I�n�������I��ff.�f���AWI��AVAUATU1�SH��H��(H�T$H��u�<�H��H9��(H��H��L�������t�M�4/A�<
t<
�%H�|$H��L���-?��H���oL�e�O�,'H)�A�}
u�C�|'�
I�D$���I��M��u�H�ھ
L���G%��H�D$H����H�|$H��L)���H�|$1�L���>��H�\$@H�D$�<
�0<
����H�|$���1�H�|$�
�5��H�D$L�<(A�7@�� tS@��	tMH�|$�	�5��H�\$H)�1�H������H�|$H��(H��L��[]A\A]A^A_�>��DL������H�|$H�k�B5��L�|$I���H�H�I��:
HD�HD�H)�H�|$H�\$H��H����E1�E1�E1��f�I��L��H��L���/���I�}��tI��I��H9�u�O�dO�$>I9��+A�$�P�����< u�C�D>�P���v< tI��I�wM�$6M9�u�H��H���������I�WI�H��M�H���������H��L��I��I��I��H��H��H�T$L��H)�M9��l�72��H�|$H��L����<��H�|$����H��([]A\A]A^A_�@H���������M�H��M�L)�I��H���������I��I�WH��I��H��L��M��t��KH�D$�x
����H�|$t�H�|$�
���3�����H�D$H���b���M���7���fDH��tOH�E�M�,A�U�r�@������ u+��A�T�L�`�O�,'�r�@��va�� t\L��H��u�H�|$1�L���;��H�ھ
L��M���"��1�H�D$H�������H�D$H�����������fDM�4H��H�|$H��L���Y;���8���I����M��1�M�L��H��1�I��I�GH��L��L��������UH��SH��H���;��H��H��H��H��[]�X�����AW�A�AVAUATUSH�����0��H��H��A��I��1�1�M����A�L�jE1�<
t`< ��<	���H�^A��<?��A�t<H9���L�L$H)�H��L�L�$�U �H�5w�H��U L�L$L�$L��E�&L��M9�u�I)�I�H�E H��H��L��[L��]A\A]A^A_��f�A��u�L�L$H)�H��L�L�$�U L��L�$L�L$��A��t����A�>u��R���D��AVA��AUI��ATI��UH�-��.SH�}H��PH�}��L�hXH��L�``�2��D���H�}�H�Ch��&��H�Cx�L��H�Cp�4��M��tI�D$f�A$H��[]A\A]A^�ff.����H�wx����H9wxw�D�k��ff.���UH��SH��H�H�{X��H�{p�N�H�{h�B��H��tH���.H��H�8H��P H�EH��[]�ff.���AWAVAUATI��USH��HH�t$dH�<%(H�|$81�H�A�\$P����I�|$X1���B��L�t$0L�l$(A������\$1�H�KL��L���^��H�|$0H����xH��H����@��H9���@ ��DL9��>H�t$(H9�������
wt=��u	A��$�H��H9�u�I�|$XH����&��H���q���H9�������H�K��H9��� �u�M�\$`A��$���E1�H9�s�<@�� A��@��	��A	�M���A�CH�����|�
H�C���H��H�D$0H�ÿ@��@
t$��H�I�|$p1������I�D$@H�GI�$����I�|$XA�\$P���M����A�CI�D$`H�H�TH�I�D$`H�PH�TH�PH��tH�t$(�|�
tI�D$`H��tH�@I�|$XH��1����I�|$XA��$���0����I�D$`H��tH�@H�\$0H��@��1�@
t$A�D$PE1�tE��$�A��A��A��A��uE��$�A��A��A�D$PD�\$A��������A��D	�E�D��D	؃��	���D	�A�T$P@������H�t$(�cI�t$I�D$xI�|$pH9�HF�1�I�\$H�WI��I�$�H9�v
H)�H9�LF�L�ŀ|$��A�D$P ��H��v	E���LI�t$A��$��TI�|$�H�>	�?H���6� H�L$�;,��I�D$I�|$pH�U�H�p��4��H�L$�f.������H�|$8dH3<%(�yH��H[]A\A]A^A_�H9��OH�t$(�+���
�����u	A��$�H��H9���������:w�u�A��$�u�I�T$XH��H�H�TI�T$H�W��������H9��>H�{�H�T.H)�I�T$I�|$A��$��YH���FD�:1�A�� t
A��	u/�H��H9��RD�L�A�� t�A��	t�H)�L��I�T$I�|$ID$HH�����D.�L�}�< t$<	t �f�B�D>�I�W�< t<	��I��M��u�I�|$hH��ML��H�L$�P3��I�|$h1��*��H�t$(I�T$I�|$hL�H)�I�t$0I�T$8� 3��I�|$h�6���M�|$H�L$I�$I�D$hHA�D$PI�\$0I�\$����D$�G���H���`����E���H��H�L$��2��H�L$I�D$pH�I�T$ H�@I�D$(I�D$`A�d$P�H��tHI�D$`HHI�|$XH�����H�D$L� ����I�D$ I�D$(�I�t$H��H�L$�K2��I�D$pH�L$H�I�l$I�l$(I�D$ I�D$�y���H�������|�
H�C��������H��	��1�I�D$(I�$I�D$@��I�D$I�D$ I�D$I�D$0I�D$8I�D$HA�T$P���������H��H���fE��$�A��D
T$�;��������|$A�H�w�LD�I9��L�T$(A�D:�<	�p< �hH���A��� �X��	�OH��I9�r�A��I9��Q��H��1�����H���B���I�D$@I�t$I�D$I�D$HH��	I�$H��.I�D$8H�I�D$0����1�H�����D�A�� t
A��	����H��H������I��I����H�	I�t$I�$H���.I�D$I�D$8H�I�D$0I�D$@I�D$H������I�T$X�B �N�������@1�H�L$��
��H�t$(I�|$hH�L$���H��vE��t�
H�L$�'��I�|$pH�L$�
H�L$�&��I�|$pH�L$�r���H������H��H��H��@��1�@
t$E1��[���A�� ���A��	���H��H�1����I�L$X�A �����E1��K���I�|$XH�����H�L$(�1@��
t@��
�����H��������y
�����H�D$0I�D$`H��t�@�9
��I�D$`H��tH�@1�1�1�1۹���E1��\���H��H�D$0H��A�����1���H�L$(�1<
A��<
��A�uA�����H�t$0H��uPL��H�
��1���H�5F�H�=�<�Q�I�_�����1�1�1۹����H���-����	���|9�
H�G�H���"���H�D$0H���S�������f����������ff.�@��ATM��UH��SH�� dH�%(H�D$1�H�\$�d�H��H�D$�f.�H�|$L���H�|$H���������e��H�|$�%.��1�L���H�D$dH3%(u	H�� []A\��0����ATUH��SH��FPt<H�SH�sH���<-���CP�u�uP[H��
]A\�_$���[]A\�L�&L���5���L��H��H���,��H�S8H�s0H����,���D�
H���$��롐��AUATI��UH��SH��1�H��H�����H��trL��H�u�&��I��H��tHH�L�-���f.�L��H���#��H9�t!�3@��u�L��L��H���S,��H9�u�H��L��[]A\A]�\�@H������H�uH9��
��I�$L��PH��H��H�����H��[]A\A]�ff.������t"1��H߀�v��;<Cw�BH�����u��D1��D��AUATUSH��8dH�%(H�D$(1�H�H����I��1�H���@����H�����<u�L�`1�L���-f�<>��<"��<(�����H���<@w�uӹ��@H���O"��H��H�$�*��H��H���������H�$H�T$�8>�xH�HI�MH9�����H�����@H�t$(dH34%(��H��8[]A\A]Ð<>��M�eH���L�����1�L��H��H����'��H���*��H�$H��H�߀8"�����H�$�����:@�"���H;T$�?��I�E���f.�I�U1��U���DH�BI�E�������H���.L��H�8�>T����� wH�&H�������
���H�&H��H����� w�H��rv��u����f�H9T$�b����
�������3���I�E1������AU��M�eH������H9��)����c
���H�D$H9$�����H
��@H����t-H�&H����H��H�����t
�� w�H��r�����<��������ATUSH��H�odH�%(H�D$1������
��H���j
���E\�8
��H��H�?�hH��PH��H�(I��H�E8HEHE I�D$H�C`L� H�SpI�D$H�{hH�$�l(��I�D$�K,L�cH�C`�C(�Q���S,�C(;C8��	��;S<�o	��H�D$dH3%(u	H��[]A\����ff.�f�AWAVAUATUSH��H�VL�nH����	��H�FH��H��1�L���9��H��tH�E�H\ E1�A�}
L�uuA�FHE1�L�u���
A��I�}��A�FH�x�
tA��L�uH�xL�{H���
L)�L��H)���
��H��u�C�D=����H�CHExH�CIF8H�UH�CHB@I�L�b@H��[]A\A]A^A_�ff.��USH��H�����uH�G(���'	����1҉G(H�hH�KpH�GH��p�H9��,	��H��H�/H��H��.5��H�EH�C`H�CH�8H�p8H��8�bP��H�CH�8H�p H��8�NP��H�CH��@X��BXH�CH�H�CH��[]�ff.��AUI��ATUH��SH��H�H9�tYH������L�%X�.�fDH������H�H�EH�sI�<$H��t
H��P I�<$H�CH�H��P H�]L9�u�L�mH��[]A\A]�AWAVI��AUATUSH��(I�H���.�>-H��t�����H��([]A\A]A^A_�f��~-u�G<9G,�6H�B�H�~I�Ծ
H�‰L$M��H�<$H�D$�����L$H���QH�4$�D$H)�H���M�~XM��t�H�C�E1�H�D$�M�wL9�r?I�H�4$L�������u+M��tM;t$vL9��&L9t$u�|$�M���M�?M��u�M�eM������I�D$1�H�HH9L$r
f�|--��A�D$ ��	�A�D$ ����D���_��H�G�@ ����LJ�H��(1�[]A\A]A^A_��H�G�H\�����H�@��|
HD�H������|�-�����|-�D$�����I��SwI�F�@ u��t0H�D$�T�D$H��THF�����M�}M�����Adž�T1�����f���ATI��UH��SH�wxH��H����A�$���H�UH�uH�{�H������H����I����~#A�<$u
ǃ��[]A\�����tk��uH�S�R�� uǃ�t�������t;�|H�=���f.�H��W�H�Cx�X���f.�[�]A�$A\ÐH�S�B t���H�}�g����]�����R��u�����ff.����AWAVAUATUH��SH��H��XL�odH�%(H�D$H1�H�T$�:��������H�EH��t+H�M���
�#��
uH��v�y
�fDH�CXH����H�UH�uL�D$H���L$�������aH�D$H�KH9H�V�����tTH�S�B0���������B0H�C���H)P H�CH�h(H�CH��@HH�C���H�HP8H�CH�H�@@H�D$A�E\@u����O��A�E\H�sPH��tH�c�.H�8H��P ���H�CPA�E\���@��H���������tA�M\ H����!��A�E\�����������ƃ�
��JH�{P�>������H��H���ǃ�A�H�EH�E���f�H�S@H�CHH���H��H)�H9¸HF����H���H�t$����A�ą��fL�d$H�CHA�D$P��ID$H�CHE�t$PA��uTM�<$H�5��L���q�����aH�5O0L���Z����u&�C4uA�M\@E�t$PA����A�L$P DL�e1�H�EA�T$P��u1����������A��	fDE1�H�L$HdH3%(D����H��X[]A\A]A^A_��ID$H�CHID$8H�CH�����I�UH��t�B\t��A�E\����D��A�E\���@H�{P���A�E\�@����K(�Q9S8�����A�E\����@H�{t"�W��uL�d$M��������I�����k$�����������DA�M\@����fDA�E\���K(�Q9S8��K<9K,�H�*H������fDH�=7��E���D$������H�L$��L�d$ ���L��H�Q(H�q 1��t��L������@��I��L��H��I����N��L��A���	�H�5��H���:������H�C�H\E��xH�C�@\tH�{P�YH�D$(H9D$ �W��H�|$�&��L�d$����������@H�{Xt)H�rH������fD���A�E\H�{Xu�H�iH����}���H�F�.�(H�8H��PI��H�CI�D$H�{PI�|$H�CP�6�I�D$H�CXI�$L�cX�������L�����H�5��H���}����uI�}��I�E�x/��L������
H�5��H���D��������H�CL��H\��H�5��H�x
�����������H�C�H\���L��H�t$L�-d��I��L�d$I�<$H��u���I��L�d$I�<$H���j���L���r����u�H�sPH��tH��.H�8H��P H�D$H�CP�PH�x�J
��H�CP�!���H�C�H\�����ff.�@��USH��H��������H�GH���W0H��H�H�p �������H��H��H���H����ǃ�H���H��[]������UH��SH��H���;�H��H��H��[]�j���f.���UH��SH��H����H�CH��H�߃H\@H��[]�2���f���UH��SH��H��dH�%(H�D$1�H�T$�����~H��H����H�S��B\uH�L$dH3%(uH��[]Ð�C4�������@���ATUH��SH��H��dH�%(H�D$1�H�T$�����~jL�cH�S�
L�����H��tnL)�H��H��H��H�C��H�EXH��twH�MH9Ht}H��H���H�{t�E4uDH��H���H�L$dH3%(uVH��[]A\�DH��H����1�H�{t�E4tȸ��H�����H����H�i���H�����;�ff.�AWAVAUATUSH���n L�v��H�P�����I��H��I��A��H�G�f.�L����I�GH�������H9Cu�I�X�C ��H����I�I�t$����I�L$I�D$I�WxH9�����H�I�D$E�����0@��
���@��
�����J�D2��I�WxH�hH�H9��c���I�D$L��L���a�H�����I���A�G4u4H��L��L��[]A\A]A^A_����H�3����D���1��@H���[]A\A]A^A_Àx
��h��������AWAVAUI��ATUSH��H��8H�t$H�T$dH�%(H�D$(1�H�D$ �������A���
H�kH�S��L�dI��L�t$ 1�H��u/���f��L$L��M��L��L��L)��w����L��
L��L)����H���sH��L�xH)�H9�s�x�
uH��f.�H��t��D$1��H�D$H�Xf�H�t$L�����I�E�@\tA�E4���f�H�|$(dH3<%(�|H��8[]A\A]A^A_�Du6H��u1H�D$M��L+HE���|$�����A��������M��t�H�D$H�XH���Z���H�T$H�t$ 1�L������q���H�|$H�r�H�O�|�
��H�ӄ���H�D$H�XH������1��5���D�L$L�D$ H��L������ygH�D$H�P�7���f�H�D$H�PA�������H���o�����)�A����������H�D$H�x�����1����D�n���H�T$H�t$ �L�����������u�H�wA���H�����������ff.���H�5�.ATI��UH����SH�8H��P�dL��H�ËE�C0�E�C4�E��Dº'�C8�E��Dº �C<H�EL�cH��HD�H�C@���H��[]A\�fD��UH��H��H��SH����7��H��hH��H�(H�E�P�C,� H�����H�CH�CH��H�C`H�����H���H�X�.H�CHH�8�x
��H�CpH�ChH��H��[]�f���AVAUI��ATU1�SH�L�c H�H�CM��H�H�C @���H�H���tH����t��H�CH��tH�8tDH����H�CH�8u�H�{X1��3��C(��u`H�{�c��H�{h�
��L�5��.H�sPI�>H��t	H��P I�>H�CPH�H��P M��t[��]A\A]A^�DI�}u����������H��dH�%(H�D$1�H�������H���P��������H�D$dH3%(uH�����ff.���AUf�E1�ATUH��SH��H��(dH�%(H�D$1�L�d$Ff�H��H������u6L��H��H���B����t^���u�E�������A�H��H������t�H�SH�UH��t��xIH�}t2H�L$dH3%(��H��([]A\A]�H�S�Bt��
����H�E��fDH�S�J�� t2H�SH�:t�f�H�߉D$��H�S�D$H�:u��x�����uɋR��u�H�{ u�����d�@��AVI��AUI��ATI��USH��H��0dH�%(H�D$(1�H����L��H�t$H�<$A��H�|$taH��H�������������H�{H������L��1�A��H�C�o@ AH�@0I�FH�D$(dH3%(u H��0[]A\A]A^�DH�CH��u��~�����ff.�f���AUI��ATI��UH��SH��8dH�%(H�D$(1�H��fDH��H�������~+H�|$u�M��t�H�t$H�<$L��A��H��H����������$���H�D$(dH3%(uH��8[]A\A]�����������fDH�WH��H���H��tZH�JH��tA�^fD�@\t#�G4tH�J HJHJ8H�P HPHP8H9�r4H�GH�HH��H��uH�H��u�H�GH�x���H����H�O�H�tH�H���t��D��H�WI��H�ztF�B\u H��L��I���H�RI�P��D�G4t�H�;L��I�������G4t�H�����H���H����ff.����USH��H��H�OH�H�Q HQH�H9�wSH��H��H)����H�SH�2�B\uH���H��H��H��[]���H�zH�dHE���fDH�1�H�C H�������[]Ð��UH��SH��H��H�wxH����H�CxH���#���H���H��H��[]����ATUSH��dH�%(H�D$1�H�GH�@H�����H�T$H��I��H�h�������H�CI�L$H�H�4
H9���I�L$H)�I�l$H�t)�H����>
���V���
��H�F��fD��
tH���H9�v�
���x-���x-��H9�t�x�
tgH)�I�D$H��H���I�D$H�Cx�H�|$dH3<%(��H��[]A\�fD1�H��Tv�H��TH9�s,H�Kx��@H���f.�H�F��V��O���H9�s�H��H)�I�L$��H���H�C ������y���H�}�H�C ������d����b��f���AVI��AUATUH��SH��dH�%(H�D$1�H�GH�T$H�XL�h L�`8� ����~$H�UJ�+L�H�
I�VH�4H9�s)H�Ux�H�\$dH3%(u+H��[]A\A]A^�H)�I�FH�����H���I�V��������G������AVAUATUH��SH��dH�%(H�D$1�H�GH�X HXHX8H�GH��H+H���1H�T$I���L������M�t$I����M�l$A�EL��<
u	A�EI�}<
���-��A�}-��H��L��
H��L)�H)��t�H��t_H�
(���L)�I�D$H���H��H�Ex1�H�t$dH34%(��H��[]A\A]A^�f.�Dž�1���f�H�UH�
L�H9�w^s�I��Sw��B u��|$�y���Dž�T1��f.�H���H�E ������p���H���H�G ������X���H���H�E ������C������f���USH��H��H�OH�A HAHA8H�	H�OH�H�H9�w0H)�H��H���2��H����H��H��H���H��[]��H�a�H�C H�������[]�f���ATI��USH��H��H���dH�%(H�D$1�H������Ņ�tax?H�$H��tnI�D$�I�D$H�L$dH3%(����H��[]A\�@H�{�G��t������������DH�{���������@H����	��H�]���H���I�D$I�D$H�{x���H�SH�KH�B HBH9u
��O���H��������H�C �:����P����USH��dH�%(H�D$1�H������H�GH��H�H��H�pH�H9����H)����H�CH�{H�p �����S01�H��H�$���H��H����Ѽ��H�Z���H��H��H����H���H�L$dH3%(uH��[]����ff.����UH��SH��H��H�wxH�����H����H��H��H���H�CH�CxH�@H�CH��[]����SH��H�����H��H���*��H�
������H�XH�XH���[�DH��t[ATI��UH��SH��H9�t%�EH�{H��L��������uH�[H��tI9�u�[�]A\�f.�[1�]A\�f�1��ff.�f���H��H��dH�%(H�D$1��D$�H��H�H��u�H�T$�S������?�H�L$dH3%(�D$uH����-��ff.�f���H��H�?����t:H��t5�WX9�vfDH����H��t��t�WX9�r��H����H��H������H��H����H����H	���8���UH��SH��H��H�}H�sH����H����8���H��t	�����txH�CH9EulH�C H9E ubH�C(H9E(uX�C09E0uPH�C8H9E8uFH�C@H9E@u<�CH9EHu4H�CXH9EXu*H�mH�[H��H����H����H	�t8��f���fD1�H��[]������1��AWAVI��AUATUSH��H��(H�T$H�t$dH�%(H�D$1��=2��H�|$��4������A��A��w0E�.H�D$dH3%(��H��([]A\A]A^A_�f.�H������D��H��H�V�H9����H�H��PH��E��tGE�e�E1�I��I��f�H�D$H��J�48�o��H��J�D=H�D$J�t8�X��J�D=I��M9�u�H�D$H�(�M����������ATUSH�_PH���c�H�?�1�1�G\tH�t
��[]A\�H�u�H�{H��tH�5�������u֋C��t91�u�L�cH�5a�I�<$�ֻ����u�I�|$H�5������u�D1�H�{(u�H�{0u�H�{ H��tH�5"�蓻�����i���1�H�{P�\���H�{8�Q���H�{X�F���H�{`@���8���f.���AUATUSH��H�_PH�����H�{8I��H��tH�5v�����1҅�uJ�CH��tAH�[@��H�-P�H��L�df�H�;H�������u	H�CH��uH��L9�u�1�H����[]A\A]�I�E�H��[��]A\A]�f.���AUATI��UH��SH��H��(dH�%(H�D$1�H�>��H����L�+A�E��B<2��H�<���Hc�H�>���H�5��L���)�����um�CP�SM�$$I��PM��tSH�S(H�s I�����A�H�����I�<$H�$�&H��t!I�T$H�BI�T$H�H�D$I�D$fDH�D$dH3%(�H��([]A\A]�f�H�5ӷL��聹����u�CP��M�$$I��@�V���fDH�5��L���Q�����u��CP�{M�$$I��`�&���fDH�5C�L���!������a����CP�GM�$$M���J���H�S(H�s H�����I�$�1���f�H�5	�L���Ѹ���������CP��M�$$I�����f�H�5�L��衸��������CP��M�$$I��p�w���f�H�5��L���q�����������CP��M�$$I��x�G���f�H�5��L���A�����������CPukM�$$I��0����fDH�5��L��������tmH�5B�L��������>����CPu(M�$$I�� ����H����PI�$�]���@�KP �����I�$H�D$I�D$���D�CPu�M�$$I�����������AWI��AVAUI��ATUH��SH��dH�%(H��$�1�H���f�BPuPH�H��tx�@\trH�^PH����I�?�H�5���a�������H�shL��H���J)��f.�H��$�dH3%(�4H�ĸ[]A\A]A^A_��I�?�H�50����A�ą�u�I�]PH���H�=��$���D$A�GP��I�L�h�@��D<0wiH����Hc�H�>��DH�5��L���A�����uH�{X��H�5t�L���#�����uH�{`uI�W(I�w H�����H�C`@H�|$�&��������E�����������H�FPH���k�F\@����H�xH�H��H�@`H)��HhH����H����fDA�H�E�pH��P�H�5��I�EPI�?H��������r�������H�5F
L���I�����u
H�;��H�5S�L���,������$���H�{ ����I�w I�W(L�l$@1�L������L���J�����`(��L��H��I����������H�D$HH9D$@�����=�DH�5Y�L��豴���������H�{P�����I�W(I�w H���>��H�CP���DH�5Q�L���q������i���H�{(�^���I�W(I�w H�����H�C(�E���DH�5�L���1�����uH�{0��H�5�L������������H�{@����I�w I�W(L��$�1�L�����L���.�����D'��L��H��I��覿����x*L���z���H��H�����H�KHH�S@H��H�C8L���8���H��$�H9�$��������D�� A�GP�l���@H��p�PI�EP�d���I�W(I�w L�t$ 1�L���=���L�������&��L��I��H���+��L��$����������/��1��f.���/��D�JB�L�ʄ�u�M;M�L�����H��H�����H�{H���$�������H�KH�SH��L���.���H�D$(H9D$ �~������f�I�W(I�w L�t$`1�L���Y����d����H�����H�����H�$�%��L��I���t���H��$�H�D$�'DH�D$`H;D$hsf�8,uaH��L��H�D$`�>���L��L���c�����xAL��藿��H��H�����H�t$H�<$�H��$��Q���I�}t�1�L������H�D$hH9D$`��H�D$hH�$H�D$`H�@H�D$H�����c���L�4$�L���B���H�I�~���H�$H��H�0���H�CX�(���I�W(I�w H������H�C0����E1�J�tH��L�L$����L�L$H�C����L���4���������I�~�����L��艾��H��H�����H�C ����L��L������������H�5��H���q��H�C����E1����A�����D��AUATUSH��H�GPH����H��H�0H����H�PH��teH�=\1��/��I��H�3A�H��t5fD�.1�L��@��!��H�������t@��!A��H��H�3H��u�H��D��[]A\A]�H�=��1�����I���DH��E1�[D��]A\A]�ff.�@��AVAUATUSH�GPH���b�A��A�ՋPH��t@H�X@�B�H��H��L�d�H�;H���U�����uE��t$H�C�8u3H��L9�u�[1�]A\A]A^��[�]A\A]A^�f.�[D��]A\A]A^�@��ATUSH�_PH������I��H�6H��H��t	舩����t2H�[8H�5�H���a
����t%A�|$uH�5k�H���F
����t[1�]A\�[�]A\�fD[H��1�]H�5ȺA\�S��AWAVI��AUATUH��SH��H��dH�%(H�D$1�H�?L�l$A��E1��y�H�s �H�����H�s(�H�����H�s8�H�����H�s@�H������C\����uUH�{����H�[A��E1�H����H�s\�H���M���E���t���H�s�H���3����^���fDH��L��L�}�D$����H�{H��t�L��H��A�����L���L��H��E1�����H�[H���s����E�&H�D$dH3%(u.H��[]A\A]A^A_�fDH�sH�H����C\�����Z��f.�AWAVAUI��ATUSH��H��@�Ņ���H��I��A��E1�H�$H�;�hH��PI��L�8M��tL���@XH�H��u�H�SH�CH�JH9�v#H���H�C 1�H��[]A\A]A^A_���2A�p\H�K@��uH�JH9�r�H�RI�PH�KH�sI9p�QH�SH�JH9�r�H�2I�p H�KH�JH9�r�H�rI�p(H�KI�p I9p(�LH�JH9��c���H�rI�p8H�KH�J H9��J���H�rI�p@H�KA�H\��tH�r$H9��(����R A�PHH�sI�p8I9p@������H�SH�JH9�������H�KA�@\����������I�h IhI�HL��H�kH��Ih8L�D$�B����������H9kL�D$��H�kH�$M��MD�H��tL�I�@1�H�$A���4���M�e��l���E1���H�n�H�C 1��U�����t��l���f�A�@\t�H���H�C 1��1���H�X�H�C 1�����H�n�H�C 1��
���H�ܺH�C 1����H���H�C 1����ff.�@��H��dH�%(H�D$1�H�T$���H�D$dH3%(uH����t��@��Sf�H��H��@dH�%(H�D$81�H�D$H�t$H�H�|$H�L$�H��H�t$ 1�D$(������t<H�D$ H9D$u H�D$H�\$8dH3%(u'H��@[�DH��H�1���f�H�D$0H�1�������f.�DUH��SH��H�^H�H��trH�SH�3讪����t�H��[]�fDH�S8H�s0H�}自����u�H�S(H�s H�}�r�����u�CPu�H�}H���H�5��[]�M���DH�VH�vH��[]�5���D��AVAUATUS�?����L�%D�.H��A��I���0I�<$H��PL��1�D�0H���l��I�<$H��H�C �̮��H�CH��[]A\A]A^�ff.����SH�H�H�{����H�{ ����H��tH�Í.H��[H�8H�H�@ ��[�ff.���SH���O(H�GH��s�H�{ [�)��f���AWf�AVAUATI��UH��SH��H��HL�ndH�%(H�D$81�BH�H�H;G���a��I�$H�CM���(I�}�����L�l$H�{ L��L��������ttH�|$t�ugfoL$foT$ L��H��MU���H�L$8dH3%(��H��H[]A\A]A^A_�D�t�H�5�L���̦�����x���@1��@M���O����G(�Y���1�뙐I�EH��tH��u�M�uH�5r�L���}������)����M�uH�5R�L���]������u���A�EP�t$�� A�EP�u�����c(�1��%���DH�=��L�t$���I�U(I�u 1�L���D$��L���I��@�_��L��H��I���Q��L��虳���H�5��H�������u<�C(��	ЈC(H�D$H9D$�)��H�|$�ƪ�����9������f�L���8����H�5[�H����������ȿ�����H��8dH�%(H�D$(1�H�����H�L$(dH3%(uH��8�膿��fD��UH��SH��H��H�GH9t
����H�EH�CH��H��H��[]���f���AVI��AUI��H�=��ATUH��SH��H��pdH�%(H�D$h1����f�L���D$4�D$D$$�D$ �c��H����H��H�T$ L���J��H�D$H��L�d$@�L��L�������uAH�|$L���<���Å������A�FH�t$H�|$H��uk�����xr1�1��!@H�t$H�|$H��������xR�1�H�|$H���^������w��H�L$hdH3%(��uVH��p[]A\A]A^�������y��������f����H�T$ L��H���[���H��H�D$�����ɽ��f���AWf�E1�AVI��AUATI��UH��S1�H��8dH�%(H�D$(1�H�D$ H�D$H�D$H�FH�$�H�T$H�4$H��H���������QH�L$ H�T$H��H9�r ��D��uA�$H��H9����<
u�A�FH��u`I��H���EE1�H��H��A���i���IA��I�L�I�^��H�t$(dH34%(D����H��8[]A\A]A^A_�D�|�
tqI��H��tw�D�<
t�H���]����|�
�R���<
�m���H��H9��J���@H��1�H��H����H��H)�H��I��迪��M.������
H��u�D�:
t�:
��������H��w�랃����������L��H�
��1��@H�5ղH�=M������AWf�1�AVI��AUATUH��SH��H��8dH�%(H�D$(1�H�D$L�l$ H�FH���L��H�D$�������x�����H�D$E1�8
A���L�|$ I����H�D$I�w�H��f���u�EH��H9�t$�P��
w�u�1Ҁ8
��H��A�FI�H9�u�H���c���I�H�t$L��H��I�D�I��c�����{�����������C1�H�߅�@������I���H�PI�L�I�VrOH�|$(dH3<%(��u8H��8[]A\A]A^A_�@1�A��h����������S1��@�����6���L�w�H�
�1��vH�5#�H�=���.���ff.���H�FHGH�H�FG����AWAVAUATUSH��8dH�%(H�D$(1��H���:H�D$ I��I��I��H�D$H�D$1�H�$H�T$H�4$1�L���!
������������H�|$ H����M����H�t$���@�T�H�K�M�~���
t��
taH9�vM��tH��M����fDM��u[A�$H��L��胧��H;\$ ��H���6��H�T$M���|�
@���E���f�H��u@��tM��t*M�~��H9�w�룐H���v����|�
�k���M��u�A�$H���|���1�L������H�|$ t>1�H�|$(dH3<%(u'H��8[]A\A]A^A_Ã���m��A�U1����������:����|��DATI��UH��S���t"����H��DH���]��t�DX u�H���U���[H��L��]H��A\����AWf�AVI��AUATU���SH���H��H�T$HL��$�H�|$@H�=��dH�%(H��$1�)D$p)�$�)�$�)�$�HDŽ$�HDŽ$�a���H��H��H�D$h����H�|$hH�$�H��$�1�������$�H��$�H��$�觻��H�T$pL��H���w���1�1�H�D$P�y��H�D$`H��$�H�D$I�D$H�D$8DH�|$PH���[�����;H9�$�t�H�T$H�|$`H��������t�L��$�M����H��$�u�H��$�H�x�sH��$�H�x�`H�|$`���H��H��tTH�5@�H�������tH�57�H��譛�����qI�|$(���1���H��$H��$�H����1�����@H��$�L��$�t9H��$1����H��$L��L��H��$��S���H��$L�0L�x��$�L�d$ L��uH�L$8E1�M�������H�l$(L��H�\$0L��L�d$I�̅������7I��N�L-M)�M����E�1I���=A����CA����)A�y���fDL�L$���A��L�L$H��DP �7A�D$���Z��A�D$��$�t.L�L$���;I�<$� �
��Ƅ$�L�L$A�l$A�<���H��}.H�D��>���M9�����I�<$L��L������$�����@H�|$`���H�t$XH�|$P��H�|$ H��(�	���H��$�H���H��$�H�x��H�D$hH��tH�H�|$h�PH�D$@�@��������H��$dH3%(��H��[]A\A]A^A_�I�$H�xtƄ$�E�1A��
uDŽ$��A���$�������M�L9�vY��$��������B�|->�L�d$uI���M�d$I�߉�$�N�L-M)�����DA�M�L9�w�H�l$(H�\$0L�d$����fDE�������b���f�A�y�����A�y�����A��E���A��B����H�5�H���p���������H��$����H��$�H�D$ �%�������A�y��]����螥��H�t$HH�������I���H�\$H�>H�����H��$��m���H��H���������H�|$h����H��$�)���H��$�H�D$ ����ڱ��f.���ATUSH��H�����tw�����tlL���L������H��vh��u+���u"�H�5 �L���
����t&�0��@�H�5��L���d
�����7��ǃ�H��H��[]A\���L�������~���L����z���f�u	H��[]A\�H�߉D$�Y���D$����@��u�fDH�����@��AWAVAUATUSH��hH�t$0�T$,dH�%(H�D$X1��������I��H����i��H�H���������L$,H��H�Ǎq H������I���H�D$H���ȱ��I��H���Q���D$,����H�D$ L��L�-M�M��H�D$I���D$(�D$(H��HD$0H�(H�XH�H9���I����H�D$@I��E1�H�D$L��I��H�����w7���IcD�L�>��fDA�$<
�3<
tǃ�DI��M9�tM��I)�I�BL9�r�I��M��t1L��H)�L9�IG�I��H�����D$(�D$(9D$,v	M���)���H�D$M��1�H�@H�D$H���…���L�d$ H�D$I�L9�����H�L$I���	�A�$<
th<.��<
�8���ǃ�M��thH�t$H�|$�L�T$HL�T$8H�l$@����L�T$8M9�������f�A�$<
t�<
���ǃ����ǃ������H��H�H�H�t$H�|$�H�D$@H�D$H�S��I������I��H�D$ H�D$���@ǃ�M���H��H����uZH�L$XdH3%(��H��h[]A\A]A^A_�H�|$H�t$@�H�l$@H�D$H����M9����M)�Ld$�=���L��H�D$����H�D$�H�D$H�D$H�@H��H�D$1�H�����N���H�D$ H�D$H�0H�����H��~H������H�D$I���H�0������L���a��H���������M)�LT$I�l$H������׬��H�t$H�|$�L�T$HL�T$8H�l$@����L�T$8M9�rM)�LT$I�l$H�8��L�������ff.����H��w.ATA��UH��SH�8H��PH��H��H�����H���H�R���H�C H�g���H�CPH�EH���D���H����5��H��H��H�à���є��H��1��7���H��[]A\�f.�DUH��SH��H���wc�GH�D�Hc�H�>��f.�H�?�=���H�sH�;H�����1�����H�{1�胶��H�;�
����H���H�E�CH�}����H��[]�f�H�?�=����sH�;���H��H�E�f.�H�?�=���H���H�E�fDH�?�=�c��H�sH�;1�H������.���H�{1��ӵ��H���H�E�X�����ATI���UH�-�u.SH�}H��P�PL� H�}H���;��H�CH��[]A\�ff.�@��SH�H�{����H��tH��u.H��[H�8H�H�@ ��[�ff.���AWAVAUI��ATUSH��XL�D$dH�%(H�L$H1�I�E����I�H���jH�D$81�I��H��H�$H�D$EI��L�=j�H�D$H��fD�{���CIc�L�>��f�C�4�Ѓ�߃�A<���B�<	��H�4$H�����I�}��Af�I9�r�H�D$H�8��I�EH�����8����H���������H�L$HdH3%(��H��X[]A\A]A^A_�DC�44@�� �@��	�@��
��@��
�[���H�{1��г���CI���`���C�4�ƒ�߃�A����PЀ�	�< ��<	��<
�N<
t����DC�44@�� ��@��	�@��
�EH�;@��
�H�H�5?��g��H�{1��,����^����C�<4
�����H�{1��
����{�0���H�;�H�5���������I��K�41�1�M)�D�H�<A��=��A��
�}��A��	�%A��
��H��H�4L�T$(H)�H�D$ H��H�;H�L$���L�s�H�;�L�����H�D$ H�L$L�T$(H��H��I9��o���I���0@�C�c���@A�� ��A��=u(�CM�tH)�H�;H�4H���*�����DH���f.�H�{H�L�����<�������CH�3�T$FH�|$�D$G�D$E�������������D�C�C����L�SI�z����C�7L��H�D$(H�T$ H�L$���H�D$(H�T$ H�L$�+���@�C����@H�D$8H�L$M�uH����f��C�;���@H�s1�H������>�H�{H�LvI�}�t?1��հ���C�i���f�H�{H��O���������C����H�D$H�
��M�uH�H�{먺�+����u���D��USH��H���w-H�1��CH�{1��B���H����[]�f��K����������@��ATUS�������ЉӃ��������H�9p.I�����0H�8H��P��X ��L�`H�HuH�
��H�[]A\�DH�՟�H(H�[]A\�ff.�f���SH�7H��H��tH��o.H�8H��P H�[����AWAVAUATI��USH��H����M�������|���M����G(H��I�����E1�1��FD�{$�@�� ��@��	������C$@��
�/A�FI��L9���A�l@��
u��C ��X�{$�NH�SH�s�C$���1�D��@�� �W@��	�M�M߀�]��@��=@��	�����H�BH9��:H�k����1�D��H�5�H�����A�FH�CI��L9��Q���H��[]A\A]A^A_Ð@��
�&�C$����f.�H�CL�{H��H;C�
�
H�5��L��1����H�C�C$���H�SH�s�C �	���@�� �dH�kA�_H��H9��D��H������H�C����H�{�
����H�{�
����H�C�C$�Q�������H�BH9���H��
H��H�L$�F���H�{D��H�L$H��H�5N�1��9��H����H�}�G���H�C���fDH�k���2���H��H9��f���H�3H��H�t$����H�t$H��H������H�CH�k�5���fDH��H�kH9����H�3H��H�t$�ǟ��H�t$H��H�����H�CH�k���fD@��	��H�BH9���H�kA�	���f.��E�D������1��m���f.��C �*����H�3H��H�t$�0���H�t$L��H������H�CL�{�����H���
H�5��H�o�C(���H�CH�@H)�H�C�I���DH�C�t���H�k���A�	�!����M�D����������H��H9�����H�k����fD��ATUS�G$H����t=��uH��=�j���C t
�C(tN�K(H�C�C$[]A\�fDH�GH�oH��H;Gs>�
H�5s�H��1�����H�C말H�{�H�5c�����C u��L�'L���՝��H��L��H�����H�CH�k�f���AWAVAUI��ATI��UH��SH��(dH�%(H�D$1��D$H���+H�D$�D$1�1�H�$�H��H9�vwM�|I�tA�<_t<=u�H��L��H)�H�����A�?_��H�CH9���A�DH�<$L��L�s�D$A�D�D$赹����uQH��I�tH��H9�w�D�l$H)�A��H��L�����D��H�L$dH3%(uuH��([]A\A]A^A_��H��L��L���D$�1���D� H��L�����I�tH������f.�D�l$H)�L��A���x���H��E1��m����ܝ��f.�f���UH��SH��H��H�6H�?赶����u�C9Er����H��[]�@���������AWf�AVAUATUSH��H��L�gH�t$hH�l$xL��$�dH�%(H��$�1�H���)�$�H�GHDŽ$��ǡ���@H�����H�����H�D$8覡����H���H���_����@HDŽ$�H��$������D$gH�D$H�D$pH�D$(H�T$H�t$(H��軍��������L�t$p�*L��軟��H��t1�x���H��1���*u	H���@��$��9�{H�|$蛏��H���ӣ��L�t$8H�t$(�H�D$xL���W���H��L���G���U���f�H�H;C�s�D$gH��$�L�c1�H�@H��$�����H��$�H�5�����(��H��$�1��D$H�AH�	H��$�H�$�D$����H�D$xH�D$XD�D$H�$1�E1�A�H��H�D$0H�@H��H��H�D$@H��H�H�0H�D$ �C�D$`H�@H��H�t$H�H�D$HD��E��I��H�L$P��A��L��A����H�uH����H�$H�|$H�@L�,�耀����u E9uDE�A�E��DE�A����;\$r�D��E���@�D$9���H�$H�L$@�Љ\$�L�l$8H�t$L�t
H�L$0L�|$(L��H�H�@H�l� H��H)�I��I��M��L�d$H��I�J�t �{H��H�=��SHE�1����L��L��H�D$p�J��H�޺L���:��H��H9�u��\$�L$�\$9��e���H�\$8�H���[��H�H�{��H�D$8H�L$hH�H��D$g��H��$�dH3%(�fH�ĸ[]A\A]A^A_�f�H�D$H�x� H�D$ �@<t	@���D;\$��L�t$L�l$PH�T$0D�d$`�5f.�L��舗��L��L��H���J��I��A9�siA�E�D��A��H�$H�RL�|�<t�@��t�A�7@��u��@L���H���I��A�7@��t�@��%u�H�5��L���������H�D$ H�8H�|$p@��ufH�|$�܋��H������L�t$8H�t$(�H�D$xL�����H�t$X�L������T����1�H���F�������H�8H�|$pf�1�H�5i�	1�谼��H�D$p���L�t$�H�5“L���-��H�D$ ;\$v��@L�l$PH�T$0D�d$`����H��L���?��H�|$H��$��
���H���E���H��$�H��$�L��H��$���������H���D$gH�����DŽ$��PH�H�r�@��	���1�D�4�H���|rЉ�$���r�@��	v�����0���鳲��f.����H�7H�H�GH�wH�O�D��AUATUSH��H��8(�s���H��H�H��tH���H�KH��A��$H�H��H9�rY�@������
��H�{H����H��H)�tH�J��x�
HD����H�H�KH�pH��H�H9�v^���(tpv���)����\uhH�PH�H9�s:�x@��
��H�{H����H)�H���=��H�3H�KH�FH�H9�w�H�������[]A\A]�f.�A��@H�H���l���@H�{H��t�H�{t�H)�H������L�kL������H�{L��H������f�A��u�H�{H��tH)�H�����H�H��H;CH���H��[��]A\A]��H��H�����H�{H������fDH���"����1�����H��B������UH�&SH��H��H�H�Of�H9�v%��� v3��(uH���F����x2H�H�KH9�w�H9���H����[]�fDH��s�H��H�뱐H�������[]�@��H�L�GL9���L�
E_.�A�<�SH�AH���H��H�I9�vU�AA�<t$H�AH��H�I9�t5�2H��A�<1u�H)��f��H���C���H��[���f.�L��H)�H���"���1�[�fD������f���ATUH��SH�7H�OH9���L�%�^.�A�<��H�VH��H�fDH9�v]�A�<uqH9�t|H)�H�����H���Y�����~MH��8.umH��H��.H��ɷ��H���1�����~=H�3H�KH��H9�w�H9����H)�H���Z���1�[]A\�H��H��t���@[�����]A\�fD[�]A\�fD��SH��H��1�H�3H�KH9�sm�L��].H��A�u1�<.t���H��[鏿���H�FH��H�H9�t)D�H��C�u�A��.t�H)�謿��H��[�S���H)�H��蕿��1�[Ð��AUATUSH��H�H�OH9��G����8"����H��H��H��A�$H�H��H9������
��v\��"����\��H�PH�UH9����x@��
wI��H��rvfDH)�H��H����H�uH�MH�F�S��uDH�}t=H)�H��H���Ǿ��L�mL�����L��H��H��譾��H�EH�MH�pH���@H�EH��H�EH9��9���H�������[]A\A]�H��H)�t�H�J��x�
HD��f.�H)�H��H���B���H�EH��H��[]A\A]�۽��ff.���UH��SH��H�7H;w���H��<.u{�
�H�KH9���H�=|[.�Ѐ<us1�<.tmH���Ž��H���m�����~KH��<"��<.�„�tH�>[.�<��� H���Ǵ��H�3�<"u�H��H���ұ�����H��[]��H�FH��H�H9�t!D�H��B�<u�A��.t�H)��g���@H)�H��H���"���H��1�[]�f�H��1�[]��1���@H��H��[]隼��������r�����AUATUSH��H�H;G�����8@���H��H��H��H��Z������~H�3�>[tH��H��H��[]A\A]�E���DH�KH9��p���H�FH�H9�vCA�$���[t5wG������
uzH��H)�ubH���:���H�H�KH�pH��H�H9�w�H�������[]A\A]�@��\tK��]u6H)�H��H�P���H�H��H��[]A\A]鑻���H�J��x�
HD��f�H�H����H�PH�H9�s��x@��
wZI��sTH)�H��虻��H�3H�KH���^���f.�H�{t�H)�H��H���k���L�kL��菌��L��H������@H���������AUATUH��SH��H��L�f�Ӻ������H��H���P����~|H�UL9�tsH��8/u[H��H��H�蜺����~x�/H������H��H��L�m���H�M��xDL9�t?H�H;St�:;u1H��[]A\A]�fDL9�vL��H���`���H�������[]A\A]�I9�s���f�L;es������AWAVAUATI��UH��SH��H��H�H�z��H�1�H;Ks
�9;t�����H��[]A\A]A^A_��H��H��H�詹����~ҿ@��H��H��I���~����~�H�D�(A��=u�H��H��H��m���A�Dž�~$H����"tJH;Cs��=tOH��H����}��A��L�����I�$E���Z�����U���1�H���6����.���H��H��趭��A���I�&�A��H���t���H�H�PH�H;SsD�hA��;w�M��s�L���+��I�$�D���0uH��u!1��fDH���H��������H�q�H���������UH��SH��H��H�H��tH�>�ω��H�E1��C0H��[]�fDH�{H�-�H��HD���@���G0��t	���G01��H�$�H�������ff.���L�GM��tuH� t^S�G0H�Ӄ�t@��t��uiH�H�>�;���H�1�[�@H�9R.H�H�1�[H���L�L������H�1�[�H�ӇH�������H���H������þBH�=��蝁��f.����0uH��u!1��fDH�A�H��������H��H���������H���H� ��AVAUI���@ATI��USH��H�?蘰��L�sH��M��tL���4���L��H��H�����1�H���,���L�sL������L��H��H���Ҷ��1�H������L�s L�����L��H��H��讶��H�EI�EH�EI�$1��C0[]A\A]A^�H���H�������H�u�H�������f.�D��H���H� ��AUI���@ATI��USH��H��H�?覯��H�SH�5K�H��H��1����H�S0H��t�:uP�S@f��uaH�S H��1�H�52�����H������H�EI�EH�EI�$1��CBH��[]A\A]�@H�5�H��1�����S@f��t�H�5хH��1�����H���H�������H�i�H���������H���H� t{AUI���@ATI��USH��H��H�?誮��H�SH�5z�H��H��1��"��H�S H��1�H�5M��
��H���0���H�EI�EH�EI�$1��CBH��[]A\A]�H�ԄH�������H���H�������ff.�@��I���H�=�������u"H��I�@8H�����H��H���@1��ff.�f���UH�͹I��SH��H�=AH�������tF�H�=ǧ	L�������1���uH��ttH��H�s@蘫���¸��xEH��[]�fDH��tH�;H������H�C0H���[]�H�C0H���[]�@H�/�H�E������fD1�f�C@H���[]�ff.���AWI��AVAUATUSH��H��8�oBdH�%(H�D$(1�@��u/H���_1�H�\$(dH3%(��H��8[]A\A]A^A_ÐH���H�G81�H��t�H��H��L�t$E1��+��L�l$H�D$H��H�D$��H��H�D$ �fDA��H�|$ L��L������~A�D$E��u0��uH�t$�H�=�������t�H�|$ �����@����vHH�|$ H�t$�I���H�|$�g��H�t$H����H�=�1����I��������fDH�|$�v���H�|$ H�t$H����H�|$A����f��H��t�H�;H���'���H�C8E��yH�t$�H�x�H���������H��H�=��1����I�������n���f�H�5:�H�t$�N����Z���f.�H�	h.AVAUATUSL�(L�`M�M9�tJI��H��L����H��I9�t/H�H��H�8�i����u�H��L)�H��A�H�[]A\A]A^�@[1�]A\A]A^�ff.�f���H��dH�%(H�D$1�H�t$�^���H�T$dH3%(uH���蔃��@��H�����H��(H�|$H�?H�t$dH�%(H�D$1�����H��tH�g.�t$H�=�f.H���ƾ��H��f.H�=�f.H�t$�N���H�D$dH3%(uH��(�����@��SH��H��H�?dH�%(H�D$1�H�t$���H�������H��f.�t$H�=|f.H���C���H�D$dH3%(uH��[�蘂�����AUI��H�=�ATI��USH���{~��I�uH��H������H�V�H9��+���H�EH��PH��H�(H��L�h(I�4$蝷��H��H�CI�t$茷��H��H�CI�t$�{���H�C H�CH��H��[]A\A]�D��USH��H�H��tVH�H�C(H�@8H��tH���H�k H��tH������1�H��H���G���H�H��tH�H��H�@H��[]��DH��[]Ð��AVI��AUI��ATI��USH�o(H���Eu1�L�����H��uH�EL��L��L��H��[]A\A]A^��DH��[]I�A\�����A]A^����H�G(�` D��H�G(H�@(H��tSH��Ѕ�x[�H�;���[�@1��ff.�f���H�G(H�@0H��tUH��SH��H���Ѕ�u#H��[]�@1��DH�}u�鐝��@H�;u�驝��ff.�f����&d.�P�d.��~	��H��H�uK.�@H�����H�8莣��H�=I.H��c.H��c.者��H�=�I.�t���H�==I.�h���H�=1G.�\���H�=�K.H���L���ff.������c.���}c.��~	��H�=Yc.�Dc��@��AUA���HATI��U��S��H��H��J.H�8H��PL��D�hH������S@�C<0uH���	�S@�h����H�5g~1�H�C�q���H�5zH.H�CH������H�{H�5L~�����s@H�{���~p��H�����H�C H��H��[]A\A]�@��USH��H�H�H�{ �Cb��H�{�ں��H�{����H�3H�-�I.H��t
H�}H��P H�H�}H��H�H�@ H��[]��ff.���H� ���t�fD�{����H� �3�����H�W 1���\t���������H�G �������������w<����H�w(H�W0���UH��SH��H��軆��������H�K 1�H���H�@H����EH���H�H��[]����ATUSH�G H���H�H�hH�H9�t.I���f�H��H9�tH�;L����b����u�H��[]A\�1�H��[]A\�fD��ATI��UH��SH���
����������H�C ���A�$H�C [����E]A\�f�SH�H�H�{�<���H�H��tH�H��[H�@���[�ff.���AWI��AVI��AUI��H�=f|ATUSH��H��dH�%(H�D$1��qx���8I��H�L��PL� I�} H��H��L�p0H�xL�x(�`����H�5|�EH�|D.H�H�E I�}�\����UH�5�mH�EH�������uH�=�X1��u��H�}H�����H�=�{�����L�u�D$����UH�5�{I��H��1����H�3L�������	H�5�{L��赨��H�sL������H�}H�H�5D���H�SH�}H�5�{����Ch��'��o� �����H�}H��{H�5�{谱���Ch���������H�{t4�	H�5�{L������H�sL���.��H�SH�}H�5�5�Z���H�{t4�H�5^{L���ߧ��H�sL������H�SH�}H�5K{����f�{l�f����v���f�������f����f����f����#���f���B���f���Rf����bf��������f��tf;��tH�5{L��1��������f��tf;��tH�5�zL��1���H�C H��t	�8�8�CH��tIH�SPH��t@H�}H�5�z�����SHH�}H�5�z�=��H�SXH��tH�}H�5�z���@H�S`H��tH�}H�5�z�ǯ��H�C(H��t	�8�H�C0H��t	�8��H�C8H��t4L�(L�xM�M9�t%�	L��I���W���I�u�L���+��M9�u�H���t#H�5�zL�����H���L������
L������H�}��H�5�x���H�=Hz�P���1���H�]xH��H���y����ubH���q��I�T$I�~`I�4$�P��H���WH�|$��b�����ٕ��H�L$dH3%(H���[H��[]A\A]A^A_��H�
�y��H��1�H�5�w諺���f��H�5xL������Ch ���H�5�wL���Τ��H�}H���H�5�w�����Ch��g���@�H�5�wL��蔤���Ch��L����H�5�wL���u����Ch��5����H�5�wL���V���������H�5SwL���<����Ch���@L���L���A��H�5zmL��H��1�����L���%��H�}H�5�wH���R������f���L���H�5swL��1�������H�}H�5�w�Z������f���$���1�H�5CwL��詰�����H�}H�5ew�"���f��������H������H�}H�5	wH��赬��f�������H����[��H�}H�5�vH��般�����f�������H�}H�5�v訿�����f�������H�}H�5�v舿��f��������L���H�slL���_���������L������H�5�vL��H��1�賯���b���fDL�klL�����H�5�kL��H��1�舯��L�����H�}H�5vH��轫������L���H���L���^��������L���J��H�5vL��H��1��&�������H�]���H��tH���v������H�
�w��H��1�H�5�t�^l���b���f�L��H�51v謡��H�s0L������X����H�5�uL��脡��H�s L�����H�S H�}H�5�u�Ī���CH���������@�L��H�5�u�<���H�s(L���P��H�S(H�}H�5�u�|��������H�}H�;tH�5*t�Y������@H����l���|����s��ff.����G����H�G���Ð��H�GH������H�(�����H�G ����UH��SH��H��H�wH�=*udH�%(H�D$81����H��H�$�uq��H��H�l$H�D$�cq��H�{�H�5�rH�D$H��H�D$ H�D$(�D���H�=�t�P���1��H��rH��H����s����tWH�
�t�H��1�H�5�r�Z���H�CH��H�x`�5���H��x0H�D$8dH3%(ujH��H[]�f�H���xk���fDH�[�#�H�rH���cs����tH�
@u�#H��1�H�5�q��i���H���(k�����q�����AWAVAUATUSH��8H�(H�|$(��H��H�T$H��t$�����5H�5�q����H�=�t�PL�H�D$ M���"L�l$E1�H�-=sH��sL�%�s�sM�qI�U�H��L�D$(H����������H��L����������
H��H�=�s�������I��M�MM���H�L��H��������v����L��H�=s������\���I���=L��L�L$��s��I��H���:���L�L$H��L�����H�L$(I�WH��H�y�	�������@H�D$L�H�D$ L�L$���1��SH�>pH��H���q��L�L$���rH�
�r�SH��1�H�5p���L�L$H�D$(1�L��1�L�@0H��P(H��8[]A\A]A^A_��9H�5�o�G���H�=�q�PH�D$ H�D$L�M���-���E1�@�D$������H�sHc�H�>���I�xH��H�5<p�����f����I�xH��H�5�q����F����I�xH��
H�5�q�ĥ���&����H�D$ ���1��NH�oH��H���Dp�����,H�
���NH��1�H�5�n诱��H�|$(H�L$L��t$H�G(L�G0H�G(��H�|$(���H��8[]A\A]A^A_�H�\$ H�5��H�= rH��P@���1��WH�gnH��H���o������H�
��WH��1�H�5<n�����_���fDH�\$ H�5�pH�=�qH��P@���1��[H��mH��H���@o����t,H�
���[H��1�H�5�m诰�����f.�H���f�����H��L�L$��f��L�L$���f���S1�H��H�=0p����H�S H��H�z`�j��H��x[�H�C �l�H�OmH���H���n����t(H�ߺl1�[H�
.pH�5#m��d��f.�H��[�Gf�����U��H��H�5�lSH��dH�%(H�D$1�H�H�H�xH�$�@���H�=�n�PH��H�=OpH��P@���1���H��lH��H����m������I��H�
1oH��1���H�5hl�?���H�$�pH�@H��h�x���H�<$1�1Ҿ����H�G(L�G0H�G(��H�$H�x�p�IN��H���A�H�D$dH3%(uH��[]�f.�H���(e�����k�����SH��H��x�,���H��hH�G(H��tH�W0�[��[�ff.�AWAVAUATUSH��H��dH�%(H�D$1�H����H��H�t$A��I���{������D�|$L���L��L��褸��H��H����E��tCL��L��訊�����+���I�.�H�T$dH3%(��H��[]A\A]A^A_�DH����T����t�D�|$L����fDH������H��nH���l����t,1���H��H�
�oH�5an�_b��������m���DH���c��������V���fDH������H�nH���k����t,D�D$1���H��H�
~oH�5�m��a��1�����H���Pc��1����j��@��AVAUATI��UH��H��SH��0dH�%(H�D$(1���^���H�=PPH�I��H���������I�EH����I�}�fH�t$H���)y������I�}H�t$�y�����w�L$�T$H�5�hH���Ĩ���������H�\$(dH3%(�zH��0[]A\A]A^�D�H�=�lH��������R�H�=�DH���������H�=�DH��������n�H�=�lH����À��ۅ����H�=�lH���������H������H�;lH���i������M��H�
o��H��H�5l1�������	`�����@�H�=
lH��������������h��H�=�kH����������H����E�H��kH���i�����RH�
;m�E��I�EH��t�H��`f�H��)D$�����H�=�dH��H�D$�����u���I�EM�EL�
EkH����L�=kL�@kH�CkL�%GkL�-GkL�5Pk�D�L$I��I�H��tC�H��L����€���tع
H��L����€�����I���L$I�H��u�H���H���H�t$1����e���H������H�bjH����g��H�
�l�����Lf�H�߻�����_������fDI�}H����H�����u������1�����
H��L����€���u�L$����H��H����€����
�L$����I�}H����pu����y�H����i�H��iH���f�����4���H�
Uk�i�ifDH���1�H�@H������H��������H������H�iH���f��������H�
�k��H��H�5�h1��������\������f�H����U���I�uH��`�r���H������fD�H��L����€���t)�H��L����€������L$ ���@�L$�{���H����v�H�KhH����e���������H�
Oj�v�0���DH������H�
hH���e��H�
�j�������������H�ƹL�����������L$@����H������H��gH���$e�����\���M��H�
�A���i�����c����H��@����������H�����H�5��-H�=��-�L��f���AT�I��H�=�gUS�t_����H��H�H��PH��H��`L��hI�D$H��H���I�|$I�$�o��H���H��d�1���H�J..��H��H�8�c���Hǃ�H���H��[]A\�f���AWAVAUATUH��SH��H��(dH�%(H�D$1�H��H�F@HD��������H���1�Hǃ�Hǃ��bm��H��x親��L���L���w����uCH��hH�G(H��tH�W01���H�D$dH3%(�<H��([]A\A]A^A_��L��E1�L�|$E1��mN��L�t$H��H�$�!�H�|$H���-������B���H�<$L��L���3�����t/H�|$�uK����u�H�|$A����m��L9�|M��u�I���@H���8m��H���1���B��E������L����{�H�eL���b����tUH��).�{E��H�
�gH�5�dL��L�H��(.U�0E)�1��Fh��XZ��������a���fDL���Z�������`��fD��AU�H�{dATI��1�UH��SH��H���dH�%(H�D$1�H����a�����7M��H�
�dH��1��H�5)d�7���L���OU��H��H�H�����H�=��H����€������H�=�dH����€�����H�ƹH�=9<������$H�s�H��H���0�…�~TH�<$H�S������H����H�\$dH3%(��H��[]A\A]�@H�s�H��H�����…�F���t�L��H�=�c1����H��H���a~��������f.�H���xX������H�<$H�S�认����a���@H�{�G�������H�s1�H��H���M�…��m���H�<$H�S1��d��������f.�L����-�H�ubL����_����t%L�H�
�eL��1��-H�5Nb�LV���
���L���W�����H����"�H�bH���_����t"H�
�b�"H��1�H�5�a�U�����H���\W�����H�����H��aH���G_����t�H�
e�H��1�H�5�a�U���d�����]��ff.��SH����|��H� &.H��p1�H�H��H9�}	H)�i��I��H�
��H�5Ia�G���H��x[�ff.���U���H�aSH��H��H���H���^����tGH�SXH��hH��H�
�dH�5�`L�
D�@��1���T��H��H��H�5�a[]�+���H��� V����ff.���USH��H����X��t8H�5	<��t_H�GXH�5�0�x����H��H��[]�����H������H�5`H���]����u$H���U��H�5aH��H��[]�O{���A�@��H��1�H�
dH�5�_��S�������H��H��H��[]�:���f.���SH�H�5�`H�H����z��H����6q������y��H����R���H��x����H����Z?��H����M��H��`H��tH�H��`[H�@��D[�ff.���USH�������y��H��#.H��H��xH�H�G�茣��H���Ԃ����xpH��h��H�=�_�H1�螩��H�{`H���X��H����H��hI��H�
x����
H�5�^�x<蔨��H��x1�H��[]�@�kB��H����8
����H�\^�H����[����t.H��hH�
����L�1�H�5,^H���'R��������H���S��������H�����H��]H���q[������H�{`�p|��H�
Ib�H��I��H�5�]1��@a��H�{`�G|��H��H����x�������������H��]�H���	[�����a���H��hH�=�!H�0�n��H�
|��I������H���R���ff.�f����7V�����AUATUSH����\��w��H��hI���H8�Y�X8��t>H���A��L��H���y���H����w��L��L��H���b���H����[]A\A]�DH��h�P8�Z�X8�ff.���H����\��w��H������-x������w��H�����AUATI��H��UH��SH��dH�%(H�D$1��tM���H�=�>I��H�H����À��ۅ�upI�}H��tgI�}t`H����g������I�}H�t$��g����x~�L$�$H�5�3L���x�����yA@I��$�������S��A��$�� H�ƹH�=�3���1ۄ���H�T$dH3%(��unH��[]A\A]�fDI��$p���H�aH����X����t+I��H�
�5H��1���H�5�`�+O���V���fDH���P���C����NW��ff.���USH��H��H��p��\uc��H��`�H���JX����u&H���.P��H����R�����H��[]�@H�
h`��H��1�H�5I`�N�����H�5`�H����W����t�H�
����H��1�H�5`�FN���@��SH��I��H��H�=
�H�������uI�8H��tH�r��e����y�CH�H����=Q���[�fD��AVL�vAUATUH��SL�fH��L�.M���������L��H����n�������H�=�1L��L��p�����uK�PH�0_�L����V������L����N��H����P����������[]A\A]A^Ð�SH��^�L���V����t�H��H�5��ԫ��H�
21�SL��I��H�5�^1���L���f�H���L��L���[]��A\A]��A^�fDL�vL�%�i����L��xH�
�3L��1��PH�5B^�|L���%������UH��SH����7��H������O�����D�H����[]�ff.�f���USH��H������������X������t+��t���H����2O�����H��[]�@H��p���H�y]H���0U����t,A� ��H��1�H�
�`H�5O]�K����H����L���fD蛱���P���fDH��p���H�	]H���T����t�H�
]��H��1�H�5�\�K���,���f.���SH�������,���H���耛������[����AUATI��UH��SH��H��L�*I����Z���H�H����M���H�=WH�������u9I�4$H��t�H�=S���������CH��1�[]A\A]�@�H�=h\H�������u.I�,$H��t%H����P��H�{H��H�����H��1�[]A\A]ÐI��p���H��[H���pS����uH���TK���CH��1�[]A\A]�H�
_��H��1�H�5y[�I���͐I��p���H�Y[H���S����t,H�
�[��H��1�H�55[�oI���C���fDH����J����fD��H��@����p�����H���USH��H9>��p��H��H��H�5�Z�D�z��H��H�H��H��[]�VY��fDSH��hH9�p�rp��H��H��p�|z��H��hH��p[�ff.��UH��H��H��pSH��H��H��H��h�[���H����H�H��tH��pH�5�P�7���H�SH��tH��pH�5�����H�SH��tH��pH�5�Q���f�{�d�Shf���7f�{,���Sjf����f�{@��f�{Tu]�Slf��u4�Snf��uH��[]�@H��pH��H�5Q[]�Ǚ���H��pH�5�P譙���Snf��t���f�H�{T����H��pH�5�PH���A����Slf��t��fDH�{@���H��pH�5ePH������f�{T�I����@H��pH�5pP�-���f�{@�����H�{,藬��H��pH�5(PH������Sjf������f�H��pH�5P�ݘ��f�{,������H�{�G���H��pH�5�OH���q����Shf���}����f�SH��H���H��t�KS��H���H��t4�:S��H���H���K|��H���`��H����ז��H�����`�����u?H���t8H�����m��I��H�
������`�H�5�W���H���[Ð����H������H����e�������[�ff.��UH��SH��H��H��������uAH���H��tH���y{��H���au�����H���_������^H���l:��H�{`�~�����t2H�{`H��莚��H�{`�z��H�{`�Lm�����*1�H��[]�H�CH�=�)�P$�p 1��Л��H�{`H���D�������H����l���H��.H�H�����2��H��H���H���z�����u;���I��H���L�������H�IV�c���H��������H���x9����Q4��H��p�8
���{H�V�H���M������L��xH�
��H��1��{H�5�U�D��H���t������������H��p���H��UH���ZM������H�{`�Yn��H�
�U��H��I��H�5qU1��C��H����������H���©��H�����������������S���H����D���\����xH�U�H����L����t�H��xH�=Y�x`��H�
I��xH��I��H�5�T1��C������H���{D���]�����j���SH���g�������u1�[Ã�H�߈������H����[������������[�ff.�f�SH�������xH����w���H��[두�����[�f���AWAVAUI��ATI��USH��H��(dH�%(H�D$1�H�H����E��I�uH���zc�������	H�=�&H������������H�={&H��I�U�H��p��������H��S�H���OK�����71�I��H�
!TH���H�5mS�A�������A�EL������I�<$���1I�} �H��PH��I�E(��tO�E�L��L�
�%M�T��H��I9�t/L��L��L�������u�I�} I�p��~��H�fDI�,$E1�1�H��tKf�H�5�SH������I��H�D$H��t�=H���WL��I9��.�CI�,�H��L�4�H��u�I�E1��3H�vRH��pH���&J������H�5�PL���_���M�EH��H�
"SI���3H�53R1��{���H�L$dH3%(���H��([]A\A]A^A_��A�EL��蟥��I�<$�����sI�} H������H��H�V�H9��7h��H��PI�E(������D�s�1�I���
f�I�E(H��I�4I�} H�,�w}��H�EI9�u����f��L���sH�����H��H���Bk��L��L��H��H�$��t����M�4�H�D$I�.H�D$H��uP�H��H������1�H�5�QH��1��l��H�t$H�<$�H�D$�t���CM�4�H��I�.H��tHH�5�QH�������=H��I��H�D$�dJ��M��tI9�r�H�<$�L���It����H�$�H���y��H�H�{��f��H�$L� �����H���@���(���H���?�����������fD���f��I�} �H��PI�E(�8�������I�} �H��PI�E(����I�<$t[1���H��OH���G����t/M�$M�E1���H�
�SH�5�OH������������F���H���P?��������4�����H��O�H���=G����t�M�E1�H�
�OH���H�5^O�=������������E���e��@��H��.ATI��U����SH�8H��PL��H��������H�5��-H�=?�-H��xǃ�x]�.���mH�5�N1�H��`�n��H�5�.H��pH��H��h����H��hH�5�O�?M��H��h����6��H��hH��xH��H��`H����JQ��H��[]A\�f���USH��H�dH�%(H�D$1�H��`H�H�߀���H�$蒢��H����������H���6��H��诀��H��h��m��H�-�.H��xH�}H��t
H��P H�}HǃxH�H��P H�D$dH3%(uH��[]��"D��f�������D��H��x�@��ATUH��SH�>H��t*�	H�5
D�q��L�#L���0B��L��H��H����p��H�{t H�5QDH��	��p��H�sH�����H�{t H�5�DH���p��H�sH�����f�{�)�Shf���4f�{,�E�Sjf���bf�{T�sf�{@���Slf��t
f;Sh���Snf��tf;Sjul���u}H�CpH��t	�8��H�CxH��t:H�L�`I�L9�t+f��	H��H���/g��H�s�H������I9�u�[]A\�f�1�H�5;MH����|�����t��H�5CH���o���j���DH�5�LH��1��|���7���f�H��H�5�C�lo��H�spH��耑���:���1�H�5�LH���W|��f�{,�����H�{,�S���H�5�8H��H��1��/|���Sjf�������1�H�5dLH���|��f�{T�����L�cTH�s,L���+�����u���L�����H�5�BH��H��1���{��f�{@�Y����L�c@H�sL���`+�����:���L��谞��H�5sBH��H��1��{�������H�{臞��H�5�7H��H��1��c{�����ff.���AWI��AVI��AUM��ATM��UH��SH��H��XdH�%(H�D$H1����t<�P����q<
�iH���@�H����T<
�LH�����u�I����t&��H����$<
�H�����u�H�5�AH�D$f��H�t$ H�5����H���H���D$,L�T$H�l$�D$<H�\$�D$(����L�t$0�������H��H�5�JI�Ǹ��L��D�1�����z��L�T$L��L����c���
L���1d��H��H�=uJ1��@���L�T$H��H��L����H��pH��H�5O@�v��H��p��H�5�H��\��H�=M�P���1���H��HH��H���@�����H���f8��L���~2��H��H���3�T$(���H�D$8H�H���H��I�UH�5xH��I�$H��p�R\��H�=�L�P���1���H�EHH��H���?������I�<$H�5�F�1���M�EH��H�
�LI����H�5H1��M���DH���@��D$(Hǃ���I�E1�I�$H�\$HdH3%(��H��X[]A\A]A^A_�H�
�H��H��1�H�5�G�Ӏ������fDH�D$8I�EH���#I�$H��p��H�5LG�6[��H�=�K�PH�ŋD$(��~eH�5�HH�=6A�U@������H�
GH��H���>������H�
oK��H��1�H�5�F�5���D$(��������I�$H�0H�E@H����H�=�@����1���H��FH��H���P>����u$H���46�����I�E����H���6���I�$��H��H�
�GH�5OFL�1�����G���I��L���P����H�5�GH�=1@����1���H�	FH��H���=�����i���H�
�G��H��1�H�5�E�(�������N<��ff.���AWf�I��AVAUI���ATL��USH��H��dH�%(H�D$1�H�B(H�����BBH������S_��H�C H�CI�H����H�-GL�%GL�5,G���H��L����€������H��L����€������H��H�=�F��€������
H��H�=/?��€������K(I��I�H��t;�H��H����€����a���H�xH���ed�����?[��I��I�H��u�H�D$dH3%(��H��[]A\A]A^A_�fDH�sH�x�[�����{�����Z��fDH�pL���p��H�C�[���H�pL����o��H�C�C���L��H����o��H�S H�{H��H�$�g�������O:��ff.�@��AWAVI��AUI��ATM��UH��SH��H��HdH�%(H�D$81����t?�P����L<
�DH�����H����,<
�$H�����u�I����t&��H�����<
��H�����u�f�H�࿀H�$H�5�ED$H�t$H�5��H����@,H���L�l$�D$����H�l$ �E������L��H�5�DI�Ǹ��L��D�1�����Ws��L��L���]���
L���o]��L��H�=�D1��~���L��H��H�����H��pL��H�5�9�Zo��H��p�H�58B�"V��H�=G�P���1��
H�BH��I����9�����L���1��L���+��H��H���v�H�D$(H���dI�$�D$H��p�����"H�5�A�U��H�=�F�P���1��%H��AH��H���G9������I�<$H�5�?����H�
�C�%H��I��H�5WA1��z��H�����D$Hǃ��fDI�$1�H�\$8dH3%(�1H��H[]A\A]A^A_�H�
C�
L��1�H�5�@�3z�����fDH�5�@��T��H�=�E�PH��I�$H�0H��twH�=�:�U@���1��H��@H��H���E8����u!H���)0���%���H�E�H��P���I�$�H��H�
�BH�5G@L�1��y�����H�5�AH�=<:�U@���1��H�@H��H����7����t�H�
5B�H��1�H�5�?�6y������\6��ff.����AUH�
���I��ATI��USH��H��(dH�%(H�D$1�H��H���H���H�<$��H�D$���A��$�H�5�AH�Ÿ��H��D�1�A��$��p��H��t)H�;t#�	H��H���Z��H�s�H����H�;uݾ
H���Z��I��$hI��$pH��A��I��$p�[H�5�>��R��H�=D�P���1��]H��>H��H���r6������H���R.��H���j(��L��H�����|$I��$p���cH�5q>�[R��H�=�C�PH�5AH�=f8H��S@���1��fH�:>H��H����5������H�
�@�fH��1�H�5>�Yw��L���Q��D$IDŽ$�A�E�D$��H�L$dH3%(��H��([]A\A]��H�
c@�]H��1�H�5�=��v�����fDH���@-���fD�iH�5}=�gQ��H�=�B�P���1��kH�Z=H��H���5����t�H�
@�kH��1�H�53=�}v�������3����AVI��AUI���ATL�%�-USH��I�<$H��P��H�I�<$H���Z����H�EH�1�H���H����>������H�5�?I�ĸ��L��D�1�����Sm��A�}��M��tL��L���V���
L���[W��L��H�5O?H�����H��pL��H�5D?�Si��H��p��H�51<�P��H�=�A�P���1���H�<H��I����3����uFL���+��L���%��H��H���c���y�EH���H��t��6��[H��]A\A]A^�fDM��H�
FAL��1���H�5�;��t���fDL��H�5�(L��1��<l��������ATUSH��H�dH�%(H�D$1�����TH��H�H��JH�{X��~��I��H��t.H�=!>蕅��H��L��D$��H�|$�;������Q�������f�}��H�}H�uNH�����5��H�{X�����H�����h��H����5�����t�Ef�}��H�}�M$��H��H����H��p1���H�]:H���2����u(H���)��H�T$dH3%(H��uYH��[]A\�@I��H�
7=H��1���H�5:�Xs���fD�Ef�}�����1��@1��a;������W0�����ATUSH��{H�+H�H�;�����H��p��H�5�9�M��H�=J?�P���1���H�t9H��I���(1����u<L��E1��	)��H�����H�{�8f��H��-H��H�8H��P D��[]A\�DL��H�
b<��1�H�59E1��Xr���fD�;�H��p��H�5�8��L��H�=�>�PH�5<H�=�2I��A�T$@A��$�1���H��8H��I���b0����t.L��H�
�;��1�H�5�8A�������q������fDL��A������(������f.���H�?H���tE1�1�1�1��e��D�ff.�@��SH��H�?H���t�g��H��-H��[H�8H�H�@ ��AWAVAUATUSH��H�$H��H�$H��HI��H��H��M��dH�%(H��$8 1�L��H�����H�H�T$L�t$0H�L$H�T$H�t$H�D$  L�D$ L�t$H�D$���I��H���t|H�D$H���YN���EA�H)I�<$� L��H+D$ H�T$(L��H�D$(�y����t�E����H��$8 dH3%(D����H��H []A\A]A^A_�����H�D$��t��tB�E����E1��z���D�}E1��k���@I�<$L��H��A��sy���E�|���H��
�aM��D�}A��.�����,��f.���AWI��AVL�wAUE1�ATI��UH��SH��H��HdH�%(H�D$81�H�t$,H�|$0H�H�D$����H�4$H�|$�f.�H�EL9��&M��H�L$L�$L)�K�/I�<$I��L��H�D$0����H�L$0L�I�̈́�uP�|$,�u�H�D$H9Ct'�H�5iH��H�L$�EY��H�CH�L$H�D$H�EL�QH9�IG�I���t���H�|$�t�D$,����H�EH)�H��
��L��H�M�D$,H�t$8dH34%(uH��H[]A\A]A^A_��+����ATI��UH��SH���m����u^H�޹H�=�;�H�=S����HD�H���ۈ��H��H���t3H���-�H�8H��PH�L�`H�E1�[]A\�H���������f.���UH�5��SH��H�������tH�5�H���o����uH����[]�f�H�5�H���Q����t�H��H�5�;�>����@��H����[]�ff.�@��AVAUI��ATI��UH��SH��H��H��H�3dH�%(H�D$1�H���E��H�3H�$H9�vBH)�H��
�@K��H�H��A�����L��H��M��u/�a����tMH�H��L���?W���DA�L��H��M��t�A�ԅ�x H�L$dH3%(D��uH��[]A\A]A^�A���������)����H���-H�� ��H��H��H�=�dH�%(H�D$1�H���Vy������J��H�L$dH3%(H�$uH����`)����H��H�?H�H���-H��`f���H�m�-H��`ff.�@��H�M�-H��`ff.�@��AWI��AVM��AUI��ATI��H��UH��SH��(dH�%(H�D$1�H�\$�"'��H��L��L��H�D$�x����xKH�|$H�T$L��H���]��H��A��kV��1�H�L$dH3%(u H��([]A\A]A^A_�f.���������T(��@��H��H��tH�}�-H�8H��` @�ff.�@���ff.���H�?�dt��@��UH��SH��H����i����t'H� �-�H�8H��PH�(H�1�H��[]��������f���H���sm��H�=|.H���*����H�=].�f.�ff.�f���Uf�H��H�5�8SH�=�H��HdH�%(H�D$81�H��H���D$H�$H��H��8CH�C(H�D$�D$(�i=��I��H��H�Q8H�5��H�=�
.H��
.�R{����xFH�=�
.��u���=�
.t9�
H�=
����� ��1�H�L$8dH3%(uBH��H[]��������ېH�5�7H�=281��u��H�=T
.H�E��(���������_&��ff.�@��H�
.� ��ATI��USH��H���o�oOdH�%(H��$�1��oW �o_0�og@�ooP)$�ow`�op)L$H����=�	.)T$ )\$0H��$�)d$@)l$P)t$`)|$pƄ$�uH���2L����xNH��H��H���@b����x<H�]	.H��L��H��PH��$�dH3%(uH�Đ[]A\�f.���������D%��@���=	.ATI��UH��SH��uH���K����x*H��H���a����xH��.H��L��[H��]A\H�@��[�����]A\�fD��H��.�`f���H�H��tH��.H�H��H�R ��D����H���o�oJdH�%(H��$�1��oR �oZ0H����ob@)$�ojP�or`)L$�ozpH��$�H��H��)T$(H�.)\$8)d$H)l$X)t$h)|$xƄ$���$��P(ZYH��$�dH3%(uH�Ę���#����H��H��.AQM��I��H��H��1��P(H���f���H��H�?H�H�p.�`0D��H��H��tH�?H��tH�H�F.�`8����H�-.�``f���H�.�`@f���H�
.�`Hf���H��.�`Pf���H��.�`Xf���H��.�`hf���H��.�`pf���H��.�`xf���H��.���ff.�@��H��.���ff.�@��H�m.���ff.�@��H�M.���ff.�@��H�-.���ff.�@��H�
.���ff.�@��H��.���ff.�@��ATI��UH��SH��H��dH�%(H�D$1��&����t2H��H��H�������t>1�H�L$dH3%(usH��[]A\�DH��������u0H��2I�$�������H�$H��H�=�3�o��I�$������H���LB��H����(��H��tI�$������H�-3���6!��fD��AWI��AVI��AUATI��U1�SH�x3L�kxH���o�oJN�oR V �oZ0^0�ob@f@�ojPnP�or`v`�ozp~pH���H����	f�H�+H��I�4/L���
V��I�,L9�u�H��[]A\A]A^A_�D��ATI��USH�H���PL��H��H��H���F��H��[]A\�ff.���AWAVAUATUH�-�2SL�uxH��(�o�oOdH�%(H��$1��oW �o_0I���og@�ooP)$L��$��ow`�op)L$H���)T$ �o�oN�oV )\$0)d$@)l$P)t$`)|$pH��$�)�$�)�$�)�$�H����o^0�of@�onP�ov`�o~pH��$1�)�$�)�$�)�$�)�$�)�$�H�EH��M�<I�\H�3I�?�l����uPI�H�I9�uͺ�L��L���3������H��$dH3%(uH��([]A\A]A^A_�1������ff.�@��1�Ƈ�f����ff.���H�M.���ff.�@��H�-.���ff.�@��H�
.���f.�D��H��(H�O@E1�dH�%(H�D$1�H�GXH�$H�D$1�H�q@H��u+�0���Љ��t
%�����1�H��H9�t���u�I��I��t
J����1�H�|$dH3<%(uH��(��������8u%H��H��H���E��H����������������f.�AVAUI��ATI��U��SH���o�oOdH�%(H��$�1��oW �o_0@�t$�og@�ooPD$�ow`�opL$(H���H�=�.T$8\$Hd$Xl$ht$x�$�H��$���H�\$L�sL����m��H�=z.H����i��H�D$H����H�t$L��L��@���������H�=D.��H��PH�S@�(H�=+.H�pI�����H�T$H�=.L���cI��H�|$��P��H�D$I�$1�H��$�dH3%(uH�İ[]A\A]A^���^�����x����������@H���xP��H�D$I�$1���H�=|.���L����1�H�
g���H��H�=m�-H�n�-��������g�����H��H��1�����ff.�@��H��H�����ff.����USH��(dH�%(H�D$1�H�=��-tlH�=�-H�\$H�l$�f��H��H�$�DH���p��H�<$H��H���Ac����u�H���u&��H�=��-�9^��H���-H��t
H�H�=��-�PH�D$dH3%(uH��([]��t��@��H�H��H�1�H�GxH��H��H)�������H�H�?-Ƃ�H�B H��=H�B8H�FH�B@�D��H�H��H�1�H�GxH��H��H)�������H�H��,Ƃ�H�B �f.����H��H�=��-�,��H���-H���ff.����USH��hdH�%(H�D$X1�H�=n�-�tH�L$XdH3%(�H��h[]�@H��H��*H��H��HD�H��H��-HD�1�1�H��H�=�K�=��H�L$ f�H���D$(H�sL�D$H�=��-H�A(AH�T$ H���D$H�@m����xLH�=�-��g��H���-H����9��H�H��tH��H��Є�t<H�=m�-�
���������1�H������H�T$H�U������D$�Gr���D$����H�����H�=5�-�@��H�=$�-�����H��H��-H���l9��H�@H����ff.���H��H��-H���d9��H�@H����ff.���H��H���-H���\9��H�@H����ff.���H��H���-H���T9��H�@ H����ff.���H��H�Q�-H���L9��H�@(H����ff.���H��H�!�-H���D9��H�@8H����ff.���H��H��-H���<9��H�@@H����ff.���H��H���-H���49��H�@hH����ff.���H��H���-H���,9��H�@pH����ff.���H��H�a�-H���$9��H�@HH����ff.���H��H�1�-H���9��H�@PH����ff.���H��H��-H���9��H�@XH����ff.���H��H��-H���9��H�@`H����ff.���H��H���-H���9��H�@xH����ff.���H��H�q�-H����8��H���H����ff.���H��H�A�-H����8��H���H����ff.���H��H��-H����8��H���H����ff.���H��H��-H����8��H�@0@��H����f.���H��H���-H����8��H���H����ff.���H��H���-H����8��H���H����ff.���H��H�Q�-H����8��H���H����ff.���H��H�!�-H����8��H���H����ff.���H��H��-H����8��H���H����ff.���H��H���-H����8��H���H����ff.���H��H���-H����8��H���H����ff.���H��H�a�-H����8��H���H����ff.���H��H�1�-H����8��H���H����ff.���H��H��-H����8��H�� H��tH����fDH�qEH�1�H���ff.�@��H��H���-H���l8��H���H����ff.���H��H���-H���d8��H���H����ff.���H��H�Q�-H���\8��H���H����ff.���H��H�!�-H���T8��f�H���H����@��H��H��-H���L8��H��H����ff.���H��H���-H���D8��H��H����ff.���H��H���-H���<8��H��H����ff.���H��H�a�-H���48��H��H����ff.���H��H�1�-H���,8��H�� H����ff.���H��H��-H���$8��H��(H����ff.���H��H���-H���8��H��xH����ff.���H��H���-H���8��H���H����ff.���H��H�q�-H���8��H���H����ff.���H��H�A�-H���8��H���H����ff.���H��H��-H����7��H���H����ff.���H��H���-H����7��H���H����ff.���H��H���-H����7��H��0H����ff.���H��H���-H����7��H��HH����ff.���H��H�Q�-H����7��H��PH����ff.���H��H�!�-H����7��H��8H����ff.���H��H���-H����7��H��@H����ff.���H��H���-H����7��H��XH����ff.���H��H���-H����7��H��`H����ff.���H��H�a�-H����7��H��hH����ff.���H��H�1�-H����7��H��pH����ff.���H��H��-H����7��H���H��tH����fDH�q@I�1�H���ff.�@��H��H���-H���|7��H���H��tH����fDH�!@I�1�H���ff.�@��H��H�a�-H���T7��H���H��tH����fDH��?H�1�H���ff.�@��H��H��-H���,7��H���H��tH����fDH��?H�1�H���ff.�@��H��H���-H���7��H���H��tH����fDH�1?H�1�H���ff.�@��H��H�q�-H����6��H���H��tH����fD1�H���f���H��H�1�-H����6��H���H��tH����fD1�H���f���H��H���-H����6��H���H��tH����fDH���ff.���H��H���-H����6��H���H��tH����fDH���ff.���H��H�q�-H���|6��H���H��tH����fD1�H���f���H��H�1�-H���d6��H���H��tH����fD1�H���f���H��H���-H���L6��H��H��tH����fDH���ff.���H��H���-H���46��H��H��tH����fDH���ff.���H��H�q�-L�T$H���6��H��H��tH����H��<I�1�H���ff.�@��H��H�!�-L�T$(H����5��H��H��tH����H��<I�1�H���ff.�@��AVI��AUI��ATUSH��H��@dH�%(H�D$81�L�d$0H�l$���H��H���
\��H��H�D$�����H�D$���H�|$H�D$ �r���H�T$0�t$H�|$ �
��H�|$L��H���mg���Ã�tփ���A5��H�t$(H�|$�NB����u&H�T$ I�UH�L$8dH3%(u1H��@[]A\A]A^�H�|$ �*��H�D$(H��tI�����H��;������f.��ATUSH�GH��X��4��H�-��-I���HH�}H��PH��I�D$H��XH��XH��H�CHH�9 H�CxA�D$tH�6H�CPH�KH�}�H�C H�wH�C(����ƒ����A�T$��	Ј��A�T$����	Ј���"��L��H����E ��L��H��1ɉ���.��H��[]A\�ff.���S��H����HLJ�H��(H��tH���-H�8H��P Hǃ(H��0tH��0�C#��H��8tH��8�*��H��tH����=��H���[�:��f.�H��������o���ff.�@��@��u�fDH�����-��@H�1�H)�H��~rATUSD�AA�XE��x81�H9�s	[]A\�@I��H��H��1�H���5��I�$�H][]A\�H��t��AA��A��A�\1�H9�r��D�ff.�@��SH�G H��H�W(H9��t'H�(����H�w�-H��[H�8H�H�@ ������g2��ƀ��f.�U�SH��H��H���H�$�-H�}H�8HCu� ��H���H�UH��H�u��2��H���ƃH�H��@H��[]�f���UH��AWAVAUATSH��D���dH�%(H�E�1�HDž���E������I��t�=���H��P���ƅ����H�����H������H�����H������H����H������I��pI���H���.I��xH�I��@H�WH9��L1��I��XH9��PA��t	H����A��	�rI����[��I�Dž��(I���H�����L�����I��A��A���������A��
�?I���I���B �L9���I)�A�� ��LI��0ƅ������~I���L������L��L���e������I���H������J�����DH;W�Z0��1��??��I��xI+�pIdžpI��xI������I����QM���
������A���H�����H�]�dH3%(�dH�e�[A\A]A^A_]�DI��8H������L��L���Y�����h
���������A�� �����I��8I����;��H���H�JH��H��H��H%�H)�H��H9�tH��H��$�H9�u��t	H)�H�L�H������H���E��I��8H������H�������	������������I��8�?;��K�t%H����p�����HL��I��0�+���f�H9���	H��H)�A��	H����A���I��x�� A���H��������� H�����A����q����I���VH��CI9E��H�5�=L��1��G��Adž��&���@I��K�t%��C��I��0�e���A�����tu�����I���I��0H�����������AƆ	����fDI)�A�� L����������������I��0�������fD�A �����p���1�H��<H�5AL���&F��H�����Adž� �H���%�t	H)�H�L�L��h���H��X���L��A�T$H������L��H�0H�PA�T$ H��L��A�T$(H�������H������A��D��D��A��H��h��������	Љ�����A�T$A�T$H��X���H��h���A�T$ �H������H��h���A�T$ H��X���H��h���A�T$(A��u�A�D$9�����rH��@���H��@���H��X���H��8����������%H������H��`���H��p���L� H;p��I��0��-��I��0L������I��0�-��I��0��I��*/��I��0L����y��I��0�
/�����F.��I��0I��(��.��I��(L������I��0��.����A�� L��B���AƆ
L������1�M�eL���#��1�H��L���@(��1�L���	��AƆI��0H�����������������������DI����@ ��A����@���Adž�H�����1�L��H�5�=�C��H��������fDI��xH���a�������)@A8E�B���M�I�E	1�I9��u���A�M	���g����I�E
L��Adž@H)�H���?���A�E
L���A�� I�EH)�H������A�EI��M)��I����������H������I9������L�����L�����I�H������L��L���B�������H����H���01�I��0��	�����H����L��L��������\H����H���r1�I��8�'���UH�����L��H)�H���H�PL��H)�H����0H��I��0H�����1�A�� ����P���H��H��x�����*��I��0A���>,��H��x���D�H�I��H��p�������L��H������L�����H������M9���H����I��M�`E�H��h�����
H�����H�u�� D��X���H��L��`���H�������>��H������I��H���H�5�:H������L��`���D��X������vE���8
L��L)�H�� ��A�A�L������H��H��`���L�L�*H���H��X���M�L��@I��I�|$E�<$��H�U�H�E�H3WI3D$H	��>H�U�H�E�H3WH3GH	��%I�D$!L��E��H��`���H)�L������H���>A�L$!L��I��%L)�ɉ�H9��"I�L��H)�H����H�rH��X���ȉ�L��H)�H��H���H9���H��H�L��H)�H�����H��I)�H��8�����Ή�������H��@���I9���A�Ѓ��hH���������J
��H�����H��`�����H�����H������H������L��I��L���H�����I��L��L��H�������:������H��X���H��P���I�uWATj0��`���D��P���L��h���I�}A��KL��H�� ����I�U1�L��H�������*��H������1�H����"��H��`���H�WH��0��
1�H���������H������1�H���"��H�5&7L��1��d>��A����������Adž�H������w���fDI��8H������L��L���N���������H�����1�H�5�8L���=��H�����Adž��!����H������
���@1�����f�H��I��xH)�H�����I���ti� �w��I��I��t$H��H��@���H��H����.��H��@���H��H���I���H��X���H��A������K	����@I�D$!L��H)�H��~.I�D$%L��H)�H��~I��)I9��VL��L)�H�� �Q���H�5
7L��1���<��Adž� �
��Adž@I�E
������I)�HDž����H������H��������H������H��h���I�������A�E
����A�E	���H��H��`���I�D$�H9��u���H��I�M��������E�MfA��fE���
E��I��M9���HDžx���HDž����HDžp���HDž����H�������d����wH������L��H�����J�+M)�A���xI���nD�)fA��fE���wE��I��D��M9��cH�YD�z������u�I��H������I��L����w�i�� H���l��I��L��H��H���������H����������	H������H�1H9AH������H��HFQ�	�����YI��H������L��H�������=6�����
H�
�-H��H�������AH��H��H��H��H���H)�H��H9�tH��H��$�H9�u�%�t	H)�H�L��AH��H��X���H������H��H��H��H��H���H)�H��H9�tH��H��$�H9�u�%�t	H)�H�L�H�AH��X���H��P�����H�
N�-H������H�A H�WH�7H��X���H��H�����H�
%�-H��H��X���H�A(H��@�����H������1�H�WH���������H������1�H�����H������L��H��H�=�4H�������������eH�������H�5L5���H������H������H������H������L�����t$H��h���M��L��L��H����������zH���H�5J41�L����8��H�������&��H���1�L��H�5!4�8��H������A����>���L��x���H��p�������H�����H�5J3L���o8��H�����Adž����M)�J�+I����L������H���������H������A����E1�E1����H�5�2L��1��7��Adž��!�1�H�5V2L����7��H�����Adž���I���t<H������H���������I���I��L��H��A��������C���1�H�5�2L���p7��A�������@H�5F3L��1��O7��Adž�H�����L���n�H�����H�5�2L���7��Adž���Adž� 1�H�5�2L���6��H������#�H���H�5J2L����6��H������A����d���I��������H�5/L��1��6���9���A����B�1���H�5.L���|6��A�������L��h���H������L��L���W���e���H���������L��X���H��P���L����I�UI�uL��H��H�����H��L��H��@�����H��x���H9������,H������H��p���H��������+I��0L��H�='1�@���I��0�H�5�1���L��h���I��0I�WI�7�F��1�L��M�o����1�H��L�����I��0L������4H��`���AƆ
AƆH��H������H������I���1�L�g���1�L��H���<��I���1���I���H���������I���H�����L�����I����H�5�+L��1��4��H�������L���H�5�+��H���H�5,L���4��H������A����!���H���H�5�,L��1��f4�����H����H��H�5,L��1��F4������H�50/L��1��04��Adž� �R�H���H�5�/L���
4��H������A������H���H�5�.L��1���3���v���H����H��H�5�+L��1��3���V���H������L��H��H�=[/H�����������L��`���H������� I�EH��H��`����'��H��`����H������H�p �+��I�U1�L��H��`������H��`���1�H���U��H������L������t,H������H��H���M��H��X���H�����������H���1�H�5�+L����2��H������H��p���H;Xt^L��H�5�+1��2��H����������4�H��`���1�H�_���H��1�H�����H���H�5�-1�L���a2����H������������H�5�*L���<2�����H�5�+L��1��&2����I�]1�L���H������H������L���������H������H��p���H;p�&���H�������4��H��h����H��H�����I��H���x�@H��H��`���H��H��H��H��H���H)�H��H9���H��H��$���1�H�5],L���_1��I���m��Q�������H���H�5%(L���51��A������I��H������L���A�H��H���H��X�����#��������H���H�5�,L����0���t�H���1�H�5�+L���0��A����W�H���H�5�+L���0��A����5�%�t	H)�H�L�A�D$H��H��h���H��H��H��H��H���H)�H��H9��?�H��H��$���H������1�H�_���1�H��H���M��H��h���H�5�)1�L���0����I��8H��x�������I��8H�������J6����tLI��8�J#��AƆ
��I����L��x���I��0L���>��M��AƆ
�X�H������H�5d*L���t/��I��8Adž���"��L������AƆ
1���I��L��I�_���1�H��H���Z��1�L�������H������1�H�5�*L���/��A�����H�5�(L��1���.���}�H������1�H�_�?��1�H��H������H�5s(L��1��.��H��`����A�D��UH��SH��H����t��H��H���7��tH��[]�@Hǃ1����f��	Hǃǃ u3H��0ƃtH��0�y��H��8tH��8����H��(H��tH���-H�8H��P ǃ@H��H��Hǃ(������H��[]����H���H�H9�@t	�&��@UH���0SH��H��H�H�-H�8H��PH�
��H�X H���H�HH�P(H�(ƃH��[]�@��H�G��@Ð��H�G�� Ð��UH��SH������H��H�����H��H��H���[]�ff.���UH��SH��dH�%(H�D$1��~��H��H��ƀ
H��ƀƀ��K��H��0��t H�L$dH3%(H���u(H��[]�f�H�$H�5'H���],��ǃ������ff.����USH��H������H��H������H���H��H��xH��[]�f���SH���H��tH����B��H��tH���	��H��H��tH���-H�8H��P HǃH��(tH��(����H��0tH��0���H��tH���s:��H���[�v��fD����@t@��u�DH����l��@H���t�H�����������@��uH���f�H���H���0��UH��SH��H��H����x>��1�H9�t%H��x,H�5�'H��1��*�������ǃ�H����[]�H�����H���������[]�f.���ATUSH��H��dH�%(H�D$1����tH���H��t	��@t+H���K��H�L$dH3%(�PH��[]A\�fD��Bƃ@t����I����)���H���/��H���L��H��H��������H�UH��t8H�u��tH��L���=:������H�UH�uH�������x=1�H������uM��}H�UH���%���H�uH���l���������������H�$H�5�'H���9)��������H��L��H���^��u�H�$H�5�'H���)���������H���H���#��H�UH���t�������b��H�$1�H�56'H���(�����z���D��AWAVAUATUSH��H�$H��H�$H��dH�%(H��$� 1���@�~����BI��I�����NL�t$0H��$�� E1�L���%��1����X�C�L�l$E1�H��I�DH�D$H�D$(H�$H�D$H�hH�H�D$H���E1��YfDH�T$8H�t$0A��$t#I��$H�$�J8�����H�T$8H�t$0L�������xeI�I�H)���1�L������H��L�$L��HF�H�D$I��$�J�4(H���c���k���H�T$(H�5�%L���7'��I�����H��$� dH3%(L����H�Ę []A\A]A^A_�@H�=�%�5���D$$A��$�!A��$B���AƄ$BL�t$(����H�����	H�5.'H��H���[���H�t$#H���D$#�D���A��$ f��f�D$(L��H���"��I��$I��$ H���
��I��$H��tH��-H�8H��P IDŽ$H�UL��H�u�!���H�|$$Hc��T���	��H����������fDH�D$H�D$H;D$����L��I�$����f�A��$B��
��AƄ$BL�t$(����H�����	H�5
&H��H���:
��H�t$#�H���D$#�#
���L��H��A��$ȉD$(�
��I��$(L��H��I��$ H�@�DI��$0B�ȉD$(����I��$(1�H��H�������-��I��$01�H��H������-���L��H���D$(���A��$ �ȉD$(�=���f.�H�T$(H�5#L��1�I������$���N����	��f���UH��AWA��AVI���HAUATI��SH��(L�-�-H�����I�}dH�%(H�E�1�H��PL��H��H�f���H���H�����H�CPH�����H�C H��H�C(D���b��L��H�=�"�_2����,�������1�H��0���H���H�=~"� ����L�%��-H�惋H�����HDž@���A�D$H�P������H����H��H��H��H��H���H)�H��H9�tH��H��$�H9�u�%�t	H)�H�L�H��H��H������H��H��H��H���H)�H��H9�tH��H��$�H9�u�%�t	H)�H�L�H��H��H�����H��H��H%�H)�H��H9�tH��H��$�H9�u��t	H)�H�L�A�D$H��H�����H��H��H��H��H���H)�H��H9�tH��H��$�H9�u�%�t	H)�H�L�L��P���H����H������L�����H��@���H��L��H��H����������I�D$H��L�u�H�������I�D$ � L��H��H��������I�D$(H�����H��H���������H�����I�����H����H�������H����H��H�����L��H��I����+�����&H��H�������I�T$I�4$H��H��������H�����H��H�����I�T$1�L��L��H���H������Z��H�����1�H���	��H�����1�L��H�=(�A���G� L���L&��H��H������к L��H��H��������H���H�����H���H��H����H�5��A��H�����H��H���H�������H�����H��H���������L��A������~�� 1�L���?��H��@���H�5�1�H�����H������L�����-H��I�����H����L��0���1�L��H���L��L�`�%����I�}�����H���H��(��H��(L��L����H��8�7�����a��tH��L��L���.���>I�}��h��L��L��H��0H���c7�����L��H��������I��H����
1���H�����H��H��������H���A���>	��D�H���I��H����������L��H������L��H��H��������L��H���$��L��L�����L�����I�I�}�H�������H�5��H��H��8������L��H��8���L�����H������G��H���J��I���2��H���5��H������0H�����L��H������M'�������������������)����H������H�����L��I��H��@���H��L��H������(�����AH��I�MI�wM�����A�j0�����I�UI�?�*��H�� ����M�g1�L����1�L��H��L��H����D��H�����1�L��H�=��|���VH�����H�x0L�8�X��H��H���L��� ���H��H���I�w �薿�H�����1�L����1�H��L������H�����H��H����4����H��@���H��H�5k1��d��L�����H��8���A�����芺�f.�H�����H��,����}������L�����L������L��H�߉��i��E��t�@H�M�dH3%(��H�e�[A\A]A^A_]�L�����H���H������H����H��H�������,���H�����H���H��H�������
���L�������f�M�g1�L�����1�L��H����H��@���H�5G1�H���=�������H��@���H���H������A�H����H�����I��H����������L��H���L������������H��*���L����*������H��1�L��H�5Y�+��A�EL��L���ȉ�H����M��L��1�L��H������Y#���L��L��L���A�Eȉ�H������1�L��L��H������"#��A�FH��H��H��H��H��H���H)�H��H9�tH��H��$�H9�u�%�t	H)�H�L�A�FH��I��H��H��H��H��H���H)�H��H9�tH��H��$�H9�u�%�t	H)�H�L�L��I��A�VH������H����L��A�V H��L��A�V(�H�������fD�ډف�L������	ʉ�H���A�VA�VL��L��A�V �L��L��A�V L��L��A�V(��u�A�FH������H��8���H�����ȉ�@������A�VH��8���L�����H��8���H��8���H�@H�� ���H���H�����L����H�����L���P��H������H���A�����M�H���L����A��H��������Ƌ�L��z���H�����1�L�o��1�H��L���K��H���L������1E1����@H��0���H�5ZH������H��,����&����L�����L���o��L��H�߉�������DL�����H����� L��H��H�������R���H�����H����H��H����d���0���L�����H����H�5����H���� L������1�L��� �I��H���H����������I�}�L��*����)��L��H��8���A�WH��f��f��*������I�WI�7H��8����o��D������L��H��8����fA��fD��*����F��L����H������H��8���L���)��H��8���L��fD��*����
��H�����H��8���L����L����L��H��8����E1�A�Ff��f��*������I�VI�6H��8�����H��8���H��8���H�@H�� ���H������@H��H����襲�H��L������g����H���H�����-���N���H�5�H��1��w������H��@���H�5]H��A������V���Z���H��@���H�5UH��A������5���9���H��@���H�5lH��������H��@���H�5QH��A����������H��@���H�5�H��A������������H��H���H�5�H��A���������r���H�5CH��������H�����1�L�g���1�L��H����H��@���H�5q1�H���g������L��H�5H��1��N��A������H��@���H�5cH��1��-������������ff.���ATI��HUH��SH��dH�%(H�D$1�H���-H�8H��PH��H��H��H���H�>�H���H�CPH�\�H�C H���H�C(ǃƃB�7��L���H��t9�$��H��H�߉��Ƕ�H��H�L$dH3%(H��uDH��[]A\�����H��H�߉�莶�H�$H�5KH��H��1�����E�������AUATU��SH��H��H�~���H�{I������I�ă�t4��tXL���s���������P���H��H�{[]A\A]���L���Ա�L��H�����H��H�=;H��1��e���H���K��L��H���`��H��H�=�H��1��<���|������Sf�H��H�G�t��t�����[���[���6���
�������[�ff.�@��SH��H���/��;��x���{��x���H�{tH�{[����[�ff.���ATI��1�UH���SH���H�� dH�%(H�D$1�H�L$�e��������|$��Ϭ�|$���L��H���&���|$� H�$���H�<$H�5�H�D$�/��H�|$H�5����H�|$����H�t$H�<$�1��T$H�5���H�CH�ljS�T$�H�����H���6��H�|$輿�H�{�c���D$H�L$dH3%(u	H�� []A\������UH��SH��H��H���tH���H���g��H���H���H��tH��H��[]����fDH��[]�f���SH��H����\����[H������t1�����ff.���U��SH��H��H�����@��uH��[]�f�H���H��[]���ff.�UH���SH��H��H����"��H�Ņ�x(tƃH����#��H����[]�f.�H�������fD��UH��AWAVA��AUI��ATA�SH��H��(dH�%(H�E�1����D��H��H��H��H��H���H)�H��H9�tH��H��$�H9�u�%�t	H)�H�L�I��L��E�n�L������M��I��M�I�UH���aI�MH�B�H���I�E�T�ƃ����H��ED�E��tKA�V�I�GE1�H��I�T@L(H��H9�u�H���D��L���R��I��H����L9�����I��L���f��K���Lc�M���H�}�dH3<%(L����H�e�[A\A]A^A_]�f.�I��H�
�1�D�M��WH�5q�O��D�M�H���I�E����ƃH����%���S������S������fDH��I������	���U������L�H�
Q1��PH�5�
H�=藪����H���������H���B���f���UH���SH��H�w�-H�8H��PH��H��H�����H�C H�f���H���H�����H�CPH�]���H�ChH��H������H��H��H�߉�[]飯�H��H��-��-���-�h��t�ƫ-H�=fH���=��D�C�����-H��H�=A���ff.��AVAUATUSH��dH�%(H�D$1�H�?tLI��H��L�t$1�L�-
f.�L������D$�L���ʰ���EI��H��H�;u�H�D$dH3%(u
H��[]A\A]A^�����AVAUATUSH��dH�%(H�D$1�H�t\I��I��H��1�L�t$DH�;L���] ��H��t#H�=p�|���D$�SL���-�����]H��H��L�H�{u�H�D$dH3%(u
H��[]A\A]A^��/��ff.�@H��H�=l�-���
T�-�R�-1�H�5���=�-u�0�-1�����H���@������f����	�-��Ð��H��I���ѿH��1�H�5��M��H�&�-H�8�n���˨-H���f������-SH�����-H���-���-��uH�����H�����[H���-�H���r�-t�!H�5%H�=Q�����f�ATI��UH��H�=CSH��H��dH�%(H�D$1�����L��H�߉D$�4��H�]H��H�����H��A��tLH��-H��H�8H��P H�EH�|$�G���h�H�L$dH3%(D��u/H��[]A\���H�5i
H�=�
����H�]H��t���8�����ATI��UH��SH��H�� dH�%(H�D$1��M�-��ta�oH�KH��H�=.�-$H�L$tSH�=�-�����-�-��uH��H��L�����H�D$dH3%(u)H�� []A\�D��-������Ϧ-�������ATI��UH��SH��H�� H�=$�-dH�%(H�D$1�����p�-���7��oH�CH��H�=e�-$H�D$tH��H�=P�-������tHH�8�-H��tH�=$�-��H��-H��-H�=]����8��H�=,�-�'��H��H��L���y��f���H��I��I�ȿ��1�H��H�5�	�J��H�#�-H�8�k���ȥ-H���ff.�@��AU1�I���ATM��UH�͉�H��SH�5�L��H�����H��I9�tw1�L��L��H�5����H��tt1�H��H�5���H��tqH��H�5��1���H�i�-H�8�����-H��[]A\A]��1�L��H�52�R��H��u�1�H�5=��:��H��u�H�=�R�)������AV1�I���AUM��ATM��UH�͉�H��SH�5�H�\$0���H��H9�t\L��H��H�5�1�����M��L��H��H�5�1���H���-H�8����[]�#�-A\A]A^��L��H�5Q�1��j������AV1�I���AUM��ATM��UH�͉�H��SH�5�H�\$0�+��H��H9�t\L��H��H�5�1�����M��L��H��H�5�1����H���-H�8���[]�c�-A\A]A^��L��H�5��1�������AWAVA��AUI��ATI��USH��H�-^�-H�=�-H�uH���*���H�=��-��A�<$I�lj��IH�u� �����A�<$�%H�u��E@�.���c��H�u��Fu�H���H�=���H�ME��tx��H�=b����M��tA�}u6H�u�
���H�}����4�-H��[]A\A]A^A_�f�L��H�5#��1��z������H�=s�����-�ܡ-�u����1�A�<$����L������H�u� �m��L��赻�\����@H�u��f�H�u�:A�_�>�����f���@��1������H���)�-H�R�-��uVH�����5:�-H�=���j��H�5+�-H��tH��-H�8H��P H��-��-H����H��u���H�5�H�=c�#��딐H��(H�|$H�=Р-�������=��-�D$�D$��uE�v�-H�D$���h�-��t���z����-����=�-H��(�����='�-�D��@��t�<�-��1��q����H����-���8��5�-���H���-H�������2��f���H���ڟ-��� ��=̟-H���ff.�@��H�����-��u
H�=��-t4H�5bH�=N������H�u�-H�5n�-H�8H��tH��P H�U�-�S�-H���fD��H�5-�-SH��H��tH�%�-H�8H��P H�	�-H�����[H���-���H��H�=�-�h�H�=Ӟ-H�5Ğ-H������SH����H����[�U���D��UH��SH��H����H��H����H��[]�%���D��AVAUATI��USH��H��dH�%(H�D$1��E�H����H�=�����a��I�<$tPL��1�L�t$L�-	f�L����
��H�}�D$�K���L��胤�����CI�,�H��H�}u���H�T$dH3%(u
H��[]A\A]A^�胹���AVAUI��ATI��USH��H��dH�%(H�D$1���L��H���w�H�=�������I�|$t`L��1�L�t$f�H�;L������H��t)H�=;�
��H�{�D$�w���L��诣�����]H��H��L�H�{u���H�L$dH3%(u
H��[]A\A]A^�謸�ff.����SH�=,�-�?��H�=H�-����H���-H�5��-H�;H��t	H��P H�;H�5��-H���-H��t	H��P H�;H�5��-H�j�-H��tH��P H�t�-[���fD��H�5E�-S��H��tH�6�-H�8H��P H�5�-H��-H��tH��-H�8H��P H�5�-H��-H��tH��-H�8H��P H��-�����������H��H��tH���-H�8H��` @�ff.�@�����H���H�H��pH��x�ff.�f���AVAUATUSH��pH��xH9��'�H��H��H)�H;�Xs;H;��vR���t���H��xH)�H;����[1�]A\A]A^ÐH�����H9����[]A\A]A^�����������H��pH��xA��L������H)�H��XH)�L�I)�L�K�l%H��pH��xH��H��H���H9�sH�H9�HG�I��M)�H����H9�PuH���H��t���v~�H��L��H�	��H��PI��H��HH����H���L��@H��H��PtH����ص�L��HH��PL��H����L����H���M��~H��HH���L��L����H��H+�xH��xH���W������@H9�L��H��HG�����I���W������ H������c���PXH������H�=8�H��1����@��H��-ATI��UH���SH�8H��P1ɺ����1�H��L���H�����H�CHH�H���H��H�CP�����������i��H���H���H���ƃ�HǃX����[]A\�ff.�f���SH��蓲�H��[H���'�����H��t5H�GH���H9PHtfDH���H��tH�@H9PHu�@����H������f���H��t5H�GH�����H9PHtfDH���H��tH�@H9PHu�H��X�H�����f���H��tMH�GH�L���H9PHtfDH���H��t*H�@H9PHu�H9�����HF��H�H����H���!������H���1�H��tH�B�f���H���H����U�SH��H�iH��tL��H��1�I�PH9�rH��[]��H)�H��L��H9�HF�H�1H������H���H��1����H���H�x��H����[]���f���SH��H�ǠH��dH�%(H�D$1�H�<$脬�H���ƃH��tyH����Ѕ�u<ƃH��H��H9Ps=H��聦�H�D$dH3%(uCH��[�H���H��tH�xu���u�H������fDH������虱�f���SH��H�����H���[���ff.�@H��t�D��t�H��H��H9Ps�SI��H��H�
����sH�5��1��b��H��[�f���H���H��t(H�xt!H�����*�@��u#H���fD@��@��u��S���H���G������AWI��AVAUATI��U��SH��H�4$�}���Lc�M����E1�����E1���A��I��D9���I��I���H�WH��H)�H9�I�4$HB�I9\$IF\$H��I��A��I��I�T$H9�t�I�4$H)�H�H��D9�tcI���H��tWA�EH��H$H�D$�M���L+gH��I9�IF�H��H�$����H�$I��I�I9�r	A��D9�w#AƇH��L��[]A\A]A^A_�f�H�D$I���H�0H�XH��H�D$�f���H��z-SH��� H�8H��PH�
����H�5%���H�����H�H(H�
s���H��H���H�
���H�pPH�5������H���H�H`H�ph1�H��H��蜗�H�5U�H��H���:��H��[�D��UH��SH������H�XH��y-H�8�6����H���H���H���H��[]���H��t?H�GH�����H9��tH���H��tH�@H9��u�H��H�����H�����H�=��H��1����f.�@���ff.�USH��H��-H�H�hH�H9�t%@H�3H��tH��x-H�8H��P H��H9�u�H��H�=Ԓ-[]�=��ff.�f���H�=y-H�8�}��ff.�f���H��Hc��
����H���-�H���ff.��SH���?�������	����;1�1�[�l��ff.��H�=9�-H����U1�1�SH��H�GH�5#�-H������t3H�ÍE�H�l�@H�;H��t�?�t�~���H������H��H9�u�H�͑-H��tH��[]���H��[]�f�H���-H��t��f��ff.�@��H��u-���t�fD�3�����USH��H�-�v-��E��uFH��u-�E���u���1������tH����[]邏�f�1��ٖ�f����i������AWAVAUA��ATI��UH��SH��H��v-dH�%(H�D$1�H�;H��PH�$�w��L�5(u-L�<$A��p��A�������H�4$���tEH���-H�=|�-H��A��]�����H�D$dH3%(��H��[]A\A]A^A_�H�;H��P H�$����E�����Q���|���w��1ɾH�I�����o��1ɾH�1�����W��1ɾH������?��L��տ谟�H�=ɏ-�������������B���]���ػ�������������1ɾH���������1ɾH�������Ɋ�1ɾH������豊�L��տ��� ��H�=9�-�T����������������AW1�1�AVAUATUSH��(�|$H�=�-dH�%(H�D$1�H�GH�5܎-H��A���i����JH�Ã�E1��JfDE��H�
��L��1���H�5Y�� ��J���8���xLI�FL9���I��J��E��H��t�8�t�L�-d�-1���H�
�L���>��u�L���"���L�9�-���H��L��L�T$���L�T$����1�E��H�
�L�׺�H�5���^��I�FL9��b����H�D$H�D$�|$蝶�H�t$1ҿ��������1�A��肶�E����D�|$E��A���gD����A�Dž����H�=�����E1��I�FI9���I��J��H��t�D9(u�L�=K�-1���H���L���%���uE��H�
�L��1���H�5�����J�4�H��tH��r-H�8H��P J��A��I�FI9��x���E�������f�E1�L�5z��g@E��H�
�L��L����1�蔮�J�<�����E���B��J�4�H��tH�rr-H�8H��P J��A��I�EL9���I��J��H��t�8�t�L�=H�-��L��L���#���k���L������z���fD��H�5��H�=���P��E���'����R��8��D��8
����L�-ԋ-���H�w�L��諧�twH�
����L��1�H�5S�芭�����DE�����H�=p�-1��)��H�D$dH3%(� H��([]A\A]A^A_�fDL���(�����L������c���1�H�=\��b��A�F<��L�5�-A������H����L���ܦ���E��H�
��L��1���H�5}�贬��J����L��萞����1�H�=������x�L�5��-H�6�L���j��tFE��H�
��L��1��xH�5��F��������H����L���(����L��������L�=�-�}�H���L�����trE��H�
��L��1��}H�5���̫��b����L�-ɉ-���H�l�L��蠥�t/H�
����L��1�H�5H�������L���b������L���U�����D����L����H�
+�H�5�A��1��:�����������H�=�-�@��S����������[�fD��S������[��隧�f.���H����
����Hc�H�݈-�8H���ff.��������̉�AU��ATUS��H����	����L�-��-Lc�C�D%��u$��1�D�
�����9�vC�D%��t�H��[]A\A]��f��D��S��贻��<臼�H�=�����K���
����1�H���1���g��1�H�~���1���R��1�H�i���1���=��1�H�T���1���(��1�H�?���1�����1�H�*���1����1ɾH������1ɾH���
�΂�H�Wm-�@H�����H�8�p��xH�5��1�H�+�-H�(�-�+����H��H��-�Y��H�=�-H�5x�[�թ�D�k����-���ff.�@��H��H�9k-���u�v���H�=��-���H�=��-��������=��-uH���fDH���G�����H��L�H�O1҉�I�@H��H9��|��H��I�H��H��ff.���H�W��H�?H���
��f.���H�O��H�?H����f.���H�W��H�?H���:��f.���UH��I�����S��H��H�GH�?H��H��H�4H�����H�UH�}H�����H�U1�H��蒫�H��[]�ff.���H�?H�6H��tH�t
H��t�0��H��tH�~���D1��D��H�L�H����H�AH����M����AWAVI��1�AUATUSH��L�oL�NI��1�I��A��I�@I��A9�uOI��H�|$M9����1�1�E��u"�qf���L�D9�t]H�D$M�$H�I�0H�9H�H�A�օ�t�H��1�[]A\A]A^A_�D�M��tI�x���D1��D��H���[]A\A]A^A_�@��L�L�M����I�@H����M����AWAVAUI��1�ATUSH��L�gL�VI��1�I��A��I�AI��A9�uTH�$H��H�|$M9��?��1�E1�E��u�l@A��L�E9�t\H�D$L�ML�I�1I�8H�$H�H�A�Յ�t�H��1�[]A\A]A^A_øM��tI�y���D1��D��H���[]A\A]A^A_�@��AW1�AVAUATI��USH��H�_H�?dH�%(H�D$1�H��H�GH��H��A�����I�|$I���p��vTD�e�I��L��M�DL��H��L�����'��L��L��H�����L��H��L�����I�I)�)�D�9�w�H�D$dH3%(uH��[]A\A]A^A_��#����AT1�USL�H�oI�@H����u[]A\��I��L��1�H������L��[H��H��]A\���@��AWAVAUI��1�ATUSH��H�H�oH�AH��A��H�H�$M��t@H�t$E1��
f�t5L�cM9�v)K�&I��H�|$H��L��L<$L��A�Յ�y�I��M9�w�E1�H��L��[]A\A]A^A_����AWE1�AVI��AUI��1�ATI��USH��H�H�oH�H�@H��H�L$��u�L@I�$1�A��H�@I�t$A9�s0D��L��H��H\$H��A�Յ�u�H��H��[]A\A]A^A_�D1���@��U�SH��H��H��f-H�8H��PH�H�;H�����1�H�s�E������H��H��[]�D��H�7H�H��tH��f-H�8H��` D����AVAUI��ATUS�H���w��9w�j��L�'�oI�t$I�<$�t��I�T$1�H���5��L�3I�>�Z��1�I�v�C9���)�9CFC��M�FI�>1�A��A��I��H��M�����C)�A9�sEB�t%�s9s�����CH�;L���e��C1҃��s9S�C�S[]A\A]A^��H�D�CL��1�H�8H�@E)�H��H��L�����sD)�s����f.���H�G�G�ff.�@����Wu�G���1�+G����f���U��SH��H������9������C�{�������@�9���D�K1���B�D
��9�we�C9�r^9��P��H�)Љ�L�AH�9�JI��H��I��L������K�C1�ȃ���S9��9��;S�0��H��[]��A9�r;�C�fD�C1҃����SH��[]�@�C1�������SH��[]�f�H�D)�D��A�qL�@H�8I��I��L��H���8��C�K���C9��V���S�]���ff.����1��e��DAUATUH��SH��1�H��dH�%(H��$�1����A�ą����D$1�E1�H�\$�!@�t$@��
t$@��
tH��臼�|$�H�����H���E��tLE����H��c-�
H�3菩�H�;���H�|$1�A�5L�J�H�
T�H��q��H��$�dH3%(��H�Ĩ[]A\A]�L�-�c-H��I�u���I�}�\��1�H�=��1��<��D$������H�t$���D��t0�|$E1����@�|$H�T$������%����H�D$@�|$H�T$P�foD$foL$ A�foT$0H��$��D$H)D$P)L$`)T$p��$��d$\��i��|$�u���論�ff.���UH��SH��XdH�%(H�D$H1�H��H���x��H��H�����1�H���Ӻ�H�D$HdH3%(uH��X[]��G�����UH��� SH���)��H��H��H�����H��H��[]�]��f.���AW�AVAUATUSH��H��L�odH�%(H��$1�H�l$H��返�����H��A���Z��I��A�F�E1�H�D$�Vf�M��tgO�<�L;ku�
L��H�= ������tL��迓�L��H��H�����I�FL9t$tFI��L;ks��H�5��H���Y��M��u�J�T�1�H�5��H���N��I�FL9t$u�L���x�1�H��$dH3%(uH��[]A\A]A^A_Ð��������Ĕ�@��UH���SH�����H��H���n��xH�����H�E1�H��[]�D�������f�AWAVAUATUSH��8H�L$L�D$dH�%(H�D$(1�H����H�D$#H��I��I��H�D$1�1�1�1�L�%��I�&A�H���D<��3�����O����Ic�L�>��f�H�t$H�|$�D$'��H��1�1ɐH��I9�u�����H�|$��H�t$(dH34%(�H��8[]A\A]A^A_��������D$'T$&롐��D$$��������D$$T$#�v���fD��1��D$#�b���f�������D$&T$%�G�����������D$%T$$�&���fD���D$&������� �����I9���H�&�'f��� ��H����H��I9���A���=uփ���v�@��H�|$H�t$#H��臿�1�H�|$�����I9�v7A��� w-H�&H��sf.�H��I9�t
A��� vMH�t$H��b���I���6����2���������H�|$�A���H�|$H�7�4���f����f�H��r��H�|$�	���1۸떸�H�|$��B������聑�AWI��AVAUM��ATUH��SH��(�t$H�$dH�%(H�D$1�H����H��E1�L�d$@�L��L��H������A��D$�C��S���������	�H�A��D$�C����A��D$�C��S���������	�H�A��D$�C��S��������	�H�A��D$�C�����A��D$�C��S���������	кH�A��D$�C���A��D$芽�I�FI�V	I��H9�����H9���H�$H)�H������A��T$H������H����H�$�H�t���������@����@��	�Hc�A��T$A�H�L�T$����������	кH�A��D$����A��D$�|$��L�d$H)�L�ƅ�t1������
=9�r�L��L��肼�f�H�D$dH3%(��H��([]A\A]A^A_�DH���jH�$�H�t���������@����@��	�H�|Hc�A��T$A��T$�H�t���������	�Hc�A��T$��������������	�H�A��D$A���D$������|$A��D$���H�t$L��苻�����fDH����������A��D$���f.�H�<$H�t�����у��������	�H�A��D$A���D$�����H�A��D$�8���f.�1��s���贍�H�=a��ӄ���H��I��@��H��H�=��H��������H��I��@��H��H�=��H�������I��H��H��H��H�=i�����@��I��H��H��H��H�=I����@��ATUH��S�p��I��訑�L��H��H��H�t�褧�L��H��1�H��H���є�H��[]A\�f���ATUH��S� ��I���X��L��H��H��H�t��T��L��H��1�H��H���ѧ�H��[]A\�f���@��H����<8����f���@��H�q��<8����f�H����
�����H��A��H��tK��tS��t
��ufI��H��H��t0H���������H��H��H��H�RM��H)�H��t)I�@H��LD�L��H���DI��H��u���@I��H��L��þPH�=3��ӂ���H����H�VH��D�OI���������H��I��H��H��A��t6H��I��H��H�RH��H)�H��tmH��uH���־��H��f�H�wH9�s(H���߾��H��1�H��H��H��A��H�HE�H�H��H����1�H���f.�H�������H�����ATI��UL��SH���o�w4��q���H��M��u�C��ta��t
��u^H��@H�sH���t*H�������H��1�H��H)�H;s H����H�HE�H��C8[]A\��<H��H����H��몾wH�=���Y��f���H��D�G4D�WA��
�g���H�WH���t-H����+���E��H��A��I��J�
1�H��L��L9�vZL)�I9�sRL)�G8tH��H��H��t?�G��t]��u91�H��H��H�RH�A��t��H��tJH�PH��HD��@1�H��Ð��u11�H��v�H��H��t���H�����DH���ľ�H�=���Y��f���AWAVAUATUSH��H�GH�t$��H�L$�D$�G8���������I��H����H�D$H��M��I��H�D$H�G(H�D$ L�����I��H�����C8t'�T$���)����
L����c8�I����H�kH���پ��H�C H9������H)�L9�IG�H��uDH;Cu��D$���I���P�H�5/�L���T��H�C �Y�����C8�����M�EH�L��s4�{L�D$8H�L$0���L��H9�HF�H��H�D$(�P��S4��
�����L�L$(��H�L$0L�D$8I9���H�Dž���L�H9��`�S���w����E1��CM9��M��M)�I����H�WI��H9���H�P�H�t$M�N�H)�M)�H��L�L�\��I��H��I9��_�H��������W��D�V��A����0E��D	�Hc���W��VD�V��A����<E��D	�M��Hc�M)���W��V��?��W�I���v���I���SI�����C�CH9��X�s4��
�����H��H)�@��H9��g���GH9��5���M9�����LT$M)�I�ML9��'���H��L)�H9���H�SH9������I)�H�C L�H9������H�H�C M�t	M�������H�D$H�L$H9��p���H)�H�L$H��tH�I9���H��H[]A\A]A^A_�f.����~D�KH�t$A����D	������H�w��?��S(H9����WH���C4������
L��裩��
���fDH�t$ L��H��L�D$0�ä�S4L�L$(H�|$ D)ʉS4J�4�W��L�D$0���D�
L���K��K8���f��C�C4�y���DL�L$�CK�4K�|�������S(��7��@����0@��	�K�tI��Hc���S)��>��@����<@��	�L��Hc���S*���?��C4�C�S+H9��H���s4H)�����H9�� ���H�t$H����T$(��
S����W����A��A��<D�KI��tH9�A���H�����1����CA��k���fD��sQ�����tH�|$ ���?@�8��{4�C4H������H9������Lt$E1�����L�\$ L�PI��I�;H�8I�|3�H�|0�H��L)��I)���r�H�D$(��1�����I�;I�:9�r�H�D$(�{���1��"���H�t$ H��L�T$8L�D$0H�L$(肢�C4H�L$(H�|$ )ȉC4��H�4���L�D$0L�T$8�b���H�t$�CN�J�tI��A�������S(A�D���A����0E��D	�Hc���C4�S)�����<�S����H�t$�CL�I���������C4�S(�����0�S������s2������tH�L$ �	������S4�C4H����L�\$ L�OI��I�H���I�t�H�t�H��L)��I)˃��r�H�D$(��1ɉ΃�I�3I�19�r�H�D$(�H�|$ ���T7��T0����H�|$ �T7�f�T0�����H�t$ �ҋ��L��L��X���H�L$ ���L�f�L��B���闶��钶���*H�=���8x����AWAVAUATUSH���G8L�/D�g��$�����H��I���ňC8H���H�����I�ƋC4����M������
����H�sH���8���H�S H9��S����{E��H��A��H)у��Y��tE���z���t���D�K��G�L
D�L;(�x�{4E���b���D;(=�C4�A���C��C8�iL�mH���t	H9��dM���^���M9�L��MF�L���[��I�C8t�
I��H���c8�I9�IF�E1�H���`I9���D;s4r^��@�k4H�CH��D)�H9�HF�L��H)�H9�HG�D��H�t(H��A����Hk H�(I9��L�����D9s4��H�C H�HE��t�
L9��H�PH��H���
L9��x����C4D9����C8u0�K8�H��[]A\A]A^A_�fD���;���M���2���H��1�[]A\A]A^A_�D�G4��u��u�E1�����@I��H���t.H9�s)H)�H�*1ҽH��H��HD�E��H�͍E‰�I�M���j����K8��]���f�H�K(����@���2��t�S(�@���2H�A���j���f.����`���D�K��G�L
D�L;(�x�{4E��u�D;(=�x���D;(=�C4���f������f�L9������L���H�
��1��;H�5&�H�=��`��H�S(L�@I��H���H�t�H�t�H��H��L)�H)�����.�����1ɉσ�L�>M�89�r������D)�H�{(D���C4��H��y���F���@�K8����S(���L��L��������L�f�L������H�=a��t���AWAVAUATUSH��8D�gA�����A�������H��A���XD�oI��D����D$(D����D$A�������CH���
�< �gH�&H�ǸsH��H9��|A�4@�� �VH��tH�H9��hD�D$(E������K�����H��8[]A\A]A^A_��H����L��H�L$H�T$ L�D$���H�L$H����A��L�D$H�T$ ��L�3D�l$,E��1�M��I��I��H�L$ L�D$L���fDM����A�w���2�������A�wH�T$��D����@��	�H�|$I��A�w@��苟�A�GE�OE�wH�T$D��H����A��A��H9�@��A���A�<,D�t;@H��A����_����|$��u@�� wH�&H��r��L��M��E��D�l$,A��H�L$ �1H9��K���A��u�C���8���J��D$(�����K�����H���S���H�)�K���f�H���7���H��+���H��tH�H��������KH��81�[]A\A]A^A_�fDH��tFH�H��8�[]A\A]A^A_��H�������H��H9������H��H�������H��8�[]A\A]A^A_�f����2A�wH�|$H�T$I����A	�E�wA���ѝ�A�GE�OA�GH�T$�=���DE�wA�G�'����A�wH�T$�<�D��@������H���������f.�1�����f�L��D�l$,M��H�L$ �@���o����C�KH9��/A�4/@�� w2H�&f.�H��sH��H9���A�4/@�� v�A��t,L�3�H�
n�1���H�5��H�=ѳ�d[�@�s������������A�/<=������KH���C�C��H9�s:A�/< �����H�&��A�/< �k���H���a���H��H9�w�T$����\�����K1��J���DH�L$ H���#���H�)����f�H9��H��u����H9�t�������D1������������A�</=����H���K��CH9�����A�/�C���H9����< ������H��	�DA�/< �����H���i���H��H9�w��j�������t$1��������A���/����C1��M����������Y�����!���@H9��������������������H�=���tm�@��H���W����������W��u.�O1���u��u�W1�������H��Ã������H��ø������ff.���AWAVI��AUA��ATI��USL��H��hH�L$H�l$dH�%(H�D$X1��Cz�H�SH���������H��H��H��H��H�4��,��M��H�t$H��I��f�H��L�t$H�����M��D$LD�1�D$,D$<�D$LD�l$L�d$ �|��L��H����H�L$XdH3%(uH��hL��[]A\A]A^A_��t�f.���SH��H��H�� dH�%(H�L$1�H��H�<$�t$H��H��H�D$�C�Kf�xH����Y�H�L$dH3%(uH�� [��t�@��AVI��AUA��ATI��UH��S�y�H�MH��H��H�4I��H��L��D��H��L��I���(��H��[]A\A]A^�f.�f���H��H��H9�������H��tH��tH���@H��?)�H��H���f.�@��AWAVAUATUSH��H�<$L�L$����������H��A��I��M��1�E1���u
�9f�A�^D9�s'A�H�<$���I��I��H�A�Յ��t(E��D9�r�A9�A��H�D$D�0H��1�[]A\A]A^A_�H�D$D�0H���[]A\A]A^A_�@��I��H�7I��H�OI��1�L��H�FH�6H������fDATUH��SH�wH��H����H�C H9�tF�C���H�{8L�e�H��t=H������I9������L�H��H��A�P(H�C�K@H�k L�c(H�[]A\�DH������I9��լ��H�H��PH�C��fD�G@�z����p���f���f�H�7H��GGH�w1�H�W0H�W(H�W G8H���\}�ff.����f�H�G@G0GH�W0H�W(H�W H�WH�7�@��AUI��ATI��UH���HSH��H��PH�u�H@H��H��L�`8L�h0���H��H��[]A\A]�D��H����������SH�H��t1H��C@t&H�sH�{8H��t
H��P H�{8H�CH��u[�H�{8H��t�H�H��[H�@ ��f.���SH�7H�H�~8H�^H��P H��[�ff.���H�G8����AVAUI��ATI��USH�G0H)�H9������H��H�H�,I��H9�wsH;k(vEH�{8�C@��H�s H�U躕�H�S0H��H�JH9�HG�H���p���H�{H9�vH�kH��H9{ ���H�{H�����M��u$[]A\A]A^�H�CH9�r/H;k(w���[L�]L��L��A\A]A^骏�f.�H9C HFC H9�HG�1�H��H)�H{�{�H;k(�e����+���H���]���H��H�S H��1�H��H�=���R�f.���H��tGAVAUI��ATUH��SH�G(H��L�gH��L)�H9�w+J�D%H�GH�[L�H��L��]A\A]A^�����H�W0L)�H9��$���N�t%M9�s.H�WI9�r5L9�r`L�sL;s ���H�{H��u�����@L9�r;M����fDH9W HFW H�L9�IG�L�1�L)��z�L;s(v:f�H�{8�C@t<H�s I�V�ٓ�H�S0H��H�JH9�HG�H�����H�CI9��b���I���^���H���Q���H��H�S H��1�L��H�=A��dQ�@��AUATA��USH��H��H�oH;o(t"H�EH�GH�GD�$(H��[]A\A]��H;o0�.���L�mL9�r-I�����L;k �^���H�CH���)���D�$(H��[]A\A]�H�GH9�rOL9�s:H�{8�C@tpH�s H�U�ے�H�S0H��H�JH9�HG�H�����H�CI9�vL�k�f�I���H9G HFG H�L9�IG�H�1�H��H)��x�L;k(v��@H���}���H��H�S H��1�L��H�=��2P�f���AUI��ATI��USH��H�G0H)�H9������H�GH�,H��H9�w|H;o(vEH�{8�C@��H�s H�U��H�S0H��H�JH9�HG�H�����H�CH9�vH�kH��H9C ����H�{H������H��L�L��1�[]A\A]�w�H�WH9�rH;o(�w����H9W HFW H9�HG�1�H)�HGH���ww�H;k(v��F���@H�������H��H�S H��1�H��H�=���O�f���USH��H��H�H�C0H)�H9��֧��H�,7H9�rnH;k(vEH�{8�C@��H�s H�U���H�S0H��H�JH9�HG�H�����H�{H9�vH�kH��H9{ �?���H�{�E���H��[]��H�CH9�rH;k(w����H9C HFC H9�HG�1�H��H)�H{�ov�H;k(v��T���@H���ڦ��H��H�S H��1�H��H�=���
N�f.���AWAVAUATUSH��H�jH9��N���H)�H�G0H��I��L9�I��IG�H)�H9������H�GL�d5I��I9���L;g(vFH�{8�C@��H�s I�T$觏�H�S0H��H�JH9�HG�H���]���H�CI9�vL�cL��H;C �����H�{H�������I�6H���R���L�L�H��L9�t4H��[]A\A]A^A_驉�f�H�WH9�r'L9g(�Z����H��[]A\A]A^A_�%��DH9W HFW L9�IG�1�H)�HGH����t�L;c(�H����
���H�������H��H�S H��1�L��H�=g��L�f.���H9ww�t�AUI�����I��ATI��H��UH��SH��H�4H��H�����H]H��L��H��L��[]A\A]鸈����H9ww鑊�ATI�����I��UH��SH��H�4H��H���M��H]L��1�H��[]A\�t����I��H��H��H�w���f.���ATI��USH�G0H)�H9��c���H��H�H�,H9�wuH;k(vEH�{8�C@��H�s H�U脍�H�S0H��H�JH9�HG�H���:���H�{H9�vH�kH��H9{ �Ť��H�SJ�"H���Ť��[]A\�f.�H�CH9�rH;k(w���H9C HFC H9�HG�1�H��H)�H{�s�H;k(v��M���@H���Y���H��H�S H��1�H��H�=��J�f���H��H�w頙���H�WH��tH�H�WH�GH��u�f�H��H���?���H���ff.���H��H9w �B���H�GH;GvH�GH�wH������H�GH9�vSH)�ATI��UH��SH9�w[H��L��]A\��q�f�H)�H�H�H��H�4H�H��H����[H��L��]A\�q�f��ff.�@��AWAVAUI��ATUSH��H�GH9���H)�M��H��H��N�4H9�viH)�H�N�<0M��tAH��L��I�����跿�H]L��L��H���Յ�H��L��H��[]A\A]A^A_�q�@H�H��H�4L��U����L��L��M���"q��H��L��L��[]A\A]A^A_�q����H�G ����H�G(����H��H�G H�WH9��Ӣ���G@H�����HE�H��H)����H�W1�H;Vu(�H��tH��H�6H�?�wy���H���D����H�G8H��t�@t	L�G M��u�H������I�H�SH��H�wH9��e���L�H��tL��L��H��A�Q(H9C�Z���[�L��H��A�Q��@��USH��dH�%(H�D$1�H�GH��H9���H��H����H�VH��H����H��H9�H�$HF��do�H��H���9��H��t\H�$A�A��A��A)�H�Q���A�H�4H��t&@�V��>D��H��D!���D�����VH9�u��D����@H�D$dH3%(uH��[]Ð1���n�����c�f���AWI��AVI��AUI��ATUSH��H��(dH�%(H�D$1�L�d$H�l$1�L��H��H���(����W���H�H��~@M��tsL9|$L��H�t$L��HFT$H�T$胐�H�t$H����Q�L+|$��t=�C �ܠ���C��u3H�L$dH3%(u3H��([]A\A]A^A_�fD������Ը������H���G�I������b�ff.�f���AUI��ATI�� UH��SH��L��H��dH�%(H�D$1����H��H��L��H��H�$�ԑ��H�$�x
t8H���pD���g���H�T$dH3%(��u*H��[]A\A]�f.�L��H�=���1w�H�E��&b�fD��ATUSH�� H�dH�%(H�D$1�H����u4H�---H��H�8H��P H�D$dH3%(uyH�� []A\��H�=!G-L�d$H�l$�*N�H��H�$��H9\$t!H�<$L��H���
��u�H���>m��@H�t$H�=�F-�׀�������+u����Sa���H���H��Hc�H�=�F-胎�1ɾH��H�����i����ATI��UH��S��H��H�0,-H�8H��PL�`H�h���tH�lj�H�D$�;m�H�D$H��[]A\�ff.�f���H���/H�=F-Hc�����Ğ��H�=�E-��u�tH���f�1�H�1��H���i����ATUSH�� dH�%(H�D$1�I��I�l$�"f.�H�=�E-Hc��a��H�$H��u@�H������V��ÉD$��̃��t?H�D$dH3%(uPH�� []A\�fD��H���>��H�$L��H�p�P�fD�SG���
t���t�H�=�h1������_�f���1�H�5#�����9��f�����D-�P��D-��9H��H�~*-1�H�=�D-H�0�M��1ɾH��H������?��n�ff.���USH��(dH�%(H�D$1��PD-���������?D-��1ҿH�l$H�5f���H�\$�\��H�=
D-� K�H��H�$�.�H�t$H��tH��)-H�8H��P H�D$H�<$H��H���ަ�u�H���j�H�=�C-�֡�H�D$dH3%(uH��([]����m����^�f.�f����ǧ�����G�����LJX��ff.����LJX��ff.����SH��H��H���R�H�8����\����H��8H;
d%-tBH��H��х�����H��@��\H��t
�D$H��ҋD$H��[�fDH�s�v ��u�H��@����\H��tH�D$H�����\H�D$���]���H�� H��H��H��[��DH�S�zF�8���H������H�
H����]�tE1���H��H�
%�H�5�
�IT���E����H���[�DǃX�%���H���U�������USH����\�њ��H�PH��t#�sh��tH�{p��H��[]�f.���H�wXH��t5H�HL��I�ٹ�H�C
�6|�H�CP@��t�H���5^���w<���t�H��H�H�H�

SL��A���m�H�CPZY@���_����i��H�{HI�ٹ�L��HH�����H�Cp�A���f�ATA��UH���@S�L��H�5V�H��H���e��\��f�����H�}���:H���r�L�eL���VY�L��H��H�����H�E�xHt,H�{���,H���6�U8H�5�H��1����H�߾)��H��[]A\��M�f������i����H�5��H��蟇�H�}�U���H�}0t�:H���~�L�e0�I����E���O���D��H�5O�H��1��c���6���fD�:H���{~��@���fDSH�XH��t�w<���H�{XH���A�H�{`t�s@H���o���H�{`[H���Bl�f�[�ff.�ATUSH�P�����H�XH���ǘ��H�`�����H�p�a�����\H�o�ƒ��\�M ���ƒ�	Ј�\H�u0H��t �<����[D�H�CXH�sHH��蛤�H�u8H��uBH��������\�H�{p�ė��1�H�����H�{p���E ��t�}Etf[]A\Ð�{@��\uD诟�H�C`H�Ǿ��^�H�{`1����H�sHH�{`��m�������U�H�CX�[���f��}�H�C`�DL���1���H��	L���Y�uOL���Q�H�u�M$H�=̳1��U �Ϧ�H�{`[H��]A\�?����Sh���*���霗���H�
r���L��1�H�5P	�Ú�뚐��AWAVAUATUSH����\@���y���L�gI��H��A��L��A��I�t$�p���E9t$ u ��D���@��\H��[]A\A]A^A_�H������H��H���X�t/H�CE��H��H�
w�H�5�D�H 1��N�����H���VP�����H����}�H�_H���?X�t�H�CM��}H��H�
մH�56L�@1��N�����9���f���USH��dH�%(H�D$1����\uhH��H��H��躳�uuH�3�H�=�<�����u[H�{H����e�xKH�{H�t$��e�x9H�s�L$H��$薕���H�T$dH3%(�~H��[]�DH������H�PH���0W�t<H�5��H���m��H�
^���H��I��H�51��}M�����fDH����N�����n����U�f���SH��H�P�r�H�{p[�ŝ�D�������f���ATUSH���@�K��H�5�H��H���d��H�C(�8�G�H�5�H���C��H���[H�H���H���]�f�����f��������f��t&H�CH�5|�H����xDH��UHD��~��Hc�����tH���H�5K��_������u[]A\��H���H�5,�[]A\�1��H���褱�H�SH�5�H����zDH�&UHD�H��車��F���fDH����d��H�SH�5��H����zDH��THD�H���{�����fD� H���Cx�L�c(L���'R�L��H��H��������@��AUATUSH��H��(�o<dH�%(H�D$1���y�o@���f������\u���l�������-Hc�������H�="�1��ǡ�I��H�k0H��t&L��H��� l���H�Q-H�8H�H��P H�C0L��A��?��H�C0��\uE1�f���uE1탻��A�ſ@轫�L�cH��M��tL���	Q�L��H��H�����L�c0H�EM��t#H���mL����P�L��H��H����H�EH���"�S<�K@����9�������1�H�5J�H���s��E����f.�H�C�xHtH�}���S8H�5b�H��1��7��H�s(H��tH�'-H�8H��P H�C(H���E�H�����H��H�C(���H���B��H�CH���H�C H�D$dH3%(��H��([]A\A]�f���x��H�5�H��1�詋�E���@���H�}u"H�C�xH�@����O���fDE�������H��1�H���\����@�H�5�H���4~�L�c0L���XO�L��H��H���~�H�5�H���~�H�E�b���DL������L��f��
�5���H�=	H��1��%��I���Y���DH�C0�����H���1��H��H���Q���H���{I�H��-H�k0H�8H���&����*����L�c0M����������fD� H���st���fDL���H�����L���`n�u�7�����f����f����������\����M��H�
��H��1��H�5��P���0����ì��H�=ڋH��1����I���$����H��H�=2�1��ϝ�I���������6�8Xu��\���f.�H�t$���D��u�D$����D$��������\f�������l�����N�ff.�USH��H�G�xD�Ў��H�����l�H��-H�����H�5��o����k�H�=���P@��uy���1���H���H��H���O���D�C<H�
�H��1���H�5~����H��H��t1�H���ǃXH��H��H��[]��f����1���H�4�H��H���O�t]D�C<H�
�H��1���H�5	��|��H�����H��H��tH��H�߾[]���H��[]�f�H���F��fDH���F��2�����USH��H�PH���Jj�H�{p聕���4�{<H���|�1�H�߉E��@��H��[]�H������H�GH�x0t!H�PtSH����^�H��[�9���ff.�@��AUATUSH��L�gA�|$D����<�H���	���H���1���H��H���M��H���E����f���-1�f���tH���H����yG�Ń����H�g-��\�f����k@�o�k<��uH�C�xG�?H���Oi�H���s@H�{HSH�
4��L�
����A���]�L���1���H�CPXL��ZH�����L���E�L$(A���L��H�5�H�
��1�1��C��A�t$(��umH����[]A\A]�DH�5��H�
ʧH��1���������f������H�CH�{�pL��uT�7k������L��1��6D�A�t$(��t�H�{HL��PI�ٹ�H�;��~��H�CpH����[]A\A]�D�sC�����@H�߾1����H����[]A\A]�ff.����USH��H��H��-H�H�GxH��-�o��H�pH��t赓�H�{X�L-�H��H���t+H��t�H���t;H��[]�@H��1�[]��ǃXH���H����[]�@H�C�@@��t��u/H����[]��ǃXH���H�������[]þ8H�=���@����AUATUSH��H��(dH�%(H�D$1���\�"H��(H�����A�ą����H��@��\H����H���H���;������Ɖ���������H�{XH�C`H�|$H�D$�q�H�|$H��t�=C�H�|$��y�L�l$fDH�|$�G�y���H��H���hH�=<�謜�H��H�߉D$��\�}H��0H��tq��A�ą���H��@��\H��tH���L���3�u����E1�H���U�������H�D$dH3%(�H��([]A\A]�D��L��A����2������E������H�|$H��t@�u�H�|$�i<�E��y*H�D$�@u��X�H�߅�D‰�X��H�|$�)��_���tVǃXH�|$�B2�t^H�|$H��u��f�ǃXH��������H�|$H���Z����L���1��̇��A��M���� G�鷇��ff.���H����X�������XH��Hc�H�>��@H���H���@H�GXH�w`H��H��錚�@H�L�H���@H�GXH��u�H�=*H������H�G��MbH�=���H(H�������i��)�1�������H�#�H���@����\t�f�ATUSH�GXH��H���H��tH�H�5�t�ڏ�H���H�C`H��tH�H�5�t軏�H���H�CH�-I��H�5%��xDH�R�HD��)c�H��PH��H�h@�WX�H�=[�H�����1��	H��H��H���F���D�c<H���X�H�
#��	H��I��E��H�5��1����H�Cxf�H�{p���y��H�{P�0b�H�{X�k�H�{X�n��H�{`�u�H�{`��<�H�s@H�{<�O9�\[]A\�H���>��fD��USH��H�W�B���������H���BH�H����H�WH�PH�GH��tH�H�H�CH�H���d��H�-�-H�sH�}H��t
H��P H�}H�s(H�CH��t
H��P H�}H�s0H�C(H��tH��P H�C0H����m�H�CH��[]ÐH�WH�GH9:�Y���H�H�G�M�����H��H�����H���tHH���H�=�-�V��MbH�=y�H�����������)�i��)�1������@H���H�=�-�UV��MbH�=a�H���������։��)�i��)�1��đ�@H���H�=b-�
V��MbH�=�H�����������)�i��)�1����|��ff.����UH��SH��H����T�H�}������oE���oM��oU H����o]0�(�oe@�8�omP�H��H��tpH��8tVH��Ht<H��Pt"��\t	H��[]�f�H��H��1�[]���H�I�H��P��H��H��H�H��	-H��8�H�A	-H���}���DH��
-H���[���D��H�GH�pX��F�ff.�@ATI��UH��SH��v8��u�G�P����U�C8H�9
-H�s�K<D�C@H���\Hǃ�����H�CHH��tH��-H�8H��P H�CL���x��H�C�E,��t�Sh��t6H���t9�}Pu^H�CH��toH9�����H���L^�H��[]A\�y�H����Chu�H����H�5��j�H����}Pt�fDH�����'2�H�CH��u�H�kH�H�EH�CH��tH�H�]�E�r���fD���U�C8����ff.���A�����D�����ff.���AWE��AVI��AUI��ATM��UH��1�SH��H��H��tA��H��H�=T�1��p��H��A�}D�����Ao��A�FfD������M��t�Ao$��A�D$���H��L���\ �H��tH���H��H�5o�v�H����H���H��tH��H��[]A\A]A^A_��f.�H��[]A\A]A^A_Ðǃ�f����f���E1�E���A���USH���D�X�����\H��H����H���H��H�5�6�Tu�H���H��tH��H��[]��DH��[]Ð��ATUS�D�"���H��A�����H����<H�5����[�H�=���P���1��AH���H��H���?�u.H���f7�H���~�H���H��t:H��[]A\��f�E��H�
6�H��1��AH�5M����fD[]A\����D$M��tfA�9uf��tf����z��Ao��E�ID�����ff.�@��ATUS�D�:��H��A������H����^H�5����Z�H�=���P���1��cH���H��H���r>�u.H���V6�H���H��tH���H�߾[]A\�D�@E��H�
K�H��1��cH�5=����ff.���AWAVI��AUI��L��ATI��UL��SH��H����n�L��A����T�L��E��H�މ�L������S<������C@���W~��H�{P���H�{X��~��H�{`�^~��H�{p��~��L�cXL����d�H�k`H���6�H�{`��1B�H������\�1�H�����H��H��tH��H�߾[]A\A]A^A_��@H��[]A\A]A^A_Ð��UH��SH��H��H�PH�wHtH�wPH���I<�H�CPH�{ptH�spH���"e�H�CpH�{XH��tH�����H�{`H��tH��H��[]�P�fDH��[]�f���H�
-H�0��h�ff.�f���UH��SH��H��H�~���E����H�C-��H�8H��P�oE@�oMH �oU P0�o]0X@H�U@H�PP�o#`X�okhh�os px�o{0���oC@���oKP��H��[]�@�0�a����E}���H�}�a}��H�}�V}��H�}(�E����F}��f.���USH��H�/H�H�]�)fDǃXH���H�EH9��$}��H��H��u�H�1-H��H�8H�H�@ H��[]��f.�f����^-���U-�ff.��H��8A��dH�%(H�D$(1�H�$H�D$A������uIH�D$H�D$H�t$H���JL���|��H�L$(dH3%(�=H��8�f�H�BH�JH=?B��|��H$HD$H��H�$H�D$H=?B~H��H-@BH�$H�D$H�D$H�D$E����H�G(H�W H=?B�4|��HT$HD$H�T$H�D$H=?B�6���H��H-@BH�T$H�D$����@H�BH�
H=?B��{����H�$H�D$�+���H�D$H�GH�D$H=?BFH�WH�D$H�T$����f.�H�GH�WH=?BH�T$H�D$�0����7��n{���i{��f�AUATUSH��H��tyH��H�?I��H�����A�ń�t!ƃ�A�H��[D��]A\A]�fD�sH��H�������Mb��C��9�v�)�A9$vA�$H��D��[]A\A]��H��E1�[D��]A\A]��S1�H��dH�%(H��$�1�H�\$ �D$����H���~z���z��H�=�-H�T$H�������D$���uifo�-H��-)D$H9~-u$H��$�dH3%(��H��[�@foL$1�H�t$)
D-�j�y��Hz��fDH�L$8H�|$ H�t$(H�T$0H��?B�/z��H�H�H��?B����H�H�D��-H�H��-H�D$H�T$�P����06���ATA��UH��1�SH��dH�%(H��$�1�H��H���[y���y��H��D��H���5���H��$�dH3%(uH�Ġ[]A\��5���ATUSH��dH�%(H��$�1�����y��A���^y��H��-����H�8H��PH��H�*-D�cH��kH����1�H���x��@y��fo$H�;CfoL$K foT$ S0fo\$0[@fod$@cPfol$Pk`fot$`spfo|$p��fo�$���tUH��-���H��H��$�dH3%(uMH�Ġ[]A\��1�H�5O-�*���;����x��D1ɾ�H������ ���i4�f���SH�H�H��t<H9-�~x��H�H��-���H�;t"H�c�,H��[H�8H�H�@ ��[�fD1�H�5/�����z�����USH��H��(dH�%(H�D$1��e-9[-u%H�T$dH3%(���u]H��([]��H��H���%&�H�=
-u�-�-�*�����H�5�-H���QF�=�σ�-���L3�f.�f�����H��H9�t0H�=ɗf���2H������3���H9�u���D���ff.�f���H��H��1���(�ff.�@������Є�t1H�=Z�f.�1�H����������1Ȅ�u������ff.�f���H��1��B^�f�H��-ATUH��SH��t	H�xH��u<H��L�c(L���\�H��tHH�XH�@ H�H�@H�X[]A\�@H��H��H9���v��H���t�H���@�=�-�Rv��H9-�-�}v��H��-�D��AVAUATUH�-�-SH���Xv��H�=�-tH��-L�eL;%�-tsI�\$L�%�-H��tbL�5z-���+�H��-L��M��t4L�kL9�t�H�=t-H��t�H�GH9Cw�H��L�����M��u�DI�D$H�EH�UI�D$H�#�,H�<-�([]A\A]A^����H��H����u��H�=�-tH��-H��-L��-L�BM�JH�BK�H)�L�\(1�L9�t
H����H��H��H��L)�L9�w�H)�H�JI�r��ff.���H��H��-H�PH�BH��H9���t��H������H����H���H�.�,��;�u��H�<-H�PH����t��H�zH�J(L�BI��L+HL��H�H9�s9H�BH��tZH�P(H�HH�xH9�rH)�H�H9�r4H�@H��u�H���fDL)ǸH�H9�w�H���1��D�H���1���f���ATUH��SH��tH��H�6�=�u[H��]A\��DH�;�v�H��I�����L����6�H�M��tH�T�,L��H�8H��P ��[]A\Ð��H��H�!-H�z�t��1�@HBH�H��u�H���ff.�@��H��H��-H�z�t��1�@HBH+BH�H��u�H���ff.���H��H�=�-�,�H��-H���ff.�����=�-t�f�H��H�M�,���m-H�6-��H�-�H�"-���H�=��H�#-H�-H��-H��-�Ɂ�-H���ff.�AWAVAUATUSH��8dH�%(H�D$(1�H���s���=�-���H�_H��H�=z-tH�m-H��-@��uAH�PH9�whH�HH)�L�d(H�t$(dH34%(L���H��8[]A\A]A^A_�fDH�A-H�ZH�PH9�wH�HH)�H)�L�d(H�P��H�-H��tTH�JH9�rKH�JH�H�BH�PH�BH�JH��-H��-H)�L�d
(@���Q���H)�H�B�E����H������H��-H��-H�H�BH�HH�PH)�L�d(@����H�=��>��D$���=F-H��D�(�zH�=;-H����H�5�����QF�H�=-H�5��H���u��F��H�=�-H�5ҔH���u�H�=�-H��H�5Ô�u�H��-H�=�-H�5��H�P�lu�H��-H�=�-H�5��H�P �b�H�=�-1���H�	��,���H�|$ ������@��I���E�I��萃�I��L��L��H��H�5}�1��Ve�H�/-1���H���H���9,���L���9�H�-H��H�
o�H�5p�H��L�J H��-L�BP��1��m�XZ�D�mH�|$�Z��V����&p��DH)�H�H�2���@H�|$�^J�H�|$���@H���#��fD��H�5��S�H��H�U-����H�T$ H�=D-H�5N��`������*�ff.�����B���f���S�H���.���H��1�H���!5�[�ff.�@��S1�H������H��-H��-[H��-�f.���USH��H��H�-�-H9�rH��H��[]�DH���0;�H9�t�H��H��H���H�H��H��H��[]���H��H�=@-��n��H9=+-�o��H�F-H9x��n���H���N���ff.���H�=�-tH�=�-��!�����ff.�@��H��H�=�-�R���-H�����H��H�=�-�L���n��H�=�-��n��H�=�-�*�H��-H����fD��tK��u�rH��1�H�5���pb�tP�,H�=k��I�f��x��f��w�f�AWAVI��AUA��ATI��US��H���H��dH�%(H��$�1�H�T$�OM���������ti�����D�|$,�Q3�A9�u`�T$(E1������T$(1�����H��$�dH34%(�YH�ĸ[]A\A]A^A_��D�|$,���2�A9�t�D�|$0��V�A9�tmH�|$�N�L$��t*D;8tV��H�PH�D���H��D;z�t6H9�u�T$(�����A�ǃ��T$(�K���fD�����fD�T$(E1������T$(����f.�E��uE��u&�!��
������������L��L�������֐�|$0�Wz�L��H�5��H��1��s`�|$0��*�H��t�H�H�52L��1��Q`��1�L��H�5\�L���;`���������%�JH�=-���ff.�AUI��ATUH��S��H��dH�%(H��$�1��S&�A���k1�A9�tv�����������<1�H�5�H��1��I�H��H���J�tB����t6��t1��
tn1�H��H�5ސL���j_�������H���&f�uY1�H��$�dH3%(��H�Ĩ[]A\A]�L����H�������@�H��L���p����������d�8
I��t 1���H��L��H�5%���^�����|�����H��L���/���1�L���H�������tA�$
������J����'H�5.�L���vQ����?$�H�=���^�ff.�AWI��AVAUATUSH��H��HH�t$�T$4�T$dH�%(H��$81�H�D$H��I�ċ�D$0��|�H�5v�L��H��H��I��1���]�H�t$pA�?/H�t$�
�e/���w�H�5��L��H��1��]��E/�H�t$���g��� �����H�5l�L���tP�H�D$(�R���?w�H�5T�L��H��1��[]���R�H�T$PH�։�H�T$8�"���	����H�|$P�w*�H�5�.L��H�D$ H��1��]�H�t$�H�\$H�-�7H��A�����L��$������D�����/H���#)�H��trH��H����c�L��H��H�D$H�G�A�Dž���A�$H�\$H��
t��u �|$t�H��H���������u�H��H�5o�L��1��L\�E�����)L���fF�D$0L��A�$�6�H��$8dH3%(��H��H[]A\A]A^A_�DH�|$p�>)�H�5�-L��H�D$(H��1���[��U���H�|$H����g��H�T$HH�5l�L��1��[�H�T$1�1�H�|$HH�5+6��E�H�D$���@�H�5?�L���\N�H�D$(���fD�H�5,�L���4N�H�D$ �(���fD�H�5�L���N�H�D$ ����fDH�|$HL��������n�|$4��H9\$�(H�|$L��������q�&H�5��L���M�$��0fD��$�1��,�9��?���L�|$(M��t*H�t$��$��gd�~H�|$pL���9�����$���$��t�$���I���s�A��L��L��H��H�5:�1��Z�L�|$ M����������������$��jO�9������H�t$8��$��A������H�|$PL���|8��q�����$��xs�H�L$ H�5��L��H��1��Y��G���f.�A�<$
��$��6�*�9�t]L�|$(�M���������A�<$
��$�u���*�9�ű�$�����u�H�5\�L���K�����H�|$HL���������~H9\$����H�|$L���������������f.�H�|$L����������������$��Tr�H�L$(H�5��L��H��1��kX��Z���A�<$
��$������)�9���������D��)�9�����������ff.����1����D������f���AWI��AVA��AUATI��USH��H�t$�;�H��D�(�{v�D��H���q�H�t$H��L��I��1�H��H�5��W�D���	"�H��tH�H�58)H��1��pW���L���4q�H��H�5r�H��1��PW���L����!�H��tH�H�5�(H��1��+W�M��tL��H�5��H��1��W�H�ߺ3H�5K���I�D�mH��H��[]A\A]A^A_���@��UH���=SH��H����H����b���H��H���m��c��H��[]�ff.���AVAUATI��USH��H�?dH�%(H�D$1�H��tiM��1�L�l$�=�A�H��H����b��H�=���o�I�>H�މD$�Z]�H�sH���@�L������b���EM�4�H��I�>H��u�H�D$dH3%(u
H��[]A\A]A^���f.���SH���ca��kb��[�f���H������\b��H���fD��AVAUATI��H�=o�USH�� dH�%(H�D$1��!o�D$��H�����H���q>�I�<$H��H��tv1�L�t$L�l$f�H�|$��H�D$H��t>H�|$�R"�H�|$H�D$�C"�L��H��H�D$��G�L��H���G�EI�<�H��H��u���H�CH�+H��A�ą�t$1�fD�CH�t��؃�H�|��>�A9�w�H�|$���Aa��H�D$dH3%(u
H�� []A\A]A^�����SH���C�H�{[�o�f���H��H�?H�H�H��tH��`��ff.�@��H���,�@��AWAVAUATUSH���Q�L�8M����`��1�I�?u��ݍEI�<�H��u�H�=���p�I��H�L��P�uH��I��L� H������H�V�H9��H`��I�$L��PI�E��t2L�4�1��
DI�EH��I�4L��H�,�`N�H�EI9�u�H��L��[]A\A]A^A_�D�H�=����H��H�H��P�H��I��H�H��PI�E�@SH���C��t��t?��t*�������[�DH�{������t�H�[��DH�{�����t�[ÐH�[�f.�H��X1�H��tCH�
H�zH�H9�t4H�H��tH�VH;Pu�$@H;PtH�H��u�H��H9�u�1��fD��f�H����AUI��ATI��USH��H�����tE��tH��[]A\A]�DH�~0H��t�H�F8��tWH��u�H�r�y0�u�L�k8�����H�v�����H�sH����[L��]L��A\A]�o������H9�u�H�F8�v���ff.���AVL�5K�,AUATUSH�A��M��tRI��E���I�~ 1��;�H��I�F H�hH�H9�tf�H�3H��D��L��H������H9�u�M�vM��u�[]A\A]A^�@H����AWI��AVAUATU��SH��H��L�nH�6�T$H�<$�]\�H��t�x��]��H�@0L�0L�`M�M9�uEH�$�T$H��L��H�x H��[]A\A]A^A_��L���/�����u I��M9�t�I�>�@��u�L���C�t�H��[]A\A]A^A_�1��ff.�f�AVA��AUA��ATI��UH��SH��0H�6dH�%(H�D$(1��9�H���7H�Ë@������tT��tG����1�A����f.�H�L$(dH3%(��H��0[]A\A]A^��1���@1�A��u�H�{H�u�?�_E���������f�H�EH=�|$A���h\��H�
�Jc�H�>��f�1�A���d���H�KL�d$�H��L����H�uE����H�{�@E��H�\$H��L��H��D���D$������t�����H�E�8������+�H��D��H��H�������u�H�U�:�����D$�����@L���`����H;C�����@H;C�����@H;C���|���@H;C���l���@H9C���\���@�>���M�����_H�=΂�
��UH��SH��1�H��H� �I8�H�} H��HGH9�tH;Yu	�5�H9Yt.H��H9�u�H�u(�E�H�U(1�H���z�H�XH��H�H��H��[]�f�H������Z��H�0���Hc�H�>��H���H���@H�j�H���@H��H���@H�
�H���@H��8H���@ATA��8UH��SH��P�@H��H��H�hH���@�@1D�`0��5�H�C(H�C E��u!H���,H�H�CH��tH�H�t�,H��[]A\�@ATUSH����H�H��I�����PL��H�ŋ�E�C�EH�s����L��H�EH�s���L��H�EH�s�8G�L��H�EH�C H�E �C(�E(H�s0�G�L��H�E0H�C8H�E8H�s@�G�L��H�E@�CH�EHH�sP��F�H�EPH�CXH�EX�oC`H��E`[]A\��1�[H��]A\�ff.�AWAVAUATUSH��(dH�%(H�D$1�H�F H�L�hI�L9���H�D$H��I��A��H�$H�=I���d�L���D$E��uH�sH���U���H�}H�3I�����I�?txH�}H�D$��H��PH�L$H�H�I�7H�HH�pI�H�<$�C����X��H��I9��u���H�D$dH3%(uH��([]A\A]A^A_��I���>�ff.���H���H�=��'�1�H��H���i���f�����R���f���H���G���X�����GH���f���H�H����H���P����W��H��p�V��P��U�x0uOH�H�PH��tKH�QH�PH��tH�H�
H�@H�PH�H��tH�xH�H�@H�����H���H9��,u�H�x�,�fD����AUf�ATI��UH��SH��XdH�%(H�D$H1�)$H��)D$)D$ )D$0H�|$�8
�H��H�D$H�EH�D$ �!�H�4$H���FH�H����R�H�<$�����t?H�D$0H���W��I�$�����H�L$HdH3%(����H��X[]A\A]��H�|$(t�H�|$0��V��1�H������L�l$(H�8I��tTH�}��H��PH�H�I�$L�hH�PI�$�E1��u�E1�p����H�|$(�V�����@L�(����
�fD��AVI��AUL��I��H�5OATL�%�,UL��S1��&�t��H����t3H�uL���&�u�H��A�[]A\A�E�A]A^�f�[1�]A\A]A^�D����t?��tM��tV��tX��tEH���� ��U���H��~,H��H�DH���@1�H��H��~,H�Dø�����ڸ��f��>��ATI��UH��S�H��H�	}Hc�H�>����"H���1�L�e@L����
�L��H��H���G�"H����0�}�T���H��I���
�L��H��H���{9�"H���0�H�mPH���
�H��H��H���TG�H�߾"[]A\�0��(H���s0�}�{�EH�g|Hc�H�>��D�H�5��H���8�}���H��I���
�L��H��H����8�"H���0�H�m�[���D�H�5H{H���8�}�d���H��I����	�L��H��H���8�"H���/�L�eL���	�L��H��H���dF�H�U H������H�5�zH��1��VE������H�5�zH���,8�}���H��I���I	�L��H��H���8�H�}0tl�"H���7/�H�m0���fD[]A\�H�uH��L�������H�5OzH���7�H�uH��L�����H�߾)[]A\��.�D�}(�P��H��H����H��H��[H��]A\�s7�H�ߺH�5�y�\7�H�uH��L���M����H�uH��L���9����H�5�y�c�����ff.�@��L�G I�I�PH�H9�t H;qtJH���fDH9ptH��H9�u�1��fDH)�H����H��H�W(L��H���E�H���1���D��1�1��#����������f���AUL�-�xATUH��SH��H�G H�L�`I�L9�tE�(H���-�H�3H��H��H���6����)H���i-�I9�t�L��H���6��f�H��[]A\A]�D��H�G 1�H�@H�w(H���1���t
H�G H�H�����AWE��AVI��AUA��ATL�% yUH��SH��H���S���SQ����Ic�L�>��H�{E��D��L��H�������H��[]A\A]A^A_�f�H�{E��D��L��H���{�����u�H�[뙐H�{E��D��L��H���[�����u�H��[]A\A]A^A_���;��P���H�
�xHc�H�>��@H�s@1�H��H��[]A\A]A^A_���@H��P1�H���F���H�s� ����3���H��PH����H�sH��[]A\A]A^A_����H�S H����I9������1�M�����H�sH��@� �������H�{0��H�[8H��u&�zf.�H��H������u@H���)2�H��H��u���I��H��u�Bf�L���2�I��H��t0H��L���u���t��O����H�s@�����f�1��1���D�{(���%���ff.�f���AWAVAUATUSH���0H�T$�YO���1H��A��M��uxH�G L�(H�XL�I9�tsA�$���RO��L�=�w,��I��L9�tMA�$���,O��H��H�T$I�}D��E�H���*�t�H��[]A\A]A^A_�H��P�z���H��1�[]A\A]A^A_�f���H��tI�Ћ�HH��@����f�1��ff.�f���ATUS�0��N��H���,H��H��I�Ծ H�8H��PH�H�hL�`�{1t
H��Pt[]A\��@���������AV1�L�5�v,AUATUSH��H�?H�O H�AL�)H�w(H�ŋKH��H��L��@��I��H���sH�y�u9�r�1�[]A\A]A^�DH�CH�s���HH��@����M��H��I�<$E��)�t�I�D$�ff.����H�7H�H��tH�v�,H�8H��` D����H�=������H�=�����L����GLAWAVAUATUH�o@SI9���L�-�{L�
QzL��xL�%CyL�5�zL��yH�vzfDA����tA�Hc�fA�|ut�GhL�_p��A�r��~Hc��Hc�A�q�Hc�E�<PA9�u�I��A�TI9�u�[]A\A]A^A_�ff.�@��H��tBH�G�G�H�G�@H�G�G(H�G�G8H�F(H��t
H�VH��H;8t�@�W�V4H�H�RH�V@H���H�H�H�F��F0��AVI��AUATUH��SH���J��H��H��I��D�(�	�L�3�C4H�E(H��t
H�UH;�tH�C,�C$E�,$[]A\A]A^���H�����H�G(H��tH�WH��H��t�@,�f�1��ff.�f���H�G(H��tH�WH��H��t�@0�f�1��ff.�f���H�G����H�G�����G8����H����@��H�>����H��H�F(H����J��H�VH��H����J���x,H���f���H��H�F(H����J��H�VH��H����J���x0H���f���H�~����H�~�����G|�����~|����H����@��H����@��SH��H�����H���PJ��[���AUI���@ATI��U��H��SH���]G�H���8J���h�}L��H��Hc��@G�H�CH���J���C L��L��H�����H��H��[]A\A]���SH����H��1�����F�H�H��t{H�xH�Hǀ�H��H)����1����H�H�H�@(H�@H�@ H�@@H�@HH�@TH�@`H�@H�@1�[Ð�K����[�fD�3����[�fD��ATUH��SH��H��dH�%(H��$�1�I��L����8�H����L�濘�E�H�H����H�xH�Hǀ�H��H)����1����H�H��H�3�u8�H�H�@(H�@H�@ H�@@H�@HH�@TH�@`H�@H�@1�H��$�dH3%(u?H�Ġ[]A\�f��������fD�������A����SH����3�H����G��[��USH��H��H�(H��tnH�C H�P�H9SsH��[]�f�H�hH��H�4��\�H�C(H����G��H�S f�H��@@ @0H�k H��[]�f�H�޿�cD�H�C(H���eG��H�H�C H�CH��[]����ATUH��SH�F(H��H��tYH�VH�<�H��tLH��H�����H�C(H�SH��H��@�C4H�H�@H�C@H���H�H�H�S��C0[]A\�DH������H�SH�C(�@H�{L�$�H���K&�I�$H�{(H��t�H�CH�<��u������UH��H��SH��H���x���H�C(H����H�SH��H�H9���H��t<H�C@�S0�H�SH�C(H��H�S@H�PH�SH�C(H�ЋS4�PH�SH�C(H��H�(H�C(H�SH��H��@�C4H�H�@H�C@H���H�H�H�S��CP�C0H��[]�fDH��t�H�CH���f���AUATUSH��H��v|�|7�uu�|7�unH��I��H�ֿ@I���hB�H��H����E���u�L�`H�ljpL�`�pL��H�H�@ �@(H�@4�R�H��H��[]A\A]�@H��1�H��[]A\A]���AUI��ATUHc�H��SD�eH��Mc�L��H����A�H���E���}�1Ʌ��H���4@�4H�qH9�u��D(L��L��H���(���H����D���@ H��[]A\A]�f.���UH��SH��H�����H��H��H�߉�[]������H����UH��H��SH��H���/���H�C(H����H�SH��H�8tSH�C@�S0�H�SH�C(H��H�S@H�PH�SH�C(H�ЋS4�PH�K(H��tkH�SH��H�8tH�BH�CH��H�(H�C(H�SH��H��@�C4H�H�@H�C@H���H�H�H�S��CP�C0H��[]�f�H�CH���fD�ff.�@��AWAVI��AUATUSH��H�FHH�������V0L�F@H�D$L�pL�=
qH�-�oH��mL�-�nL�%.oL��oL��A�A�FLM��I���Hc�A�fA�<wtA�AhM�Ap���A�t��~A�Hc��Tu�Hc��<S9�u�A�DUI����t
A���M�ApA�AhL��M���H�L)�L�4$A�GA�Q8A�A�Q0A�M�A@����B��H�=�lHc�H�>��D�~L�FHE��u�FLI�~��I�~��I�F(H����I�VH��H�H��ts�RA�V4H�L�BM�F@M���H�H�I�FA�A�V0���I���M��H��H�4$���H�4$H�|$H����$�L�znL�[nA�V0M�F@�~���L���]���I�VI�F(�@I�~H��L���� �H�I�VI�F(H��H��Q���H��,H�I�FI�F(H���&����H��,I�~H�I�F�������H��H�[]A\A]A^A_�H��H�[]A\A]A^A_�H��H�[]A\A]A^A_�I���I����R��H�H��H�[]A\A]A^A_�M��A�Q0M�A@���I����H��H[]A\A]A^A_�I�IIcq8�M��I�����D�L�>mL�m���H��H1�[]A\A]A^A_�A�A0L�4$A�M�ApA�Ah���A�AL��M���O�L��lL��lH�D$�h���H�|$I���M���7��H��A�FLH��H[]A\A]A^A_�L��I+�����D$,A�A0A�I�QI�A(H��H�
D�q8E��u3�AA�A4H�I�QH�I�QI�A(H���@8I�QI�A(H��H�
H�qIcy4M�q@H�>H�D$I���L;t$��H�|>I9���?���y4I)ƅ���I���H�D$L��L�$I�A@��L�$L��kL��kM�A@M����X���H�|$�\M���>�L��kL��k�(���H�|$�"M����L��kL�ck����I����H��H[]A\A]A^A_�A�~��|$��~*A�~�1��H����H�JH9�u�I�QI�A(H��H�
�y8te�t$��q����L�D$0M�q@H�y�Q I)����EH�A�>���I�A@A�ALA�AP�P�����������A�A4H��@A�A4�D$��u+�D$���I�QI�A(�D$H���@8A�A4I�qI�Q(�|$H��L�2�A;N�BA�I4H�HcɃ|$H�@�I�A(I�QH��IcA4H�R�DI�A(I�QH��H�H�@I��������|$�^HcT$,L��L�$H�I�A@��L�$L��iL��iM�A@M����=���f.��A�����A��L��Hc�H�L$ L�L$�(�H�L$ L�L$H��H�A��Mc�I�Q�t$I�I�A(M�q@��H��q���C���L�D$0L��L�D$0L�qL�L$�t$ �{
�L�L$L�D$0L�iH�HH�xH��L��hH9����v<��Hct$ � �� HN�H)�H9�HG�HcL$HzH��L�����K��t�?@�9��(HBI�II�Q(A�A4H�ʉB����PI�������1���I�yL��L�D$ L�L$���L�L$L�D$ �D$L�JhL�+hA�A4����H�?H�9��L�t>�L�t9�H�yH��H)�H)�����H��d����I�~L��L�L$ �L�D$8Hc�L$0��L�L$ I�FI�QI�A(H��H�x�;���L$0L��gL�D$8L��g���HI�QI�A(�L$AI4H���G���H�Mcq4LpL�t$������t>�f�t9������?�9�Njt>��t9����HcT$,L��L�$H�I�A@�e�L�$L�:gL�gHc�fA�<OM�A@tA�AhM�Ap�TM��Hc��4S9�tI�L�TM��Hc��4S9�u�A�DUM������k������c���I��M�A@�I����{:�����H��t���f��ff.�@��H��tgUSH��H�F(H��t
H�VH��H;8t#�G H��H����u*H��H��H��[]����DH��G H��H����t�H������f��ff.�@��H�G(H����SH�WH��H�<�H��tqH���6�H�C(H�SH��H�CH��tH��H�CH�C(H��t?H�SH��H�H��t/�R�S4H�H�RH�S@H���H�H�H�C��CP�C0[�����SH�G(H��H��u<�f.�H���6�H�C(H�SH��H���0)�H�C(H����H�SH�<�H��u�H��H�����H�C(H�{`H���w��H�C`H��H��H�C(H�CH�C H�C@H�CHH�CTH�CH�C�$��1�[�1��f.�f��>"t#H��H��tsH���V�H�H�Q���uXH)��@H��1��Q��'t�~(��,tȀ�\uN�y\H�Qu�H��H��t��H���̀�"u+H��t�Ð��H���H������H���f.�AWAVAUATUSH��8HcJH�<$H�t$dH�%(H�D$(1�����\H�H��g�L$H�H�H�׃����о�؅�Iƾ)ֺ
��
O�9���H�
�fH�1�H��	�H��9�~(�9�u�t���HcՃ��D�H��9��HcL$�����������AA�.H�,e��tA�2H��d���/L�t$�E�M�,�L�%F^,�@M9��/IcNI��I��I�4�1��!���L�L9�}ٸ����H�\$(dH3%(�eH��8[]A\A]A^A_Ð�D$�����A�H��c�x����H�?���s1�H��cH�|$1�L�5�],L�'�DI��H����A�$��t>�S<%u�su�9�}�HcD�L��D�iH��I�4��d���Ic�I��A�$��u�1��5���f�A�&H�Sd�������D-A�
H��bH�I)�M�����@H�<$H9|@��?����A�*H��c���HcL$���H�$H���������H�H9�H�$}H��������H����������V��H����w���ff.���S1�H��H�=rb�8�H�C0[�@��AWA�����L�
�dAVAUE1�ATA��USH��H�|$(H��$�dH�%(H��$1�H��$�Ƅ$@H�D$0H�D$`H��$@H�D$h�I��H���D$H�,$H�D$G�<)E��A����AA�����E���FA����A����E�w�A��wUMc�H�5�cB�69�uBH��cB�0L��E�����t$H�T$XH��A�������H�U��H���t$��H��cF�,(E����H��bMc�J�0�)�I��H�H�T�A���1H�
jbE��Jc�H�>��H�U�H�=Y�H�ED�U�H��H�D$��������	H�=;XH����������H�=XH����������A���)H�D$(D�\$@��L�D$8H�x �T$ H��P�T$ L�D$8D�\$@I���@���D�\$8L�D$ �_����H�D$(H�t$H�x �(�H�5`I�EH�����L�D$ D�\$8L�
dbH����L���J��H��H)�L)�H��H�mH�PH��aH��a�9B�0����
H�����wHc�H�=�a@:4�hH��a�L��AH�YK�D �H9���L)�D�\$ H�kI��'�fM�'L�D$I��'LO�K�|���L�D$H��I���3M�|$L��H��H���U�I��H��H�4$M�H��L���;�L�D$L;D$L�
JaD�\$ tL��D�$�'��D�$L�
,aL�K�D&�I�l/�H9��L�<$M��A�������1���fD1�E1�����fD�A��wIc�H�a��T$�����|$u3E�����A������@I9���H��H�H��E�<A���t�A��A��w�Mc�H��_B�<8u�H�`B�8L��E��~�H�T$XH��H���D$H�U�J���Ic�H�V`�E�4���f�H��_F�,(E���P���A����	����L$���_���D�؉D$xL�t$`H�D$pL�l$hH��L��D�\$L��L�D$H�\$pH�D$ ���L�D$D�\$���H�5�\����H�|$(D�\$ L�D$�D$���D$L�D$L�
c_D�\$ �������H�|$(H�5�\L�$�����L�$�*DH�U�����A���m�����L;D$tL������H�|$`H;|$0t����H��$dH3%(���xH��[]A\A]A^A_�H�D$(H�|$XL�D$H�0�9��L�D$L�
�^A���N���DH�9^�L�����H�t$`H�|$(�
��L�D$D�\$L�
\^����H�D$(H�U��D�\$8L�D$ L�m�H�x H�T$H��PH�H�0L�hH�T$L�
^H�PH��L�D$ D�\$8���H�D$(L�mD�\$ ��L�D$H�x H��PL�
�]L�D$H�H�H��D�\$ L�hH�@�U���H�U��L���I�����I!�L��H���3���I�����I!�L��H������I�����I!�L��H������I�����I!�L��H�����H������H�K�����H��9����H�D$(H�@(���H�D$(H�UD�\$8��L�D$ L�m�H�x H�T$H��PH�H����H�EH�L$(H�A(�c���I�����I!�L��H���J��������A���������A������w���H�|$`H;|$0tD�\$L�D$�I��D�\$L�D$H�|$hL�D$D�\$�;�L�D$H��H�D$`t1H�T$ L��L���,�H�t$`L�D$D�\$�}���M�����H�D$0H�|$(H�54YL�$H�D$h�H�D$`�s��L�$�u���H�D$(H�5~ZD�\$H��L�D$H��H�p0H���@��H�L�D$L�
�[D�\$E�<�����z���H�D$(D�\$L��L�D$@H�x H�T$8D�T$ H��PD�T$ H�T$8I���D�PH�D$(H��H�x ���H�t$I�E@H�D$(H�x ��H�|$I�uXI�EP�8�L�D$@D�\$L��yI�EX�I�}PH�5aXD�\$ L�D$�>�L�D$D�\$ L�
�ZH���Y���A�E�L���H�|$H�p(����L�D$ D�\$8L�
�Z���%���H�D$(H�t$H�x �
�H�|$I�E0�+�L�D$ D�\$8L�
NZI�E8���H�|$�:���L�D$ D�\$8H����H�t$pH�xD�\$@L�D$8H�D$ ���L�D$8D�\$@��H�D$(H�T$ D�\$8H�t$L�D$ H�x x5�6�H�T$pL�D$ L�
�YD�\$8I�EI�U �X���A�E�K����A�1�L�D$ L�
�YD�\$8��H�D$(H�t$D�\$8L�D$ H�x ��1�D�\$8L�D$ L�
\Y����DAVI��AUATUSH�� �WdH�%(H�D$1�H�H�h ��uSH��tNL�`0H��I��M��t	���|H�CH��H�PH�0�Q�L�cM��t8L���p��L��H��H���2�KH�D$dH3%(uQH�� []A\A]A^�AoI�FH��L��H��$H�D$����fDL�����L��H��H����
��i�������AWI��AVI��AUATA��USH��(L�.H�_8H�L$L�D$I9}��1�I�GXH��tBI�nI�NH����H�y�gI�I�`H���1��I�~I�FH��1I�GHH��t	I�P��H��A�G|t*A�N1�H��tH���D��A�FH�T$L��H�t$�N���H��t=A�G|���E��A��A�D�D$tvH�����I�~H��1�H���%��D�D$D��I� H��tXA�G|u,A�E8tA�FuA�W@L�D$L��H�L$D�������E�H��(��[]A\A]A^A_��I� A��H��u�H�T$H�t$L�����I�}u�I�](H��t�A�Fu�H�߽�U��I�~H��1�H���t���f�1���������@H��H�L$�#��H�L$H��H��H�����I�~���H��I�GX�d���H�T$H�t$L������I�m(H������H������I�~H��1�H����������fDH�T$H�t$H�����I�~���H��I�GX��f�AWf�I��AVI��AUATUH��SH��H��xdH�%(H�D$h1��D$$D$4�D$D�D$ �F8��H�=�,E1�H��t��HH��@L�D$ H�����A��I��f�@H�$D$I�D$�3�1�M��L��L��H��H�D$������uMH�{ t�D$��C8��E����$��H�D$hdH3%(�/H��x[]A\A]A^A_�D�C8u�L�d$�D$uVH�\$H����H���P��H��L��H����H�|$�(��H�t$ H���H��H��1���&��q���f.�L�����H�L$H�D$8�D$�D$@H��t!H�t$ H�]�H��1��&��-���fDH�t$ L��L��H���m��������AoI�FH�T$PL��L$PH�D$`H�{ ��������H�~ �E�����#��L��L��L����������������ATf�USH��0dH�%(H�D$(1�)$�)D$H�D$ 9wxv'H���,H���9GD��GD�G|t&�K| �H�T$(dH3%(uiH��0[]A\�@H�=�,H��A��H��tI��H�����u�H�=��,H��tI��D��H��H�����u��c|�1��fD�G|��������ff.�@��ATA��UH��SH��H��0dH�%(H�D$(1����u3H�=#�,H��t'f�I��D��H��H��)$)D$H�D$ ���H�T$(dH3%(u	H��0[]A\������AWI��AVAUATUSH��H��(L��@D��HH�|$H�|$H�T$��H�sH�|$H��D�0H��tz�S��U�H�|$��HH��@�3�<��H�|$�b��H�T$L��H��H�|$����H�|$D��L����H�|$�>�D�uH��([]A\A]A^A_�L��D�����UH��SH��H��(L��$�L��$���t@)�$�)�$�)�$�)�$�)�$�)�$�)�$)�$dH�%(H�D$h1�H��$@f�H�=kRH�D$XH�D$pD$D$$D$4H�t$�T$ H�D$D�D$L�D$�D$P �D$T0H�D$`��)�H��H�L$PH��H�t$�D$���H�|$�n���� ��H�D$hdH3%(u
H��([]�������UH��SH��H��(L��$�L��$���t@)�$�)�$�)�$�)�$�)�$�)�$�)�$)�$dH�%(H�D$h1�H��$@f�H�=JQH�D$XH�D$pD$D$$D$4H�t$�T$ H�D$D�D$L�D$�D$P �D$T0H�D$`�(�H��H�L$PH��H�t$�D$��H�|$�>���`��H�D$hdH3%(u
H��([]��W�����UH��SH��H��(L��$�L��$���t@)�$�)�$�)�$�)�$�)�$�)�$�)�$)�$dH�%(H�D$h1�H��$@f�H�=)PH�D$XH�D$pD$D$$D$4H�t$�T$ H�D$D�D$L�D$�D$P �D$T0H�D$`�q'�H��H�L$PH��H�t$�D$��H�|$����>��H�D$hdH3%(u
H��([]��'�����UH��SH��H��(L��$�L��$���t@)�$�)�$�)�$�)�$�)�$�)�$�)�$)�$dH�%(H�D$h1�H��$@f�H�=OH�D$XH�D$p)D$)D$ )D$0)D$@H�t$�T$ �D$P �D$T0H�D$`�U&�H��H�L$PH��H�t$�D$�l�H�|$����0��H�D$hdH3%(u
H��([]����ff.���UL��SH��H��(L��$���t@)�$�)�$�)�$�)�$�)�$�)�$�)�$)�$dH�%(H�D$h1�H��$@f�t$H�D$XH�=�MH�D$pD$D$$D$4H�T$�L$ H�D$D�D$L�D$P(�D$T0H�D$`�-%�H��H�L$PH��H�t$�D$�D�H�|$�ʻ����H�D$hdH3%(u
H��([]�������H���H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�H���$H�D$H�D$ H�D$�D$0�}�H�D$dH3%(uH�����0����H��@��t�O|H��,����PD���H��,H���g|�����WD�D��H�E�,�@��H��H�=1�,���H���,�H���ff.�f���SH���&�H��H���,�d+�H�u�,�[����H�ͷ,�@��H��H�=��,���H�=�,�H���ff.�f���SH���S�H��H���,��*�H��,�[����H�U�,�@��H��H�=A�,���H�͙,�H���ff.�f���SH������H��H�	�,�*�H���,�[��H�?tjAUATUS1�H���@��CH�<�H��u�I���{H���J��I�Ņ�t%��1��DH��I�<�輱�I�D�H�CH9�u�H��L��[]A\A]ÿ���fD��SH��H���p���H��H���&�谵�1�H��H�5�J�8@��1���S�����SH��H���0���H��H������p��1�H��H�5{J�8@��1���S�����ff.�AWAVAUATA��UH��SH��H��8L�-B�,dH�%(H�D$(1��D$H�D$A�E�D$�D$H�D$ H�D$f.�H��H��D����I��H9��aM��a輴�I��M���@�������tPA�E�|$�����t
H�|$�F��H�L$(dH3%(���H��8[]A\A]A^A_ÐL�L)��u���D�|$��1�H�|$�<�f�T$&�����D�d$ f�L$$��xGA�E�D$�D$�%���DA�E;D$t6�D$��A�E�J����D$�D$���DA�>t��7��DA�E�D$�����{��H�����H�=�HH�D$H��tH��H�=�H1��a�H���9���/���@�����1ۀ|$�����������ff.���UH��SH����t7�����,D��,H��
����H�UH�u��H��[]���D�b�,��H��,SH��I��H�=%H�H�1���H��H���q��H�޿[H���p�����AWI��AVI��AUI��ATI��USH���H�_�hH�����G �����̀���#�@��H�5�GH��H�j�,H��H�1�����@uI�l$H��tH������H��H��H����H�CL��L��H��I��;��H��H��[]A\A]A^A_�f������3#�@��H�5/GH��H��,H��H�1��Q�A�T$ H�5GH��1��;��f���fD�=s�,�"���H�5|�,H������H�=�F������d����B�,�����?t�fDH���=�,����H���f.�ATUSH�� dH�%(H��$1�H��,H��tSH��H��H�����>H�|$H��H�
Ʊ,H��tH��H�=@F1���L�d$H��H�¾L�����H��u#H��$dH3%(��H�� []A\�L��
H����������!�%����t�L��H������D�H�JHDщ��H��L)�����f�H��H�����H���ͮ�T$H��H��,�-����e��D��AVAUATUH��SH�FH��H=���I��A���*!�H�uL��H��H���H��I���voM��L;erL��H���H��L��H��J�4(���
H���L��H�SH�3��;�������M�L;msjL;cs�L��H�������A����M)�I���LB��s���f�H��
����H�U[�H�u]A\A]A^����f�[1�]A\A]A^�D[�����]A\A]A^�f����ff.������t��t�%�,�%�,f��%�,f.���H���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�H���$H�D$H�D$ H�D$�D$0��H�D$dH3%(uH�����;��ff.�AUI��ATUSH��H��H�oH��twD�g H���k��E��tzD��H9��Z��H��L�����H���,H�,�H���:��H��L��H�����s HsH��H�����H��H��L��[H��]A\A]����f�H�-9�,H��tH������H��H��L�����H�%�,H���ff.�@��AUI��ATI��UH���SH���?�H�}H�uH��H�����H��H����L���Y��L��H��H�����H��H��[]A\A]�ff.�f���AUI��ATI��UH����SH�����}H��uVH�mH��t5H�����H��H��H������L��L��H���y��H��H��[]A\A]�H�-!�,H��u���f.�H��H���5����AUATUSH��(dH�%(H�D$1��Ĭ,H�D$������H��H�=NAI��I�Չ��,��H�t$L��L��H�-v�,�D$H��H�E�PH��tSH�M�;H��H�T$�H�|$��菮��O����xB�-@�,H�L$dH3%(��uAH��([]A\A]��H�|$������I���	���=�,�E�뭻������d��@USH��H����H�-Î,��y
H�EH��PH�EH��H�@H��[]��f.���H���,H�
n�,H�H�Q�f���H�m�,H�
.�,H�H�R�f���H�M�,H�
�,H�H�R�_���ff.�@ATUH��SH���?��u_H��t�H�=��H�������u�[]A\�D���AH��1��<����tU[�]��A\�%��D���y��3H�=�?1���H��I���|��L��H���,���h�����H��H�=_?1��y�H��H���>��H��H������H��,H9��K���\��f�USH��H���odH�%(H�D$1��/�����y��Yt{��,��P���,��t%��St H�=?�ީ,�y��H������������tI�-��,������H�=�>�J��H��u9H�=�>�9��H���������H�|�,�(�w���H��襠�u��u��������PXH�
3�,H��H�@�,H�H�Q�	���f���PXH�
�,H��H��,H�H�R����f���PXH�
��,H��H��,H�H�R���f���ATI��USH���H�t$(H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�腧��$H��L��(H��H��$��D$0H�D$H�D$ H�="�,H�D$���,�+H�D$dH3%(uH���[]A\��t��@��ATI��USH���H�t$(H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�襦��$H��L��(H��H��$��D$0H�D$H�D$ H�=��,H�D$���,�+H�D$dH3%(uH���[]A\�蔾�@��ATI��USH���H�t$(H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1��ť��$H��L��(H��H��$��D$0H�D$H�D$ H�=��,H�D$�ǚ,�+H�D$dH3%(uH���[]A\�贽�@��H�=��,�@��SH��H�=<;謞�H���,[H����,�f���H�=]�,�@��H�=E�,�@��H�M�,H�H�;�,H�H�)�,H�H��,H����S�6�H�=�,�j��H�#�,H�����H�����H��[���f.���SH��H���H�t$(H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H�5�,H��$��$H�D$H�D$ �D$0H�D$H��tH�t�,H�8H��P H��H��H���,�������,H���,H�D$dH3%(u	H���[����f���S1�H��H�=�c芴�=�,����;=ݖ,u{�=͖,��t;=Ɩ,t9=–,t
�S���7��H��H�=��,�������,H�=/�,���,���,���H��,H�����H���G��H��[�>��fD������
���=E�,���t����f.��=*�,���a����q���ff.����H��H�5��,H��tH��,H�8H��P H�=��H�Z�,���8�,H�G�,H���f���H�5�,H�n�H��HD��fD��Uf�SH��H��H�|$H�F�?t�CH�{H��[]���G��?����<�����F�G���FH�wD�GH�t$H�s�G�PЀ�	w+�H��@��H�|$H��H���TPЉ�G��HЀ�	v�< t�H��[]�fDH�nA��@H�l$u)H�kH��[]�fDH�=81��*��H�|$�&���H��H�T$H�s�o�H�l$��x��} u�H��H��H�l$请�SH9�v��C�fD��H�=�71����H�|$����ff.�f���H����虮�H�=r����M��H�=������H�=�����ի�H�=��H�����D��H����H�.���H9���H9���	��ff.�@��@�=�,�@��H�����,9��,H��u
���,H�=z�,���H�=�,�h�,H�=5�,�W�,H���.��ff.���H���2�,;4�,H��t';%�,tH�=�,�C���H���,H�Ք,H������,��@��UH��SH��H���,H�5M�,H�;H��t	H��P H�;H�5-�,H�*�,H��tH��P H�5K5H��H��,�=�H��H��t-H��H���Z�H�{H��,��H�ӟ,H��[]�@H����H���,H��[]�f���H���c�H�,�H9�,tH���fDH��H�=�H����D��H���H9Γ,t�H��H�=�3�y�f���H�=��,�@���
��,���,S���,9���9���9��������t3A��L�x3H�
O51�H�$4H�=c�,�J���T�,�=I�,t3A��L�<3H�
51�H��3H�=#�,�����,H�-�,H�5��,H�;H��t	H��P H�;H�5f�,H�c�,H��t	H��P H�;H�5>�,H�;�,H��tH��P H��,[����,9��������,���3���A��L�x2H�
O41�H�3H�=g�,�J��X�,�R�,����������ff.����S��wvH��3��Hc�H�>���H���3��߾H��\H��1��K��1�[�����f���f���f���f���U1҉�1�S���H���4���e���ƒ��߃�@��D�1�����Q��H��[]Ð��AWAVAUATUSH��dH�%(H��$x1�9�������L�t$(E1�蟛�L�d$0I�ōE�D$H�D$pH�D$H�D$rH�D$1Ҿ��1�茧�A�m���u	��	��L��L����m��A�Dž���f�|$0�FH�l$PH�T$*��H��������D�|$*H�����L$(L��H�ʼnL$��L$E��I��H�‰�1�A�H�=3���;\$�L���E���]��H��$xdH3%(�-H�Ĉ[]A\A]A^A_�fDH��$��޿�L����H��$����H��H��$���H��H��@0�	���I��H��$�H��H�� H����H�ǁ����	��z�L��I���H��H�=h21�A����!���fDH�t$H�T$,���D$,n���M���C��f.���A����H�=22H��1��P�����f�1��D$`)D$Pf�D$*�g����Ʊ�fD��USH�����
����1�1�����l���(���€��߀�@��D�1��H������H��[]�f���AWAVAUATUSH��(D�7H�L$A���tFI��M��E�����D�L$H��H�T$�Ϙ�D��I�ŋ(�ҿ�H�T$D�L$��xA�m�����H��([]A\A]A^A_�A�}h������ff.���ATUH��SH�� dH�%(H�D$1�H�<$�H�t$;u����������1�L�%0���t&��~<A��M��1�H��H�
O1H�@0�s��H��H��t=H�,�E���t�ĉ�H��x,�8�Ȳ�u9��C��H���E����H��u�H�D$dH3%(u	H�� []A\���f.�@��S1�H��dH�%(H�D$1����ÉD$���tQ��1�茗�y�c�����Ã�	��	Ã����H�|$A�1�L��0H�
�0H�����H�T$dH3%(��uH��[��W�����H��xdH�%(H�D$h1�H�A�H=����L��f�H��H�$)D$)D$0H�D$@H�L$H�D$ H�D$(���u"1�H�t$���H�T$hdH3%(u?H��xÐH�D$P�D$dH�D$0H�H�D$PH�D$X�t$`H�D$8�蒮�f���SH��pdH�%(H�D$h1�H�B�H=�������H��I��f�H�T$H�D$ 1�H�D$PH��H�t$)D$H�D$@L�$H�D$()D$PH�D$`H�D$0H�D$8����H��~H�|$8w#�����H�L$hdH3%(u4H��p[��H�T$0H��t�H�:v�H�H9Ju��R��謭�f.�f���AUA��ATI��0USH��H�-�x,H�}H��PL��D�(H�����H�}��H�C���H�CH��H��[]A\A]�@��H�5��P����USH��H�H�H�{H��tH�s �
���v��H�{詐�H�-2x,H�sH�}H��t
H��P H�}H�CH�H��H�@ H��[]����ATI��USH������H���^��H��1�H��H��H��uDI�t$ 1�H9�v0I�|$H��tN�H���A��H��H����n��I�D$I�\$ 1�[]A\�H�H)�1�H��H��H��t�����H���X��H��I�D$H��������@��AWAVAUI��ATUSH���H�t$8H�T$0dH�%(H��$�1����H�����I��H�D$0H���H��H�L$8H9��kH�D$0H�H�D$(I�E H�L$(H9�sH)�H���PH�t$(L��������H�D$81�I��1�I��H�D$(J�D0�I��H��L)�H�|$ ����H�PI�}L��1�H��I��M���Q��M�MI��L��I�M��I��fDL��E��H��A��L��D�‰�s,I�Q(I�.H9��H;T$(���D�����!ЈA�9L��H��L��D�D$L�\$L�L$�`��L�L$L�\$H��H��D�D$�I�H�I�A(H9�s"1�I����ǃ���������A ;I�i(I9�t/I)��?����H�D$(����H�D$8H��H�D$0���D�D��I��M����H�l$ H�|$ ��H�t$0H��$�dH3<%(H���AH���[]A\A]A^A_�f.�H�l$ I��M�H���fDH��������H��H�|$0����f.���I9i(uH��1�I��L9�����D����H�D$8H9��S���H)�H�D$0H9�H��HF��<���f�A�uH�T$@����xQH�D$pH;D$(�����H�|$8H9�vQH��H�D$(H)�H�L$0�j���f.�H�|$ ��������s��8t�Y��H��������1����H��������薨�fD��H�G(H�H�G���AUATUSH��L�o(H����I9���I��H��H�����H��H���$��L��H)�H9�HG�I9�vpH�D*�1�H�H��1�H��H��H��H9����H)É�I��H�S��I��H���L$H�jH��u:I�|$H��L���
��L$������� H��[]A\A]�f�H��H!�I�D$(�H��H��ID$�H��H���s��I�|$H��L�����H��t��L$1����H����	�փ�wH��u�� H��1�L�@H��L��H��苲�I�����b���1�1��fD����	ЍQH��H9�r��A (H��[]A\A]�ff.����7H�W 1����ff.�@��AWI��AVI��AUI��ATUSH��H�����H�����I��H��H��L9����J�,3L��H��������I�}L��L��H����I�E(H9���M9�waH��1�I�}I��H��H��1�H��I��H����1���H��A������Q��9�s'���ډى���������@<A9�u�H��[]A\A]A^A_��H��L��H��L��[]A\A]A^A_���@1�I�}I����I�������D�������� I�m(M9�w��/���fDAVA��AUM��ATI��UH�����SH��H��@H�RdH�%(H��$81�H��H�T$H�T$H�� ��D$�����H�L$H��D��M��AUD��H��A�����蘭�ZY��~7H��$�H���}��A�ƅ�ufH��$�H9D$��L�����H��$8dH3%(D���H��@[]A\A]A^ÐH��H�=X71�A������	��I�E����E1��8t�H��H�=�;1�A���������L��I�E�0���fDH�L$H��$�H��H��H��H���lj�H��H�� %������	�H��H�� %�	�9��&�����@��H��H��0�@0�	�	�9������sI�<$A����s���sI�<$@����`�����薣�fD��AWAVAUI��ATUSH��H��H�T$0H�L$PL�D$(dH�%(H�D$x1�H�D$p�D$<�H�D$HH�D$lH�D$XH�D$hH�D$@�_fDL�D$(H�L$0H��L������Ņ���H�|$@1�A��L��%H�
N&H�}������l$<��L��1����ljD$8�D$h���u��\��8I�������K�kL��I��H�D$���S��E���D$�����D�ƅ�E�t$ 躠�L��L��H���|��l$$�T$$�D$������L$ �t$H�|$�!��A�ljD$lA�����A�>�&�C ����|$	��k$D�c(�����L��/��D�E��DD��k��H����H��L���'��H�D$������s D���H������A�T$$A��D$����E���H�K�T$ �t$H�|$���A�ljD$lA����A���H�SH�|$H��H�T$pH�� ��D$t耔�L�L$(L�D$0�H�L$H�|$lH��耽���H�|$�N��L��H�������+A�����H�|$������L��H�=�3H��1��H��H�\$(H�H�|$0���A��1�A�L�h#H�
�#H��zH�|$l茲�H�|$�“�H�5:#H������A�A������(A�>�����H�t$H�=G31�����H�\$(H�H�\$xdH3%(D����H�Ĉ[]A\A]A^A_�f�H�K�s D��H�|$����N����L��H�=~31��_��H�\$(H��DL�t$0L��I�>�`���sI�>���a���sI�>@����O��H�|$�Ւ�H�5M"H�����H�D$PD�|$l��4����H�|$0�>��H�|$X1�A�.A��L�"H�
�"H�Ny�4��H�|$�j��H�5�!H�����l$<A�.�)���L��H�="1�A������q��H�\$(H�脆�����f����H�=�!H��1��:��H�\$(H����DL��H�=:�1����H�\$(D�|$8H��J���H�D$PD�|$h��8����^��A��1�H�|$lA�L�!H�
�!H�^x�D��H�|$�z��H�5� H�����A�D�|$8����f���AVAUA��ATI��H�=\!UH��SH��dH�%(H��$�1�����1�H�5F5H��D$1��>��H��E��tFH��L���{���K�>��I�ŋ������t>���I��H���:1�L��1��4��D$���uK��8����1�H�|$�������H��$�dH3%(����H��[]A\A]A^�H�T$ �ƿ�o���i��1�耺�T$8H�߾AA��1����D��A���_��A������T$@�����D��������|$� 讇�1�1�D��H�D$�=��H�t$H��H�D$�۝��RH�+ ��Hc�H�>���H��H�������v����E1�H�|$�{��H�|$���|$�Ȫ�����D��踪�����A���u�H�ߺzH�5^������������@�s��8��������D�H�5'H���,��x�H��L���m���=���A�E���H�|$A�����L��H�=��H��1�����0���H�|$A��藽�H��H�=�H��1�����	����)��H��L��H�=F.1��u���&���A������L�WL�^ATUSL9VuIH�L�H��L��H��H��A�܉�L��H�� ��A�����	�H��H�� ���D	�9�tmM��u!H�GXL�OhH9���L9�L��E��uH��H9
|2L�VH�H�H�GhH�FH�GXH�F H�G0H�F�[]A\�fDH�
L�W�����A��H��I��0�E0�	�A	�A9��q���L9_h��D ��a���H�_XH9^ �S���H�_0H9^t��D���f�L��H9
�Z����f�AUATUSH��H�H��kX���u\H�-�d,H�sHH�}H��t
H��P H�}H�sPH�CHH��t
H��P H�}H�CPH�H��H�@ H��[]A\A]��D����I��D�(��������CX����E�,$�z���ff.����'���U1�SH��(dH�%(H��$1�����D$�����H�l$����H��謬�1�H�|$A�lH��L��H�
�H��r貪�H��~}�|
H�C��:H��HD��D讛�H��tY�H�xH��b,H�0�c��u?H�t$H������x.�D$��~&H��$dH3%(uH��([]�f�����������@AUATI��UH��SH��H��H�~dH�%(H��$�1�H��@(t
��������I��L����y7�b�8�W��H��$�dH3%(u`H�Ĩ[]A\A]�H�H���L��L��H�s(D�@(A��A��A��A���S����E1��@賯�H�{�j��H�{�d����,��ff.��U��H�5SH��H��H����xR1��uH����[]�f.�蛦��Z|
�‰�������iҠ�)э�����H����[]ý�����DAUI��ATA��U��H�=��SH��H��`,H�H�>^,H�01����H��H����H�މ�H���t��x#E��u1�H��[]A\A]�fD���~�y�1������y�����ff.�AWAVE1�AUI��1�ATI��U��SH���T$X�T$_dH�%(H��$�1�貹�I�uI�}H1�H��1��N��H�D$PI�$A�E��D$L@��uE�uI޿L��$������I�W�L��$�H�D$(H��1��H�I�EHDŽ$�����H��$�H�D$PH��$�A�E(����$���H�D$x�l$HH�$H��$H�D$@H�D$pH�D$ H�D$hH�D$H�D$H�D$H�D$8�;D�|$x���$�����%H;�$���H��$�����ƒ������$��	Ȉ�$���M��taH��$L�H9�~QH��$�H��$��@(��H�t$@�U������{�8���L�$L9���fDH;\$tiI�EH��t`L9�}[H��$��D��)�)�9L$L�09��(A�u�<���)�9ξC�I�U ��H�\$��uH��H��$@1�職�H��I9���H�D$H9�$���=���Z|
H�\$�‰������H��$H�D$��iҠ�)с�����$��$���y�L�L$ ��H��$�I��H�
�H�D$hH�5	���������H�|$8�7��$�蚢��Z|
�‰�������iҠ�)э������1�荶�H��H��$�H�$L��H��D�`�����Ņ���������
���\����D$H����A�E(�H��$�����1��$��ʼnD$x����E�|$X����$��1���H��I�}H�{}������$�������H��$��a���(��H��$I�]`I�E0H��$I�E8��$�DŽ$�����A�EXH��$xH�PH9�|
H��H9���H��M�eH���H��$xH���}��L��H��H�=XH��1����$����t�x��I��D�(�����E�,$H��$�H��t�YH�5�.���u�x��H��$�dH3%(����H�ĸ[]A\A]A^A_�@H�C�H9�$��^��$�1ɺ��������f.�H9\$�R�����$=��-�@�����H�\$��Љ�$��$�.�����$蔭�������MbL�D$hH�
���H�51����$�׺�������H�|$hH�D$x���H�|$ ���H�<$�F��H�|$8�<���3����1��׉T$0裲�T$0��t�vw�T$0�8t�T$0���T$09������H�$L��H������Ņ��
����|$x����L���\����Ņ������f�I�}H��z�����f�H��$��C�����$�����@H��$���$���H�T$@��虼�����H��$�H;�$x��H��$���)�����v����!��
�s��������fDH�\$������I�U 1������fD���������fD����~��H��$�H��$��/L� ���H�t$(H�~�*M���@A�<$/t,H��t'H��$�H�|$(H)�H���U��H�|$(�/膲�L���n��H�|$(L��H���.��蔫����H�|$(��A�ĉʁ���؝�D�牄$��i��$�����|$_t8H��$�H�|$(D�`(���$�A��H��A��D���������H�|$(�€�H��H��$��g���f�H��$�H�|$@I�wPH��I���D�@(A��A��A��A���,�����H��$����H�5�"��HDŽ$�������t���t4���������
�����H��$�H�=o�1��������1����f����H��$��^��H��$��2����H��$�H��$����P(�����������l$x�%����1��Qo�����H��$��1���@H�|$(1�H�D$0���H�D$0M�������H��t(H��$�L�d$(H)�L��H�����/L���L��H��S,H�|$(H�5H�H�V,H�1�������H��$�H����������I� A�l1�L��H�
 H��脝��Q���I�}H���v��Y���H�<$A��1�L�JH�
H�`e������A�������'���H�YV,ATI��hUH��SH�8H��P�oEH���oMH�xH�oU P tL���%���CX����H�CHH��[]A\�f�H�QH�C����AUI��ATA��USH���dH�%(H��$�1��a���H�=H�D$�p��H�\$H�L$D���D$H���B�Ņ���A��tRH�|$�t���H�|$�V�H�D$I�E��H��$�dH3%(��H���[]A\A]�fD�{X�CX����衘�����H�t$H�T$ ��%������H�C0H9D$ ����H�C8H9D$(����H�D$xH�|$H�C@�Lt������T���f.�H�|$�&t��.�������T�����ff.�@��UH��S��H��(dH�%(H�D$1����H�=�
H�D$���H�|$1҉�H�L$�D$���H�|$���s��8���~#H�D$H�E�@XH�T$dH3%(u H��([]�H�|$���H�E�������蛈�ff.���H�GPH��t�f�SH��H�w1�H�H蝞�H�CP[��ATA��UH��1�S�/��H��H��褗�H�M@H�U`H9�t7��H�5�H�=[)�E��H��]HD�A\H��1����f�)�H�5�E��H����A��[HD�]H��A\H�=~
1��o��ff.�@��ATUSH��dH�%(H��$�1�H�H�H��H�D$���H�t$ H��H��路���H�|$H�D$(H9G8uLH�G0H�T$ H��H��H��H��A�ȉ�H��H�� ��A�����	�H��H�� ���D	�9�ts1�����n�H�|$��'�1�H��$�dH3%(�'H��[]A\�f��{n�8�(��H�|$��S���H�|$���1��D����H��H��0�0�	�	�9��o���H�T$xH�G@H9�tlH��H��H)�H)�H9�H��HM�H��~P�X�uJ1��+��H�T$H�|$x��+j`�G��I��H�D$H�x@�6��A��L��H��H��H�=31����@��H�5�	H��脳�t H�|$�D$���D$���f�H�|$��D$�]����D$��貅�f�AW��E��AVAUI��ATI����USH��(H�D$`�$H�\$D�D$L�t$hH�D$dH�%(H�D$1����$L��H��L����]���A�����A���t�t$��D!����u/H�D$I�H�\$dH3%(D����H��([]A\A]A^A_ÐD��D������y��l�H�|$�8u�|$�t-�6��T$D��H�=HH��1����H��A����������	��H�L$D��H�=q	H���Rf�H�=c,H��1�������z��f.���H���t$j���H������H���t$AQE��A��������H���ff.�@��SH��1�H��0dH�%(H�D$(1��ݧ�H9C@toH�C@H�=�H�D$H�D$����H�߉D$�1��H�t$H��H����f��P��1�H�|$�mn��.��H�T$(dH3%(��uH��0[�D1������ff.�@��USH��H��8dH�%(H��$(1�訒�sXH��H��走�����H��$�H���]������1�H��$�H9L$t$H��$(dH3%(��H��8[]�H�4$H��$�H��H��H��H��A�Љ�H��H�� ��A�����	�H��H�� ���D	�9�u�@��@��H��H��@0�@0�	�	�9����i����h�����S���H��dH�%(H�D$1�H���H�H�$u_��uKH��胑�H��H�$H��H�pH�������H���0��H�L$dH3%(udH��[�D�@X������H���x��u4H�<$��t�GX����1��N����Yi�H������1���H�$�X���肁�f�UH��S��H��� i�1҃8t	H����[]�1��9��H)�H��H9���H����[]�H�=P^,�S�y��H�=t
�Eb�H��H��t=H�5.^,H�����'��H�^,H�����Hi��H�^,[�fDH��������[H��],�ff.�f�USH��H��(dH�%(H�D$1�H��],H����H��������H9�t�{0t"H�D$dH3%(��H��([]��H��H����r�H�s H���9��H�5Z],H��S㥛� Hc�H��H��?H��H��H��H)�H9�~�����MbH�s��H�=m	����)�i��)�1�����h���f.����H��\,�8������f.���UH��H�54*SH��H���4e�u�E�H��[]�DH�5�H���	e�u�EH���[]�f�H�5�H����d��1���u��EH���[]�fD����t��uH��)���uH�h�H�R�P�7H�=1�v�ff.���AWAVAUATUS��H��(dH�%(H��$1�����1�H�L$ f�f�T$ f�t$>1�H�ʾD$"H�D$2�D$:�Dr�xH�D$ f��t=HcT$8�J��v0f��H�5�H��HE�H�=�1�����8��@�=1[,�D$��H�T$@�޿肫��iH�D$@L�L$HH��$�H��H����I��H�� H��I����H��E0�1������A	�G	�H�T�$x�1�H�=U1��t��D$�����H�|$�L�-V��qk�L$H��H�D$ ���H�D$L�%�H�D$L�=�H�l$��g�I��H����H�=��#��L��H�5���D$�P��H��I���5��v@I�~(H�����u0I�vL��M���I�~ H�t$����MD��6��xjf�H���xg�� ��T$��u`H�|$ �^���fD��Y,H�j�H��$dH3%(ukH��([]A\A]A^A_�D1���@�D$�fDH�|$ ���D$��t��q�HcT$��H��9�t�L��H�=�1������|�������w����	�@�w�f������6�w��	�@�w����UH���8SH��H��F,H�8H��P�H���@����H�}���H�������C0H�{ H�C�m�H�EH�CH��H�EH��[]�ff.�@��H�G����H�GH9�tCUH��SH��H��H��tH�KF,H��H�:H��R H�EH���?��H�EH��[]�@�ff.�@��H��H�=�c,�8��H�=�c,H���:m�f.���USH��(dH�%(H�D$1�H�=~c,���H��H��H���l�H��H�5`c,�膚�H��HI�H�`W,H9�~VH��x~H���H�=>H��S㥛� H��H��?H��H�Ѻ�MbH��H)�H��������)�i��)�1�荼�H�b,H��b,H�D$dH3%(uH��([]�@�{���H;�V,~��o����y��AWI��AVI��AUA��1�ATUD��S��H��XL�L$dH�%(H�D$H1��H��H�D$A����'�����L�%���t��L�%yH�`LE�A����u��t1�����H�L$HdH3%(��H��X[]A\A]A^A_�1�f�\$ f�D$"H�D$(H�D$0��t^H�T$ �D��1��l�1��D$�φ�L���d�T$��t�H�|$�������D$�:`��T$I������H�
��X�1�H�T$ �D���,l��<����_�I���������H�|$1�L�D$���H�
mL�D$���I1�L��L��L�D$H�=���H�L$L�D$H�A�8#���������A�F����A�6��D��蜤�H�=H��H�D$H�01���Z���tl�������:���1�D��蘿��1��T$蛅�L����b�T$���O����_�H�D$�f���q������������W���������D���)���������^�8H�D$�}H�|$���i�������1�L��H�=2L���]��H�L$H�H�L$������9#�����A�F�����A�6��D���j��H�=�H��H�D$H�01��Y�D��耾�…��V�����������f����f���f�H�D$��D���A�6����L��L��I��H�=~�1����H�t$H�1�������n���fD��^���fDA�A�6��D��茢��L��L��I��H�=z���L��L��H�=�1����H�L$H�1��j���DL��L��H�=��1�����H�t$H�1��B����Pu���AWM��AVI��AUA��ATI��U��SH��L�L$@�����~BH�[@,�8H�8H��PL��H��I�D�kH��H��k0H�{ H�C�xg�I��H��[]A\A]A^A_Ð��H��AQM��E1��[}�H���fD��U��E1�SH����H��H��H�w�dH�%(H�D$1�I��������~H����k0�H�T$dH3%(uH��[]��Jt�f.�SH��E1��H��H��H�w�dH�%(H�D$1�I���n������
��H�D$dH3%(uH��[���s�ff.�USH��H��XH�dH�%(H��$H1�H�l$H�D$H��H�T$H�� ��D$�X���H�s�{I��H�L$L�L$��������u0H���X��H��$HdH3%(��H��X[]���sH�T$ �讠��w��H�sH��$��谘���H��$�H9D$(u�H�L$ H��$�H��H��H��H���lj�H��H�� %������	�H��H�� %�	�9��:�����@��H��H��0�@0�	�	�9�����H�{��H�5��蕽������Z�8���{���Xr����USH��H�H����H�H�{t	H�{胆��C�u{�uGH���O�H�-H=,H�sH�}H��t
H��P H�}H�CH�H��H�@ H��[]���H�{A��1�L���H�
��H�@�躃���H������C�t����H��[]Ð��H��dH�%(H�D$1�H�H�H�$�@����H�xt!H���1��H�D$dH3%(uH���@H��������q�f���H��Y,�@��AVAUATUSH��H�$H��H�$H��dH�%(H��$� 1�H��H��?����X��A��H��H�������%��H�\$0H9�����H��H)ڀ=�M,t3H��D���'������t	��_��H�\$0�eM,H��H)�H�� � � HO�L��$�1�L�����H9�~fA� �H�H9�~SH��H��L��D��H)�H�� IO��^�H��y��W���t��zue������@H��D���v��{��1�H��$� dH3%(u-H�Ġ []A\A]A^Ã�t���zt�1�H�=��п����fo�1�H�=�踿�����H��1�H���詄���x��H���f���V�1҃8&��H���ډ��f.���H��H�1X,H��t\H�5-X,���t0H���
X,H�5X,H�(9,H�=��L�1�H���C��H���
�W,1�H��W,H��W,�1�H�5�W,�rb��^����c�H��W,�5�W,����W,�ff.���UH��SH��H��(dH�%(H�D$1��l�H��H��H�����D$�EH�D$dH3%(uH��([]��m�f.���H�W,SH��H����H�
6,H�1H9���HiA�H�5�V,H��V,�H��V,H���CH��V,H���CH��V,H���CH��V,�CH��V,H���CH��V,H���CH�vV,H���CH�XV,H�C[�f�H�=aV,��H���ɚ;bH�GH�GV,�k���f.�1�H�5'V,��`������Eb��U,�V�H�5�U,H���c���U,� ����H��1�H��U,H��U,���HiA�H9��d�������f���H�G��?uH��H9�u��@1��D��H�H�WH3H3VH	�������U�SH��H��XdH�%(H�D$H1�H��H�����H���kj�H�� u5H��H�����u&1�H�|$����H�L$HdH3%(uH��X[]�f����������k�@������f�����Ҳ�f�������f�������H����uk�GH���O�W�7P�GP�G
P�GP�GP�G
P�G	P�GP�GP�GP�GPD�O1�D�GH�=:�譹�H��h����u(1��t���H�=��H��H��1������#��H�=��b�f���AWAVAUATI��H�=�USH��(H�t$dH�%(H�D$1�蚾�L��D$��h�H��H�����I��H����E1�1�L�u��C@A�4I9�t^I�WH9�tI�W
H9�tI�WH9�u5@��-tL��袎�H��H9�t9H��u�A�<${��A�4$H��tnI�WH9�u���@��}u�H��H9�uȐL���8]�H�t$H���v�H�|$���T�tKH�L$dH3%(��u4H��([]A\A]A^A_�f.�@��}�A����@A��S����i��{��f.�������f���1�H9�����O��t^ATE1�UH��S�DA��D9ev>D��H�U H�@H��H�0H��t��H�}H�H��P H��H��u��f�[]A\��f.�ATUS�G�����H��I��H���fDH�~tH��H�3H��u�I�|$t6[]A\ÐH�H�H�}�GuH��P ���H�E(H�H�u(�I�4$H��t��oA$H�FI�D$H�}�Gu
H�[]A\H�@ ��H�E(H�H�u(닐AWAVAUATUSH���G���M��I���Gf�f��A�_���H*�H�lj��H*��^�f���Z�f/
H��R���"��A9GACGE1��9��r	@���H�
�2,��C�CM�w HC�H�9A�GH�4@H�H���PI�GI�G A�G�PA�W�����C�M��H�@M�l��I�t$H��tI�T$�L����I�$H��u�Sf�H�H��H��P H��t9H�sH�+H��tH�S�L���I�?�Gt�I�G(H�I�_(H��H��u�I��M9��y���A�G��A�GA�M��tH��1,L��H�8H��P H��D��[]A\A]A^A_�fD�
��E1�/��������f�AWAVAUATUSH����H�T$���H��H���Ϳ�H��A��H�G0����H���ЋSA�Dž��	1�sH�C H�RL�,�I�}H���vH��S8���~A�M�uM���HI�~H��u�B@H�xH���I��E��t
H��S8��tqI�H��uًC�����H���a��������{��-��H�C0H��A���A��1�D���sH�C H�RL�,�I�}��E1��W���fDA������H�D$I�FH��[]A\A]A^A_�fD1�sH�C H�RL�4��
DM�6M��t�I�~H��t�H��S8��u�A��t��ؾ�f.�H�C(H��thH�H�S(H�I�fDH�L$H�hH�H�C�m���M�����L����H�D$�CI�mI�E�J���A���C��H�D$I�E�2���H�;�H��P�ff.�@��AWA��AVM��AUATI��H��UH��SH��H�H�L$�PL�-M/,�@I�}H��PD��H�(H���@��CH�L$I�}��CL�s8B�H�K0�C�C��H�4@H�H���PH�C I�$H��[]A\A]A^A_����L�5���H�
����)N�f���USH��H�H����H��C���~��H��@tGH�H��PH�-.,H�s H�}H��t
H��P H�}H�C H�H��H�@ H��[]��fDH�����H�s(H��t�H�;H�.H��P H��H��u�H�H��t��f�H��[]�f���USH���G������H�H�����@t-@��u\�CH�{ 1�H�@H����m�H�CH��[]�����@��t�H�;�Gu!H�s(H��u
�f�H�;H��H�.H��P H��u�H�C(�f���ATI��UH��H��S�U01�uH�E H�RH��H�{H��t
L��U8��tH�H��u�H��[]A\�DH�[H��[]A\�@��AVI��AUI��ATI��UH��H��S�U01�uH�E H�RH�АH�{H��t
L��U8��tH�H��u�[1�]A\A]A^�f.�H�CI�H�C[]I�EA\�A]A^���1�����D�������f���AUATI��UH��H��SH���U01�A��uH�E H�RH��f�H�{H��t
L��U8��tH�H��u�1�H��[]A\A]��H�C�E�m��t�EH���[]A\A]�f�1�H���f�����u�D��1�H��uH�E H�RH�4������ff.�@���G����H�GH����H�HH��t~H�H�HH�
�f.�H�xu,H�H��u�wH��V�W;QtpH�A H�RH��H�xt�H�G��D�GH�A�@�G;AtL�@H�A J��H�HH��u�H�H��u���D�GH�1�H��f�H�G��w����G����SH���Cr�H��*,�H�8H��PH�H�S H�P[Ð��USH���G�������H���Gu�W��u	H��[]�f�1�������u�C��t$1�@��H�߃�H�@H�C H�4����;kr��C븐��SH�H��t+H�H�;�4��H��),H��[H�8H�H�@ ��D[�fD��ATUH��SH��H�� dH�%(H�D$1�L�d$�Dq�H��H�l$��J�H��H�$�fDH�T$H�t$H��膋�H�<$L��H��触�u�H����i�H��蓍�H�D$dH3%(u	H�� []A\��]�D�����t5H�����t$��Љ��t��%���H��1����u��D1��ff.�f���USH�����t?H���g=�H�1�f�����Љ��t
%�����1�H���]��u�H��[]�H��1�[]������t@�V��H�LH��H9�t%���Љ��t�%�����H��1�H9�u��fD1��D�����%���t>H�����t*�����Љ��t��%���H��1����u���1��f.���AWAVAUATI��H�=�USH��HH�t$�H�T$dH�%(H�D$81��`X�(H�D$0H�H��RH�|$0L��H��H�8蚑�H�=��H�EH�EH�E���D$(A�$����H�\$,E1�H�\$�f�A�E���sE�wM��M�<%u�H�}� H��PH���@H�EH�H�]A�<B��<XuA�G�CI��A�A��<{��M�}L���^�H���H��H��L��L)�H�$�œ�:H��I��I���o^�H���H��L��L�h藜�H��I���\~�H�CH�����H���T$,M��t<H�t$L���j��o�T$,���cH�C�H��9��Q����H�������S�pH�}H�F�H9��K��H��PH�SH�CH��RD�,$E�uM��M�A�E�������H�|$(�$E��IH�D$H�(1�H�L$8dH3%(�&H��H[]A\A]A^A_��L���`}�H�CH�����H���D���@A�G�CI��A��\����H�D$H�5H�H�0H�}�8��H�T$H�|$(H��vD��L��H�\$H�;�1a�H�H�D$0H��ttH�H�|$0�P������-����1�L��H�=1�1��}�H��H�D$H�0��H�D$H�5��H�0�k���1�L��H�=@���1�L��H�=��봃������Y�鬳�ff.���ATUSH�_H��t(I��H��f�H�CH�{H��L��P H�H��u�[]A\�f���SH�_H��t'f�H�CH�{1��P��c�H�CH�{�PH�H��u�[�f���AWAVAUATI��USH��H��hL�H�O dH�%(H�D$X1�M���GL��1�f�H�PH��R9�HB�H��u�H����I�D$E1�1��0H�D$H�D$@���@��%�8M������I�GI�t$ I��P(A�GI�t$ �������A�G����������L�t$f�I��1�H��",L�k�D$A�F<L��AFE��AFAF,H�D$H�D$ ����誕�H��L�����H�CL9�w�$@H���8b�H�CL9�vH�H�p��|�=t�M�t$�}M�?I�<.�:Z�H������A��E)�A�mA�4.I��@�����H�D$XdH3%(��H��h[]A\A]A^A_�H���({�M�t$붐H����S��fDL�kH����S�H�KD��H9���H�;�<70��D���f��<0u2�BH��H9�w�E���A��D)�D�H9�HE�H���ґ�����DD)���H�V�I�<$H������H9��Ѱ�H��PM�|$I�D$ ����H������鮰�f�D��H���1����U�ff.�@��SH�H�H���	T�H�H��tH�H��[H�@��@[�ff.���H��H�?H�H�H��tH��`��f.�D��H��@��H����H�H��8�H�H��0�FH�H��(�FH�H�� �FH�H���FH�H���FH�H���FH��F���H�E,ATUSH�H��t%I��H�h�
H��H�]�H��tH�;L���m�u�H��[]A\�ff.����UH��SH��8dH�%(H�E�1�H������H��H��t	H�����CI��H��H��H��H��H���I)�L��H9�tH��H��$�H9�u�%�uWH�M�H��H�U�H�u�SH�u�H�U�H��H��hH��HD�S H�M�H��H��S(H�E�dH3%(uH�]����H)�H�L���S�L�F�H�
r�1��8H�5#�H�=%��6����AUATUSH��H�����oH��I��I���X�H��H���
n�sH��H���υ�L��L��H��H���n��H��H��[]A\A]�H�i,SH��H������w��H�8H���zv�H�C(H�{ H�C �C[�p��~�ff.�AWf�f��AVAUATUH��S��H��(D�edH�%(H�D$1���H*�H��D���H*��^�f���Z�f/
��v�
��/�������9ECE��A9�r�������oU H��E1�L�m )$����H�4$H�L$1�H�FH��D�x���tbI��H�H�H��t(f��C1�L��L�#�u���2�H�H�H�L��M��u�M9�t%H�4$H�L$1�I��H�FH��L9�w�鄭�DH���h5�H�D$dH3%(uH��([]A\A]A^A_��Q�@��AWA���HAVI��AUI��ATM��U��SH��H��,H�8H��P����@H�=K�H�ø�B�D�{L�s0�kL�k8L�c@�6M�sH��H�C���H��H��[]A\A]A^A_�D��SH�H�H�{ �4�H�CH��t
H�H�{�PH�,H��[H�8H�H�@ ��ff.���SH��H� �O4�sH���d���H�{H��P0�H�C[�f.���AVI��AUATI��H��USA�T$01�I�t$ I�L$(��A�t$H�FH��1�H��H9����H��H�H�H��u�<@H�H��t09ku�L�kI�T$@L��L��A�T$8��t�[L��]A\A]A^��E1�[]L��A\A]A^��H�:H��tCH�BH��t;pu
�9ptH�H�AH��u�1��@H�H�H��H�Q�f�H���r��1�L�O L�G(�wI�AH��1�I��H9����L��I�J�H�AH��t";pu�*f.�9ptH�H�AH��u�1�H����H�H�H��H�QH���ff.�f���AUATA��USH��H����H�kH��tYH�EL�m1�L��H�CH�E�S�Y�D�eD��1�H�{ �s���.�H�H�UH�(L��H��[]A\A]�fDH�{�sH�H���PH��L�h�fD��SH��H���S0H��[��������AUI��ATI��H��USH��A�T$01�I�|$ ��A�t$���.�H�0H������H���fDH�H�3H������9nu�H��I�T$@L��A�T$8��t�H�L��1�H�H�I�T$H�A�,$I�D$H��[]A\A]�����U1�H��SH��H���F�wH�� ���}-�H�H���=��H�MH9�u�fDH��H�H�����H9�u�H��H�H�H�CH�H�K�+H�UH��[]�f.�����f���E�A�� A��AH��tO1�A��
����D�Q0��	E�	D��AGȈG���D�Q0��	E�	D��AGȈLGH��H9�u��ff.�f���USH��H��H��x/H��H�|6聃�H��H��1�H��I���^���A�[H��L��[]�H��A��1�H�5|�H�=���L/�ff.����USH��H��H��x2H��H�|6���H��H��H��I�����A�[H��L��[]�H��A��(1�H�5	�H�=���.�f���UH��H�4SH��H���~�H��H��H��[1�H��]�����������UH��SH��H���1���0���E�PЀ�	w>��0	�H��H���o��E��tb�PЀ�	vʍP���w*���E��W�P����	vP���w%��W	��fD�P���w0���7���D�P���w��7	�닐H��1�[]��H�������[]�1�Ð���B���t+D��A������
D�I7�Q0ACу�H��B����u��f�����tx�F�L�T1��@���0Hc�H�H��L9�t.�H���JЀ�	v܍J���wD��H��A��7Ic�H�L9�u��@�J���wD��A��WMc�L���1��f.���UH��AWI��AVI��AUI��ATSH��(dH�%(H�E�1��AH��H��H��H��H��H��H���H)�H��H9�tH��H��$�H9�u����H��H��H��H��H��H���H)�H��H9�tH��H��$�H9�u�%��sA�EH��I��H��H��H��H��H���H)�H��H9�tH��H��$�H9�u�%�t	H)�H�L�A�}P�(M���A�EL9�s*H�u�L��A�UL��H�u�L��A�U H��L��A�U(E�}H��L��H���2h�A�MJ�<;1�H�ʉM�L)�H�M��S�H�M�H��L��H���h�D�E�1�A�H�E��u�H�Ѐ46H�PA�4\H9�u�L��A�UL��A�UH��A�U I��PL��A�UA�UL��L��A�U A�U1�H���q�A�U1�L���~q�H�E�dH3%(u+H�e�[A\A]A^A_]�H)�H�L��J���H)�H�L������G�L�(�H�
Y�1��H�5e�H�=��*����ATUH��SH���H��L��P�P(H���H��L��P�P H���H��[L��]A\H�@(�����AWAVAUATUSH���dH�%(H��$�1�H���٢�H��H����I��H����H��I��M��H��u	M����D�kL�L$�RK�H��L��L�l$�Ra�H��L��H��L��I���Θ�M��uI�S1�L���x�L��H���{�L��H��$�dH3%(u6H���[]A\A]A^A_�f�L�L$H��$�L��L��L��P �� F�L��H�
��1��HH�5��H�=���)�L���H�
��1��IH�5��H�=]���(���L�AH�	�p0���AUI��ATI��UH��H��SH��H���C�H��H��L��[L��H��I��]A\A]�00���UH��AWAVAUI��ATSH��H�EH�] L��P���H��H���dH�%(H�E�1�H���q��H��A�U���)�H9��2��I�ω�I��H�QH��H��H��I��I���M)�M��L9�tH��H��$�L9�u�%�u8H��I��H��@���H��H��H%�I)�L��H9�t"H��H��$���H)�H�L��D���hI��H��u4H��t/L���H�
�1��sH�5=�H�=��o'��H��P���uH�}�*M���qM���hH��H����2H���)H����H��P�����H�D�1�L��p���L��0���H��H��L��L�牅<���H��X������L��0���L��L��H�����L��Q H��@���L���7x�H��X������	A�UH��L��A�L�� ���H��@���ƅo���H9�L��HF�H��X���荕�H��o���H��0����DDA�UH��L��L��H��@���D��o���H9�HF�H��X����J��H�E�A�UL��L��P H�E�H�UL��H��P����P H�E��L��H��0����P A�U1�L���N�L��L���Uw�H��X���H��H���L����o�H+�X�����D;�<�����A�����G���A�UH��@���1��
l�A�U1�L���k�H�E�dH3%(uBH�e�[A\A]A^A_]ÐH�A,H��P����:���DH�5),����H)�H�L�����	B�L�Q�H�
��1��tH�5��H�=n}�%�L�b�H�
{�1��wH�5��H�=F}��$�L��H�
S�1��vH�5�H�=}�$���H��`�H��`H���FH��`H���FH��`H���FH��h�FH��hH���FH��hH���FH��hH���FH��p�FH��pH���F	H��pH���F
H��pH���FH��x�FH��xH���F
H��xH���FH��xH���FH�G�FH�GH���FH�GH���FH�GH���FH�G�FH�GH���FH�GH���FH�GH���FH�G �FH�G H���FH�G H���FH�G H���FH�G(�FH�G(H���FH�G(H���FH�G(H���F�ff.�����H��`�F��H�H�H��`�F��H�H�H��`�V��H�H��`�VH��h�F��H�H�H��h�F��H�H�H��h�V��H�H��h�VH��p�F	��H�H�H��p�F
��H�H�H��p�V��H�H��p�VH��x�F
��H�H�H��x�F��H�H�H��x�V��H�H��x�VH�W�F��H�H�H�W�F��H�H�H�G�V��H�H�G�VH�W�F��H�H�H�W�F��H�H�H�G�V��H�H�G�VH�W �F��H�H�H�W �F��H�H�H�G �V��H�H�G �VH�W(�F��H�H�H�W(�F��H�H�H�G(�V��H�H�G(H�@HLJP@H�GHLJX����AVAUATU1�SH��@H�dH�%(H�D$81�H�����;~���CI��L�k</�������/L��L�5R��@�H��H��tL��H��L�s��~�I��H��L���%|�Ń���̙�tFH�|$ H����A�>uB��D�1�I�$�H�T$8dH3%(��umH��@[]A\A]A^Ð�������f�1�L��H�5�Q1��a�1�I�$�DH�=c2M����{H���s���L�s�j������������<�ff.����H��H�|$H�|$�:�H�D$H���ff.�@��H��H��t�?~u
�W��t'��/t
H���fDH�w1�H��1���`��H��H���f�ATI�� UH��SH�?H��PL�`H�uH��H������H�V�H9��n��H�}H��PH�CH�E H�CH�H��tH�XH�] []A\��H�]H�] []A\���AUATUSH��@�����I��H��H�=����7�(I��H�L��PL��H�XH��H��H��L� �X�$���H��H��[]A\A]�fD��L�G I�HH9���H��D�OE��t;1��f.�I�H��H��H;�tH������M�HI�у�;Gr�L�G I�H��thH�y����W1���u�Gf���;Gs=L�A��I�<�u�L�A��M�@M��L�AM��L�AM�@M��L�AM��;Gr�H�	H��u�H���:���f.��ff.�@��H��H�?H�H�H��tH��`��f.�D��USH��H�L,H�5�#,dH�%(H��$1�H�;H��t	H��P H�;H�5R#,H�O#,H��tH��P H�=]�H�*#,���H��H�����;����H��H�5X��K�H��H����7�H9�����H��轀�H��,H��",H��.�H���H�=�",Hc�1��3�H��,H��",H�H��$dH3%(u3H��[]�@H��H��踄����Ƅ$��B�����8�ff.���SH�5D",H��,H�;H��t	H��P H�;H�5",H�",H��tH��P H��!,[�f���H��!,H��t��SH�=M��{�H��tH����[H��!,�DH��,H�;�S�H��tH�H��u�H���f.�D��H��H�A,H��H�V�H�8H������H9����H�H�@H�������H��L�B�H��,H������H�I9��Ҕ�H�H��tL�A(H��H��H��H��H��A���H�IH��H��H������H��,H��H�8��l�f.���H��,H��H��H�8�WZ����H�e,H��H�8�&�f.���H�E,H��H��H�8�w�����H��H�����H�,H��H��H�8H����e�fD��H���H�t$(H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�H��H��H�D$H�D$ H�D$H�m,�$H�8�D$0���H�L$dH3%(uH�����5�f���H�%,H��H��H�8�����USH��H���H�t$8H�T$@H�L$HL�D$PL�L$X��t:)D$`)L$p)�$�)�$�)�$�)�$�)�$�)�$�dH�%(H�D$(1�H���͒�H��$H�=a��D$H�D$H�D$0�D$0H�D$ ���H�T$H�t$H�߉D$�j�H�|$H���J<�H�3,H�t$H�8H�V�H������H9��C��H��PH�T$H��H��H���kT�H�|$�q��
��H�L$(dH3%(H��u
H���[]��4��USH��H�,H��t��8"tH��[]�DH�-�,H�}�8w�H��v*H��,H��H��H����H��,H��[]��H��,�����fDUSH��H��,H��t��8"tH��[]�DH�-Y,H�}�v�H��v*H�C,H��H��H����H�>,H��[]��H�,�����fD��SH�5,H���+H�;H��t	H��P H�;H�5�,H��,H��tH��P H��,[�f���AUI��ATI��USH��dH�%(H�D$1�H�����H���s���I��L��L��H�
s,H�|,�i���"t�H�<$�u���ƒ���	ƒ����H�L$dH3%(��uH��[]A\A]��2�ff.�f���AUA��ATI��USH��dH�%(H�D$1�H�����H������I��L��D��H�
�,H��,�1���"t�H�<$�u	1҅����H�L$dH3%(��uH��[]A\A]���1�f���AUI��ATI��USH��dH�%(H�D$1�H���d��H�����I��L��L��H�
,H�$,�{���"t�H�<$�u	1҅����H�L$dH3%(��uH��[]A\A]��I1�f���AUA��ATI��USH��dH�%(H�D$1�H������H������I��L��D��H�
{,H��,��g���"t�H�<$�u	1҅����H�L$dH3%(��uH��[]A\A]��0�f����ff.����ff.���H� t%H�(t0H�/�+H��H�G�f�H�����H�(H�G u�H�����H�G(�Ð��H������Í��H���@��S����΍�P�H������u
1��W H��S(1�[Ð��ATUH��SH�G8H��t,H�L�`I�L9�tDH�{�H��I9�u�H�}8�P�H��+H�uH�;H��t	H��P H�;H�uH�EH��t	H��P H�;H�EH�H��[]H�@ A\��f���@���g D���g0f���ATI��UH��SH��H�8H��t&H�s@�a�H�S@1�H���O:�L� H�h[]A\�H�)�+� H��H�8�BR�H�C@�H��H�C8�ff.����H��L�_8L�W@1�I�CM�I������I;1tKD�@��I����H��L9��Y��H�PH��H��I9t	�u�I��H��L��L��H����i�1������USH��H��H��H����[�H�sH��H��tH�E�+H�8H��P H�kH��[]Ð��H���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�H���$H�D$H�D$ H�D$�D$0�=�H�D$dH3%(uH�����;-�ff.���ATUH��SH�����I��H��t�C��u&H��t�E��uJA�$H�t�[]A\�fDA�$H����A�$��߅�t0[H��]1�H�=-�A\�L{�@A�$H���N�A�$��߅�u�[H��]A\�D��H�w����H�GH��t�f�H�1�+H��D��ATUSH��H��<]�H�{賅�H�{I��觅� H= vJH�{�qK�H�sH�{�-�H�{L����VK�H�{�Y��"��H�M�Hc�H�>��H�{�G��H���f�H�{��H�H�s(H�C �[]A\��@H�{�H�H�s(H�C �[]A\��@�C0H�{�H�H�{�ZK��t΅�tQH�s(H�C 1�[]A\��H�C�@�X���C0[]A\�f�H�C�@�q���C0H�{[]A\�1H�f�C0��D��USH��H��H���J�Ņ�~D�{1�C0uH�{�GuPH�{taH����[]�H�s(�1��S H����[]�f�t�H�s(��S H����[]�f�H���(���H����[]��I��H�
����jH�5��D�H�CH���,��s���ff.����USH��H��t\H��H��tTH���Gu@H���R�H���`$�H�I�+�8H�8H��P�H�XH�hH��[]�fD�Ft��<��L��H�
��1��vH�5o�H�=:e���ff.�f���SH���q��H� H���;��H��GtZH�{�Gt H�{�G���[���I��H�
����H�5��C�H�CH��[�+��H��H�5����g��ff.�@��H��H������H�GH���fD��H��H������H�GH���fD��H��H�����H�w H�W(H���f���H��H��������,���H���ff.���SH���1��H��H�H��t�q��H�{[�WE����SH���Q��H�H��t������H�������~[�@H�����H�{��H�{��	�H�'�+H��[H�8H�H�@ �����H��dH�%(H�T$1�H������H��H�?H�<$H��t.H��t�H�$H�x��H�$H�x�z	�H����h�H�D$dH3%(uH����X'�����G0����USH��H������H�H��H��tH�wH���'�H�CH�{H���$<�H�{H��H��[]�br�f���H���+H�0��/�f.���H�����V��H��H�
s�H�V H�@�4�1�H������H�����7��H��H�
C�H�V H�@�4��H����ff.�f���AVAUATUSH�����H��H������I��H�����I��H�����H�`�+I���(H�8H��PL��L��H����)�L��H��H���)�H�;H��H�5���H�C�=1�H�{H��H�5/����*1��CH��[]A\A]A^����SH������H�H������H���r�H�;[��r�f���H��H������H�wH�W H���f���H��H������t��u"H�H���y-�f�H�?H���d-�lH�=���C���H��H������t��u"H�H���IZ�f�H�?H���4Z�wH�=�������H��H���X��G���M���GH���f���H��tWSH�H��tH��C���=����Ct[�f�H����e�H�{��e�H���+H��[H�8H�H�@ ����ff.�@��SH�����H��H�?���H�{[���ff.�f�����uH�?���u	H����P��H�=�������SH���Ӆ�H��H�?�'@�H�{[�@�f.�AUI��ATA��UH��SH��H��(H�:D��dH�%(H�D$1�H��H�|$H�D$�}5�H�|$D��H��I�E��DU�H�|$H��'�H�|$��H�D$dH3%(uH��([]A\A]��"�ff.�f�AT�"A��UH��SH�ĀdH�%(H�D$x1�H��H�t$PH���e�H���+H�5��H�ߋHH�1���\�Et5�} H�������I�F�A��H�������:��F� H����F�H�}H�T$H�4$�" �H�D$xdH3%(u	H��[]A\��4"�@AUI��ATI��/USH�_H��H��(dH�%(H�D$1��/%�H��t"1�H�L$dH3%(��uxH��([]A\A]�1�H�L$H�T$H����x�f�|$t�H�|$H�T$H�t$�tU�u^�t$H�|$1���Ń��tL��L��H�މ������v����i!�H�|$�\$�~��H�=a�H��1��q��J����ǃ��X�H�t$H�=ԠH��1��q��%���ff.�f����w���W u�H�9�+SH���H�8�;�H�C[�f���SH��H��_�H�{[�u�D��H���sAUATUSH��H��H���I��H���p	�H�{�wQ�C����{!�ZH�{H����1�A��f.�I��L9�t0C�|,�
u�L��H)�L���C��H�{L��I��L9�u�H9��A�|,�
�C!�M�H�{��?��2H��[]A\A]�H�0��H�{1���*�H�{H��L��I�L����M����H��
L���/3�H��t:L)�H��H)�I��H��CtH�����H�CH�{H�PH��t��@H�{H�GH�H=�v}E1�1��fD���H���;���H�{L�������������H���������fDH��H)�L���H�{�����H�{�����H��L���K�H�{���H�{�A�H�{H����H��H�=fYH��1���n�XH��[]A\A]���@L�������AVI��H��AUI��ATI��H�=}�USH�� dH�%(H�D$1���l��AH��H��1��_�D$�������L��H�=:�1��l��AH��I��1���^����*��I�>I�E�H��T$H�|$H�D$��/�H�|$��L��I��1��O�H�|$I�E��H�|$��H�L$dH3%(��u
H�� []A\A]A^��j�f.���AT�I��UH��SH��H�=��H��H��dH�%(H��$�1������u;H��H�������t,��H��$�dH3%(��H�Ġ[]A\�fDH��H�޿�pB�xXH�%�+H�=,�H�0��E�
X,H��H�n�+H�=�D�AH�
H��1�D�4,�k�L��H��H���)��k�������t��
u������P����T�1�H��H�=���l���2���ff.���AUI���H�=t�ATI��UH��L��SH�������u'H��L��������t����H����[]A\A]�fD���AL��1��\����k~�L��H��L�������1�H����[]A\A]�f.���ATI��USH��H�� dH�%(H�D$1�H��tqH�>H���L��H�|$�[�H�|$H�E�C��H��t*H�;�L��H�|$�`�H�|$H���L���d�H�D$dH3%(u5H�� []A\�H��t�H�:L��H�|$�n`�H�|$H��a�����f.���H���1��f���U1�A�+L�J�SH�
ĴH��H�H�H��8H���,�H��0���H�-��+H���H�}H��t
H��P H�}H��(Hǃ�H��tH��P Hǃ(H��[]�ff.���H��H�|$H�|$��H���@ATI��USH��H��H�� H��dH�%(H�D$1�H��H)��]�H��H��Hǃ��N�H��H�$��H�4$H����Q�A�$��vb��u5H�<$�G������H�<$H���/:�H��H�5űH��H��1��^�H���d��H�T$dH3%(uH��[]A\Å���{�1�����ff.�@��UH��SH��H��(dH�%(H�D$1����t�Fu8���H���H���8P�H�L$dH3%(��H��([]�DH����0����H�T$�H���u:�~aH�UH�t$H9��({�H��H���H9�uZH;�uQH���y[�H�E�M H��H+� H���1��]���DH��u������+���f�H�t$H������‹D$��������H��H�EH��H�� �6@�H�t$�k��������ATI��UH��SH����8���uDH��0H�GH9���]z�H��H��H���"�H��0H�@H���1�[]A\�D�[%�xL�1�H9�@s�H��@[]A\���H��81�A��L���H�
��H��������(�������ATUSH��H�$H��H�$H��H�_dH�%(H��$ 1�H��0��y�H���+� 1�I��H�8�1�H���H��0u#�]H�H��H��0L���sC�H9��v<��8H�� L����_�H��~H���H��H)�H9�s�H����uTH��8A�j1�L���H�
1�H�����'�1�ǃ�����H��$ dH34%(uBH�� []A\�H���H�����H�=h�H��H��1���e��ǃ���o�ff.�@AWAVAUATUH��SH����t\I��A��H�^E1�E1�H�s���8H��F<�x:H�A��H��H��I�E9�u�L��L�@H��[]A\A]A^A_�1�E1���H���H���H��H�T$�=
�H�T$H�=��H��1��e�H�����xdE9�sJA�F�D��D)�H��H�H��H��L�M�dH�SH�3H��H��0�A�H�C�H��I�L9�uր�<L���N����w�H���@���ff.���AWI��AVA��AUATUSH��H��(dH�%(H�D$1����H��tH�t$�������A��8���I��8E1�1�H�D$E���*f.�I��0H�SH�GH�I;��aA��<�SAƇ<���ql�I���I��H��H�4$��H�4$L��H���|@����L�タ�����L��A��8����G�p�@H�5ªH���,^���I��0A��8H�PH�0�
:��'A��8I��0A���I��0H�@I��@�f��A��8��!v�D��H��L��)��8���I��DH�L$dH3%(L����H��([]A\A]A^A_�A�AH�|$H��L���1�H�
���S$�H�SI��0�H�3��H���Q?�H�C�I��I�A9��Z����u���DD��H��L�����I���Z���I������N����)�H�=z�H��1��(b�H�SI��0�L����H�=��H��1��b�A�F�3�����f���AWA���HAVI��AUI��ATUH��SH��L�%��+I�<$H��PL��H�À��H����H���H�J���H���H�����H���H�^���H�CxH�c���H�C �ZX�D��I�<$� H���L���+�1������H��H��0ǃ8������H��I���X�H��(�}u/L��H�=ɨ1��._�L��H���#�H��L��[]A\A]A^A_ÐL��H��H�=��1��^�L��H����"���ff.�@�����
�f���H�%�����AWI��AVL�5�$AUATI��USH��8dH�%(H�D$(1�H�H�XH��(�>�H��H���+�Et4L����H��H�L$(dH3%(��H��8[]A\A]A^A_�fDH���X�H��L�� H�D$H��H�H�$��'�����D$����H�|$L���Q��L��H+4$Ht$H��H�D$ �R�H��H�|$ L)��D�H�|$ H�����H����/�H���L��H�=]�H��1��]�H��H����H�����������H�= �1��R]�H��I��H������D��8A���tjH��8L����H���D��L��L��@H��1�H�=���\�H��H��������fD���H�5~��81����H��� ���H��0H�pH�8�`�H���L��H�=|�H��H��0H�H1��\�H��H����H��0H�5��H�����Hǃ0�����
�f�AWE1�AVAUATUSH��L�7L;6��H��A��I��H���bj�A�6H�H��Dqtp��0E�M��UH�H�QH�I;$so�qH�H��Dqt^1��f�I9$vRA�pH�H��Dqt@D�E��C���TJЉUL�I�PH�D9�|�A�H��D��[]A\A]A^A_��A�������AWf�AVAUATUSH�7H��xdH�%(H�D$h1�L�|$)D$ H�|$A)G A)G0A)G@H�\$H9���H��I��I��M���]i��UH�0H��DVtt��0�D$4H�EH��H�D$�	fDH��H9�tP�H��DNtC�L$4���JH�PD�A�H�T$D�D$4H9�u�A��k~���L$4H9�v
�x-t,@1�H�|$hdH3<%(�H��x[]A\A]A^A_�H�PH�T$H9�v��HH��DNt���0H�H�T$0H�L$H9�v��xH���D~t���H�x�TQ�H�|$�T$0H9�v��x-�v���H�PH�T$H9��d����H�DN�U����I�H�P�L$,H�T$H9��<����x�D~�-������TOЉT$,H�PH�T$H9������P��߀�T����H�PH�T$H9�����HH��DN������0H�H	�T$(H�L$H9������x	�D~��������TWЉT$(H�P
H�T$H9�������x
:�����H�PH�T$H9��{����HH��DN�i�����0H�H�T$$H�L$H9��P����x�D~�A������TWЉT$$H�P
H�T$H9��$����x
:����H�PH�T$H9������HH��DN�������0H�H�T$ H�L$H9������x�D~�������TWЉT$ H�PH�T$H9�������x.��H�PH�T$H9�������P�DV�����H�PH�T$H9��t����H�DN�yH����
H���DNt
H��H�D$H9�u��D$�D$H9��+����<-�N��<+�
���H��I�oH�L$L��H�T$H���3���������|$����H�D$H;D$�����8:�����H��H�L$H��L���H�D$�����������|$;�����kD$<D$�ÉD$XH�D$H9D$�n���I��D$@������H����S����T$XfoL$ foT$0fo\$@A�Uk�<H�L$PAAVHc�A^ H)�I�N0I�$��
���<Zt<z�����H���H�T$�^����D$�D$����������f���H��HI��H��dH�%(H�D$81�H��H�����H�L$8dH3%(uH��H���ff.�f���H��I��dH�%(H�D$1�H���m���H�T$dH3%(uH����C���SH���H�������t*��+��xV�Ⱥ����H�=����k�<)�1��U�{�KP�D�K�W�{D�CP1���lH�=X��cU�ZY[���پ-�ff.�@��SH��H�|$H�|$����H�t$H��H���Y�H�߉����H��[����H������H��H��tH���+H�8H��` @�ff.�@��H���HLJxHLJp�ff.���U@��H��SH��H���W`�������xH���1�H���t	H�E�H����[]�ff.�@ATUH��SH��H��@H9�p���|2�
L�f�LE��������	Ȉ��H9�HtwH���H����H���H��pL9�rx�['�H��pH���H;�xH��H)�H��pH��H�H���[]A\�fDI��1��t���fDL9�Pv�B�"H��pH��HH���L��H)�H�@��1�H����j���f.�1���H����A���DH���+�H�8�$+�H��H�������D��� tH��xH9�pt	���u1�����ATI��USH��H���H��t�5���|H��P�03�H��M��tH��HH����g�L��H���#�H���tH�����H��HH��PH��H��H��@H�E���� ��H���[]A\�@H����^�H��PH��HL���^��H���f���UH��SH��H��H�GH�pH��tH�|�+H�8H��P H�CH�@H��H�[�kJ�H�CH��[]����f.�H���H��tH�WH�BH��t��fDH������ATUH��SH���H��H��tnH��t"H�H;Nu�NfDH�H;Ht?H��H��u�H���+� H�8H��PH���H�I��H�x��O�L��[]A\�@I��[]L��A\�DH���H��tH�x[]A\H�Gx��fD���tI��H��xH9�pt���e�H�����"�H�=��H��1��
��f.���H�����H��C���H��#����H�G���Ð��UH��SH��H��H�������pe�H�S������e���E�����C��	ЈCH��[]�ff.�����O��u�;�G��tH�WH�BH��uH���H��u���	V�f����G H�ޛH���HD�Ð��1��T�D��H��t'SH��H����C�K��u�C [Ð�ff.�@��@��u�fDH����T'�@��H�GH��`���H��C����H��XH���H��t	���@�ff.�@��1�f.�H�WH��XH���H9�HB�H��u�Ð��H�W���6�����	�@����ff.�����������H�W�����	Ȉ��H�GH���H��u��f���ATA�������A��U@��SE�H����C��D	�CH�C������t9�t������H�C���H���H��u�[]A\�fD��SH�H��tSH�H�����H�CH��tH��[��DH�{t	H�{���H�{����H��+H��[H�8H�H�@ ��[�ff.���H�H����UH��SH��H�X�;~&H��������b�H�EH��[]��H����L��H������}b�H����4�H������H������H�EH��[]�D����USH��H�H��t.H��H�{1���C�K��u�C H��H��[]���H��[]�f���H�G�o���ff.����SH���H��t.H�����HǃHHǃP[�f.�H��HH��t�H�}�+H�8H��P HǃH����SH�����H���[���fD��H�GL��xH��pL��H)�H9�s7H�L��pHH�����L)�H�H�Ou7H�H�HP1�H���fDH7H�pH��p���t	H;�xt�@HǀxH��Hǀp����f���SL�H�_I9�wgH���H��t9H�@���9��t�G����H�B;��u.H���H��u�L)����H���H��u6���[�DH�����H�Gu8�g�1�H��SPH���H��t�H�P������H�H���[�@�O [�f.���H�����AVAUATUH��SH�_H�G���g�H���H��tH����>�H��xH��pH���I��I)�H9���Hǃ�H��SHH��pI��H��xH��H)�L9���_�I����M����I�����M����_�H9��,_�M�L9��8`�H���+�o���E��t�M H���H����H�P������H�H����&@���H�X;����H���H��t
H��Ht�[L��]A\A]A^��I��H��xHǃ�I)�����H9��\����^�f����L��[]A\A]A^�D�E�3�����^�f�D�uE��u�E �_�L9�������^���M �O��D�0�����O I������0��U�L��[]A\A]A^�L�ЕH�
��1��{H�5�SH�=�4�g�����UH��SH��H�_H���H��xH9�pt8H��SxH���H���P�H��~H���H�D$����H�D$H��[]ÐH��u���f���ATUSH���H��H9���H��L����Bf�L�����H��xH+�pt0H��H+��H9�sH��L������H���H9�w�[]A\�D�����u�D���H��H��1�H���H�5�A��A���=�ǃ�[]A\�H������H�=��H��1�������H�����SH�_H�Gu5�gߺH��SPH���H��tH�P������H�H���[Ã��[����H�����SH�_H�Gu4H�CXH��t+H���H���H��tH�P������H�H���[Ð���[����H�����AUA�����ATUSH��H�_H�Gu"I��H��@��H��S`��xH�èE1�H�]H��D��[]A\A]�A�L$ ����H�O�����I�����L�Gu#S@��H��H��Qh��x	[���K [�f��ff.�@��H�f�H�WH���H��H��u�����USH��H�_H��pH��xH9�sOH��@H)��
H��	�H��tH)�H��H��H��[]�O��H��H��[]��f.�H��1�[]����H�G������ff.�f���L�GM��pM��xL��M9�r�@H��Hu���H�B;��u<H���H��u�M)�L�I��pI�@�H���+H�H��fDH��G��uIǀxIǀp�g�H�y�+H��D��AUI��H��ATI��U�SH��H����I�EH�;uL����K�H��L������I�EH����[]A\A]�ff.����ATUSH��H�_dH�%(H�D$1�H��H��pH)�xH��HǃpH����u�H��xH��@H�$H9�skI��H��xI)�I�����H���H����H�P������H�H���H�L$dH3%(L����H��[]A\�DM��~WH�����J�H���H��I�ċG�������W��߃� 	Ј����H��xH��@H�$H9�s�I����K���H9��+���H��xM���2���I�������� ���������������X�f�����'������ff.�@��H��dH�%(H�D$1�H����H�$H�T$dH3%(uH�������f���SH���%�H��u
�S��������[����SH���s%�H��tH���P�[��ÐH���x��H���P�[���ff.���ATUSH��H���m?�H��H��uRH���=��H���tOH��t?H���u�L�#H���%�H�{H�5&�H��L��1��y7�����i�K �CiH��[]A\�H�{[]A\�{�ff.���ATUSH��H��H���dH�%(H�D$1�H������H��@�����XH�$�o���oH���oP ���oX0���o`@���ohP���op`��oxp��o���(@��u$1�H�L$dH3%(��H��[]A\�D���u�Hǃ��������t�H���H���t&H����D���1���������L���H���f�H���h#�H��H�����H���u��H���H����1V�����F���H���L��H��H����3�H����m���H����@���������������@��H�WH��pH��xH9�s%H��HtH)�H�H��pH�H�fDH�1��fD��AWE1�AVI��AUI��ATI��UH��SH���L��H����I�EM94$wH���{��H��H��~#A����H��[]A\A]A^A_�@L��H���e�I�EH���tj�UH��u"1����BU�H��[]A\A]A^A_���� tD��H����[]��A\A]��A^A_Ð�U���������T�H��[]A\A]A^A_É��g���f.���AVAUI��H��ATI��UH��SH��L�w��I�EH9+rH�+�[]A\A]A^�f�I��h1�H��L��L���	B����T�IdžhH9+r�H�+[]A\A]A^�@��SH��H���H��uLH��xH��pH��H)�H9�tH��HH��d*�H��xH+�pH��xHǃp[�f�����=T����USH��H��H��`H�xH��PH9�vH���0�H��PH����~5�H���T�H��PH9�wH9�r#H��PH��[]�fDH��H��PH9�s�H��H��H��[]����ATUSH���T�H��PH��xH��H9���S�I��H��H)�H9�sIH��p��H���H��t���vH��PH����H���5�H��PH��xH��hH��u"H)�H��I�,$��H��H�[]A\�f�H��pH��H)�H9�w�H��H)�H9�wI�$1�[]A\�@H�,�f.�H����44�H9�r?H��hH��PH��xH���o�����1�H���v����S��� H���3��벐��AUI��ATI��USH��H��H��pHLJp�"��H��pH��t&��u"H��L��L��H��[]A\A]���f.�H��[]A\A]�D��AUATUH��SH��H��dH�%(H�D$1�I��L�����H9,$r+H��xH�HH�L$dH3%(uNH��[]A\A]�f�H��xL��PH��-�L��H��H��P���L��H��H���J��H9,$s��R�����f.���H���t:SH��H�������HǃPHǃ@HǃH[������ATI��USH��H��H��H�odH�%(H�D$1�H��H�����1�H9$r%H��xH��H�HL����	�H�x�H�L$dH3%(u	H��[]A\������H�OH���H��t5H���H��8H���*Q�H�JH���H��u�H��H���H�����@��u�fDH���W��H�@H��8H��tH������fD���H���ff.����UH��SH��H��H�����H�{H�GpH��t	H���H�{H���H��u�H��[]����H�ʹ+H�0�m4�ff.�f���UH��SH����H��H�@H��8�LP�H��8H�C���u
H��[]�fDH�����H�C����H��[]�ff.���UH��SH���.��H��H�@H9�8�P�H����tH�C���H�CHǀ8H��[]�ff.�f���SH���H��H��pH��H)�H9�w_H��xH�H9�r8H�H���H)�H���H��puH���H��x�[�DH��1��nB�[��H���H�����*�H���HǃxHǃpH���1�Hǃ�Hǃ�[�ff.�@��H�F���H������H�H���H���H�H����F�������V��߃� 	Ј��H���p���U��S��H��H�����H�������H�{ H����H�{(�#H�{P�.H�{`�BH�{h�MH�{x�XH�{0�gH��`uHǃ` H�����Hǃ�H�����Hǃ0H��)���81����H�H�p�+H���H��H���H�H��H��H���������t��� H��H���[]�H���������������H��������H���H�{(H�C ����H�S�H�{PH�C(����H�-�����t|H�CPH�{`�����H�n�H�{hH�C`�����H�(��H�{xH�Ch�����H������t&H�CxH�{0�����H���H�C0����H���+H�Cx��H���+H�CP�x������U����SH��H��+H�8H��P1ɺ����1�H��������H��H��Hǃ� ���6�C�V�H��H�5����H��H��[]�ff.�f���UH��SH���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$��$H�D$H�D$ �D$0H�D$���H��H��H�xH������H��H�L$dH3%(u
H���[]��r��f���ATI��U��SH��H9��w@��L��H��[]A\�>�@H���1�HLJxHLJpH���HLJ�H����S&�H������f���Hǃ�H�������w���ff.���AWI��AVAUATUSH��dH�%(H��$�1������H�D$0H�l$(H�$L�d$@�I��xI+�pH9T$��I����+�H��w*I����I9�I���H������H����I�I��xI��pL�t$8M���H�D$H)�H�L$H�D$I���H�����H��H�D$(H���_���H��H�$L��H��H�4@����H�T$0I��xL��I�H�$�H�T$(M��L��H��L������
H�D$HI�xI���H�t$8����H�|$8�^���������WA��������
�����������������H�����I������H����H�I����(����A��� H�����H��$�dH3%(��H�Ę[]A\A]A^A_�H�����I��xI+�pH9T$t�H�D$H�H+D$H9T$r��H�1��H�|$8H�t$(�H)�H��HG�H���H�5*�L��H��1��%�H�����ALJ��H������E���H�5�L��1��u%�ALJ� ��������H�)�+ATI��UH����SH�8H��Pf�H��H��H�EH��XH��XH���H�CHH�3���H�CP����ƒ�����U��	Ј���U�������L���Hǃ�	Ј��ǃ���H��H��1�[��]A\��ff.���H��H�=j�+����ff.�f���H��H�=��+���f.���U@��SH��H��H���dH�%(H�D$1�H��� ����H�$1��o���oH���oP ���oX0���o`@���ohP���op`��oxp��o���(H�p0H��tH����<�H���H�L$dH3%(��uH��[]�H���������@�����������ATI��U��SH��H9��w@��L��H��[]A\�t8�@H���1�HLJxHLJpH���HLJ�H����� �H���f�H�����H��������H����HD���H������H����Q������AWI��AVAUATUSH��dH�%(H�D$x1����EH�D$(E1�L�l$1�H�D$L�t$0f�I�����H��u*I����3�I���H����n�H���pE�H�D$ I��xM���I+�pH�$I���L���x��H�t$H��H����L���_��H�T$L��H��菼���H�T$(I��xL��I�H��H�$M��H��H�T$L���E�H�D$8H����D�I�xI���H�t$ �O���c���f.�M��xM+�pL9����L��H)�L9���0D�D�W��A������������.�I�H����������I����+�H����L9���C�I���1�I��xI+�pH���:��H����H�T$(H��L���a����L�d$0H�T$(I��xL��I�H���L��H���n�tA��� L�d$8M���'C�M�xM��xM+�pL9����A��� H������1�H�L$xdH3%(u<H�Ĉ[]A\A]A^A_�M��xM+�pL9������H�����뾐H�������2��f�1�H�����tA��� M��xM+�p�h����AVAUATUS���C�H�(�+I��I��A�Չ; H�8@��H��Pf�L��H��I�D$H��XH��XH�����H�CHH�����H�CPH�����H�C`����ƒ����A�T$��	Ј��A�T$���������	�E��H�����L������D��HD‰���H�����]��L��H��1�[��]A\A]A^���fD���ʉ�H��H�=5�+��������ʉ�H��H�=]�+������H����USH��H��H��pH���H����H���H9o��A�wRH����������H������ Hǃ�H�GH9����������H9���A�H�H��@H�GH��xH���H�GH)�H��[]��1��q�H��pH���HǃpH)�xH���H)�H����4���H���H�GH9��r���H�����H��u���@���� H������H������o���D��H��������AUATUSH��H����@�L�%r�+H��I���I�<$H��PI�<$�H���H��L������H��1ɺ����H���H�����1�H�C(H�)���H�CH��HH��[]A\A]Ð��H�GH������ff.����UH��H��SH��H������H��H��H��[H��]�T�@��H�GH�������wH�H�5&~1������USH��H���H��XH��tH��H�{H��tH���_��H�[H��u�H��[]�ff.�@H��H��pH���L���H9���?�H���H��H)�H��tJH9�v7H�H)�H���H���1�M��t
1�A�x��H���f.�HLJ�H)�H��t�H��@H���8?�H)�H�H)�xH��pH��@H���M��tA�xt/L�TxH�
1y1���H�5xH�=��'���I�x�w��H���ff.�f���AWAVAUATUSH��H��8H���dH�%(H�D$(1�H�����}���������L��xL���L�pM9���L�|$H�}M��L��M)����H�T$L9����f?�H�}�R+�I��H�@H�������H�}I����9�G���H���H����>�H�}H����>�G �mH�t$ H�|$���I��H�EH���`H�UH�PH�EH����H�UH�H�EH��+H�EH��H�8H��P H���H��tH�xH��t1����H���H�l$ H���H��xH��pH��H�H)�H9���=�H)�H�I�H�H���H�l$ H��tOH���H��t�2��vH������H�l$ H��H����H��L��H�����H�D$ H�xH��H�|$��H�|$H���=��H�|$賴�H��pH��H������I��f.�H�L$(dH3%(L����H��8[]A\A]A^A_�f.�H�����H��@H��xH+�pHǃpH��xH9���<�I��H��xI)�H��pH����r���f���������<�E1��[���L�����H�T$L9��(H����r���L9���;�M)�H��I�I�L����L��L��H���F��H��HH��@H��xJ� �M����H�EH;�������H���H�E����HǃxHǃp����DH;���o���H�EH����_������ I������h���L�D$螵�H�}I������L��H�5H��H��1��;�H�EL�D$�@����$��������;�L�(tH�
�t1���H�5�sH�=袳��p;�ff.�f���AUI��ATUSH��H���H��t-L�%��+@H�{H�k�;��I�<$H��H��H��P H��u�H��L��[]A\A]餰�@��AUATUSH��H��H��HH9�@t_L���M���I�D$H��H��t/L�hH��+� H�8H��PH��L��H��A�UxH�EH9�t3H��H��[]A\A]�DH�����:�H��[]A\A]��I�|$H�}����H��H��[H��]A\A]�ff.�@��U��SH��H���<���@��t!H���H��tH�{���H�[H��u�H��[]�ff.�@ATI��UH��SH��tyH��+� H�8H��PH��H�hH���@�I��I�<$��I�D$H�CH�H��tiH�XI�\$H��t��]A\�
��f.�[]A\�H�GH��tH�xt�H���+� H�8H��PH��H�@�@�f�I�$�f.�I�D$H��H��X�\���Y�������������1����D��UH���SH��H��H��+H�8H��PH�D���H�
m���H�P(H�����H��H�5����H�H H�
M���H�PxH�������H�H01�H�pH1�H��H��XH�H�������[]�>��f.�@AWAVAUATUSH��(���H�T$dH�%(H�D$1�����H�>I����H��1�L�d$�/fDH���I�J��H9�rmH)Ѓ�I�9��v\H��tWA��N�,�9�u�H���L��J�<����xTH�T$H���H�R0J��C���1��H�D$�1�H�L$dH3%(��H��([]A\A]A^A_�H���J�<(���H��H���J�<(���H��H�5pH��H��1��z�H���J�<(誰�H��H���J�<(����H��H�=�pH��1��3�H���J�(�@������P������f���SH�����H���H�t$H��H9���7�H�D$H�t$HLJxH���HLJpH��H���HLJHLJHLJ����������H�t$;��rJH��u]����6�H��������H�<�H���H���H�4�H�t$�%�H��[��H���H�<�H�����@H��H��H�50o1���ǃ�H��[�ff.��USH��H��pH��H9��F6�H��H��H��H)�H��tsH9�v1H�1�H)�H��H��H���H��H��[]鞸�fD���H���P�H���H�<��x��H+�HǃHǃH��t>H��@H����5�H��pH�H)�xH��@H)�H��p�e����H��p�R���ff.����AWAVAUATUSH��8���H���dH�%(H�D$(1�H���H;���6�H����6�H�����L��xH��H�pI9��E6�L�t$H���M��L��I)����H�T$H��L9�����6�H����ԫ�I��H�@H�������H���I����@�����;��r
�G �=����L�����H�T$H��L9���H����H��xH+�pH��@H��xHǃpH9��6�I��H��xI)�H��pH��H�t$(dH34%(L���,H��8[]A\A]A^A_��H���z���L)�H��H�L$H�H�T$ H�����H�L$����H��HH9l$ J�4!HFl$ H��@H�xH���6��H��xH�(�=���fD�G���S�����;����H���H��xH+�p�&�H9���H����E �(4�H��H��H���YH�t$���H���1�I�ċ�������H�<�H����$
�H��H��xH����H����L��M����3�HǃpH�t$HǃxH��tHH���H��t蓸�vH���6��H�t$H�T$ H��账��3�H�t$H9t$ ��2�H��H��HH��L������H�t$H��薴�H�D$HǃpH��x�.DH�L$L��pH�L)�H��H��H9��2�L��H���@���I����������P�H���H�<����H���Hǃ�w���I�GH���]�����1�D�G ��fD��� ���L9��i����1�fDI���������H��HI�����H��@���轩�H���H������H��H�5 H��H��1��W
�H����@������������2����USH��(���dH�%(H�D$1�H���H��H9����2�H�����H�T$H�t$H��H�l$�*�����x]��Hǃ���t/H����P�H�AH�4�1��H��HH��H���H9�u�1�H�|$dH3<%(uH��([]É��������ATUSH������H��H9���-2�H��I��H��X�����t+1���H�����L���H�<����9��w�[]A\���USH��H������H��H9����1��H��1ۅ�t&f��؃�H�<��B��;��H���r�H�l�+H�;H��t	H��P H�;H���HDž�H��tH��P HDž�H��H��[]�u��D��USH�����H���H��H9���[1��H�����tA��t2�����t(1�f�H����ڃ�H�<��[��9��w�H��[]�@���븐��AWAVAUATUSH��H�<$H�?H����L�<$A�1�1�A�E1���
�H����0�H���tH9�HG�I�?�G�ED�ED��}��KH�$H��H��L�<I�?H��u����DI�����H���H�-�+H�L$� H�}H��PH�L$H�4$���H�}I��H�����H�L$I���H������H�Q�H9��*0�H�}H��A��A��E�A��H��P1�I���I���H�8I����t�H�=���1�1�I�F H�~���L�������I�F(H�����I�F0H�p���I�FHH�5���I�FPH����I�F`A���M��X���A	�E	�E���H��[]A\A]A^A_���@H�� A� LC�M������L��eH�
�g1��kH�5�dH�=����f.�DSH��H��H���dH�%(H�D$1����H��udH����+�H��>H����/�H����J����R������� ���	ʈ���4�H������H����.�H��H��H�����<����H�t$dH34%(uH��[�萿���AWAVAUI��ATUSH��(dH�%(H�D$1�����H�H����I���H�t$1��h��E���H�\$M��xI��A��DH9�sSI��PI9�sGM�4(A���
��I��HL�
��E�����
H�\$I��E1�H9�r�fDH9��B.�M;�P�
.�A���I���H���A	�E������L��I+�xH����A����@.�H�|$�4.�L������H�t$dH34%(��H��([]A\A]A^A_�fDE��tI��HB� 
H�\$I��H��A������
I��H��H�\$E1�����L)�H)�
L��H9�L�$HF�H�L$H���Z��H�L$L��H��L)�H��H��HE�H��I�H��T��H�\$L�$�n���fD�--�M��x�����y��f���AWAVAUI��ATUSH��(dH�%(H�D$1����H�H����I���H�t$�J��I��xL�|$H��H�D$M��PI��HI�H��H�Iƀ9
��I9���I9��
M���
H��I)�L���[��I��H���GI��I)�J�T%L��H)�I9�LB�M��ubI9���I9���I9��gI9��^�{�
H�E��E
I9��SH���
H�CI�XH9��X����9,�fDH��H��L��L�$����L�L�L�$�f�A�����L9���H�\$H9��>,�}�
I���H����H+t$�A�����	�A����I��I+�HH��I+�xH����+�I��x�H�t$dH34%(��H��([]A\A]A^A_�DM�����H��H��H������f��E
H��I9�vH�D$�E
H��H�X�J���DI��HH�\$�#����I��H����@I��HL�������L��bH�
�b1��YH�5'bH�=a�����:+�ff.�@H���+ATA���UH��SH�8H��PE��H����H��H��H�EH��XH��XH����HD�H�CH����ƒ������U��	Ј�����H��H��1�[��]A\�$��@����b���f���1��U���D����� H������ff.�f���H��pH����ff.�f���H��H��tH���+H�8H��` @�ff.�@��H�Մ+ATI��UH����SH�8H��PH������1�H��L��@H��xH��H��H��XH�9���H�C�H�N���H�C��C�����C���H�kXH�5�aH��赠�H��[]A\�ff.�f���H��uH�=���[�ATUH��H��SH�����H��H��I��H���u��H��L���*�L��H�5��H��H�����H��[]A\�f.���SH���H��H��tH���+H�8H��P Hǃ�[�ff.�@��USH��H��H���H��H����y��H����]��H��H��xeH���H��xH��pH���H�9H)�H9�w-H9�syH�H)�H9��l(�H9��c(�H��H��xH)�H�H��H��[]�fD�����u�H����u��G���H�5b_H�߉1����H�������H��xH���������H�5'_H�߉1����H������q������H�e�+AVA��AUI����ATI��USH�8H��H��PH��H��I�D$H��X���H��XH�����H�EHH�A���H�E(���A�T$���	Ј��A�T$���	Ј��A�T$���D�����	Ј�����L���L��H������[L��H��1�]��A\A]A^�A����H�щ�H������[��f.��������tHLJx���HLJp���Ð��SH�����t������uǃ�����[�����y��r��8ht�H������H�=�^H��1����ff.���H�����uH���H9��*&�H��H)�H��H���HLJxHLJp����H���f���AT�USH��H��dH�%(H�D$1�H���d���|�����H��xH������H�H+�p����� ���H�$H�H���H���H�����VH��~qH���H���������%�H��pH;�x��%�H9���H)�H���1��Gf����H�$H��H�H����x���f�H��xH��H�H��xH�����H�L$dH3%(�zH��[]A\�DH�x���H������1�H��H��1�������������H��H�5H�H��1�����=�����H���z���@Hǃ�H)�H�H��H��pH�H��xH����G�����$�@���I�ċ��tq��tl����$�	�$�H�$���u.H�5�\H��1��m��A�$���H���������H��H�5\H��1��<����f.����u�����]����n#�D��� H�����������fDH������r����o��ff.�@��AUATL���USH��L��H��� ���t%���I��H������t"�����x_1�H����[]A\A]�H�ƿ���y�蚙�L��H�5h[H�ߋ���1��>��L���v��H�=�YH��1�����^��L��H�߃��H�5�Z���1���L���7��H�=XYH��1�����a������ATU��SH��H��dH�%(H��$�1�C�D���H��X��A��A	�H��x+D���H�G H�;{+H�GHH�x���H�GPH����H�GXH�����H�G`���uY���1�H��1ɀ�������H�5�ZH��H���[��H��H��$�dH3%(��H�Ġ[]A\�DI�ԿH�����x�D$%�=�t�=@tU1�1�����%��xi��t,���1�H��1ɉ��'��H�5mZH���e�������
���M��tSL��H�5�YH��1��g��ǃ������!�苗��H�5j/H�ߋ���1��0���o�����H�=�Y1��8��I���螯�ff.���USH������^!�H��z+��H����H�8H��PH��H���E1�[1�H��]���ff.���USH���?��6!�H�fz+H��H����H�8H��P�3H��A�1�H����������H��[]���UH��SH���H��H�z+H�8H��PH��H��A������H���r��H��H��H���D��H��H��[]�f.���UH��SH��H��H���tH�5GY1�����ǃ�H���HǃxHǃpH��[]�f.���ATUSH��L���H��H���H��dH�%(H�D$1�H����@��L���(��H��H��~hH���t>H��L������H�$H9����H���H���H9�� �H��H)�H9�w<@H�L$dH3%(H��uHH��[]A\�@t�Hǃ���f�H�H���H�H���H���H)�P ��8�����AUI��ATI��UH��SH��H�Mx+H�8H��PH��H��H�EH��X���H��XH�����H�CHH�C���H�CP����U���	Ј���M���	Ȉ���M���L�����L���	Ȉ������H��H��H��1�[��]A\A]�V��fDATA��USH��H��H���dH�%(H�D$1����I9�w�o�H������I9�vWH�����H��H���H�����H����H����@�� ��������	Ј����uH���t4���H��H��H�����t=�H�L$dH3%(u/H��[]A\�1�H�5WH�������ǃ� �ȸ������e��D��AWAVAUATI��USH��dH�%(H��$�1����������H�H����I��$�H�t$81�L�|$@I��$x���H�T$8L�D$0H��$�I��L�L$4H9�sBI��$PH9�v5A�<"�	L�k<\��I��$HL��*H�T$8H��H9�r�E1�I��$�H����H��I+�$xH����H�����E�����A�uL�����H�H��~
L������DH��$�dH3%(�tH�Ĩ[]A\A]A^A_��I9��{O�.A�<uuSH)�H���I��$HL)�DŽ$�I��Ƅ$�H��D$4H���A�����DI��$HH�<b��vc<n��vI<r��<tuY�	f���H�T$8L�H9��N�H�I;�$P�l������<fu���</tD<\t@<"t<1�H�5UL���{��H�����ADŽ$�����
�x������i���f���I��$x���D�
�@���L���H�L$L�D$L�$L�L$(L�\$ ���L�$H�L$L�D$A�BH��L�T$L��H�$��$��n���:����|$0��%��=��$���=�H�$L�D$L�T$L�\$ L�L$(����%��=�����������L��L�L$H�L$L�$���|$4�D$HH�L�$H�L$H��L�L$H���\���f���H����A��$�I9�$x����A��$� H������L���A����I��
��A�z\tA�zu�A���A�BL��H��L�D$L�L$��$�H�$�I�������T$4H�$L�L$L�D$��%��=����D$0�Ɓ���������-���
��$�|$0���DI;�$x�9���H��������fDA�����訦����UH����SH��H��q+H�8H��PH��H��H�EH��XH��XH�����H�CH����ƒ������U��	Ј��肾�H��H��H��1�[��]�
��f.���SH��@��H��H���dH�%(H�D$1�H���Q����H�$H����o���oH���oP ���oX0���o`@���ohP���op`��oxp��o��1��(H���tH���H�L$dH3%(uH��[�H����@�������������ff.�@��H���H��H����GuH97s�7����ff.�@��ATUSH��H��H���H��dH�%(H�D$1�H�������H���H��xH+�pH�H;���bH��xH��H���HǃpH���n��H��xH��@H�$H9�s|H���E1�H�����H+��H9�w��� H��H�$H9���H��xM��tI�������� ��H�L$dH3%(L����H��[]A\�M��~WH�����H���H��I�ċG�������W��߃� 	Ј��蛻�H��xH��@H�$H9�s�I����z���H���H����&���H9��@���I��H��xI)�I����I����0���������6������� I��������������UH��SH��H���dH�%(H�D$1�H���t&H��H�L$dH3%(uAH��[]��H��@��H�����‰؅�x�H�$H�P01�H���t�H�U���h�����H��m+ATI���UH��SH�8H��PH��L���H��H�EH��XH��XH����H�C(H�<���H�CHH��H�C`H����H�Ch����U���	Ј���U���	Ј���U����	Ј�����H��H��1�[��]A\���ff.�f���USH��H��H�/H�7H���e��H�+H��[]�f.�������@��tHH���H�VH�H�JH�H9�t fDH�H��t	���tH��H9�u�H�>����fD����U�SH��H�����H���q��H���1�H�x���H���H�uH�VH�H9�tH;u�pH9tkH��H9�u�H�H�H9�u�%DH��H9�tH�8t�H��[]�f.�H���h��H�}���H��k+H��H�8H�H�@ H��[]��H�H���H�uH�V����H���H�8�}��ff.�f�ATA��UH��SH��dH�%(H�D$1�H�k+H�8H��PD���H��H���H�$H��H�CHH�����H�CpH�;���H�C H�����H�C(H�EH��X�E(��������	Ј��E��tPǃ�����H�U H�}H���v��H�<$1�1�����#��H�L$dH3%(u/H��[]A\�f.�H�}�W���H�$H�������ff.�@H��H���l�H�GH�H�HH�H9�tH�H��t	@8��tH��H9�u�1�H���ff.�@AUL�-OKATI��USH��H�H�nH�H9�u�DH��H9�t8H�;H��t� A�$��t�LJ� A�$L��1�H�����H9�u�H��[]A\A]�ff.����H���H��H��tH�xHLJ��f.�H�����AWAVAUATUSH��H��8H�?H�4$dH�%(H�D$(1�H�D$H���.L�d$L��詵�H�D$H�;H���h�G��y��I��H���hH�;H�D$ E1�H�D$�-H����A�H�;��CA�FȉC衋�H�;L���6��I��H�D$H���M�K��t��sH�������kH9l$I��H��HFl$M����A�����I���I�xL��H��H�T$�	}�I��xH��I+��I��x����H�D$ H�$H9����HG�I��PA8��trH�/H9���I�HH��L�����I���I���車�C)�H�;H��C蘊����S�������H����������fDH�4*H9����I�HL��I�H��H���{��I�x�C��M����H�KH�H�H�y�rH�H��H9�tH�H��t���H��H9�u�H��B uPH�L$(dH3%(L���H��8[]A\A]A^A_�f.�H�<$�'���I�TH��LO��w���fDH�sH�{���롐�C(�W���H�4$H���*���I���H�KH�H�H�y�rH�H��H9��_���DH�H��t���H��H9�u��;���I�����3��H�$���A8��uM������I������
���f.�E1����H�$I�������� ����L��ff.����US@�މ�H��H�oH����@���H���(�H���H����[]������AUI���0ATUH��SH��L�% e+I�<$H��P�@H��H�(I�<$L�h�E������C(��	�H������C(�
��H�C H��H�C���H��H��1�[]A\A]�u���D��H�G������H���H��H����GuH97s�����ff.�@��U��SH��H���H���e��@��uH��[]�f�H���H��[]龿�ff.���ATUSH��H��H���H��dH�%(H�D$1�H���H������H��pH)�xH��HǃpH���茰�H��xH�$H��@H9�sRH)�H���H�I������H�$H��xI�����H�L$dH3%(L����H��[]A\�M��~WH������H���H��I�ċG�������W��߃� 	Ј�����H��xH�$H��@H9�s�I����w���H9��D���H��xM���^���I�������� �J���������<������]��ff.�f���AUI���ATA��UH��SH��H�mb+H�8H��PD��H��H�EH���H��X���L���H��X�}��H����H��H�CHH�����H�C H�m���H�C(����U���	Ј���U���	Ј���U����	Ј���׮�H��H��H��1�[��]A\A]�^��ff.���AU��AT��USH���T$H����
�I���|$�����
�H���˅�uG1����I��H��H�=7D1����L��H��聨��L��L�����H��[]A\A]�f�H�|$1����I���f.�D��H9��r#H���HLJxHLJp�D���H�����ATI��UH��SH��XH�� H��t誄�H��H�8H��t)1�f�L��舄�H���SH��H�<�H��u�[]A\�ff.�f���UH��S1�H���u�H�� ��v�H��H�?t��v�H���SH��H�<�H�?u�H��_+��0H�;t H��H��t	H��P H�;HDžH���H��t	H��P H�;H��HDž�H��tH��P HDžH��[]�ff.�f���LJ,����H�� ���fD��ATI����USH��H��dH�%(H�D$1�����H��H���I��H��H��H����������H����ǣ�D$���tyH�����H�5�CH������x+H�����\$I�$H�L$dH3%(��uTH��[]A\�H�|$A�1������L��CH�
DH�qm�W���H���苆�H�=�AH��1������#������,�uH���t	���@H���@H�� H�x�gxf.�ATUSH���I�H���G��uR��(H���J��(H�<�H��H��t|�w��H����H�����H��H���t�H��[]A\Ð�w�H��I���<��L��H��H�5{�H��1����H����� �@���H��[]A\�fDH��xH��E1�H+�p���"H���H�8�w���H����s�H��A�T$I��H��H�8u�H��[]A\��H��[H��]A\�DAUATUH��SH��H��(H��xdH�%(H�D$1�H���H9�suH���M�H��p�?�H���H��H��xH)�H��pH�T$H9��]H�UH���1�H�L$dH3%(�AH��([]A\A]�@���H��H��������H�D$H����H��H�t$���H�t$I��H����L��pH�T$H��Hǃp�p�L��p���d���H�T$H�D$H9�vH�D$H��H��xL��H�H���H�t$H�xH��H����~�H�T$���f�H��t&H���>���H�EH��H���-����������� �H�E���������+�������я���ff.����AUATUSH��H��HdH�%(H�D$81���,���H��pH��xHǃpH���H�@H)�H��H��xH�H;������xH��H�������H��u)H����H���8���H�PH�D$ H����H��H�t$(���,H�T$(H���a��H�D$ H�����U��,����H��p�d�H�����L��xH���H��H��XHǃx���L��xH���1ɋ�,H���~���H�� ���H�����,H��tH�xY+H�8H��P Hǃ�H�t$ H���g������9�H�D$ �DH�� ���H�t$ H���c|�H�D$ H��H���H�� ���H�� ����H�D$ H��~~H�D$ ����H�� H�t$0败�H��xH�T$0H��@H��pHǃpH��H)�H9�sdH�H)�H��xH�L$8dH3%(��H��H[]A\A]��H�� ����W��߃� 	Ј���G����d���f�H�D$ �f�L�d$ L���3���������H��H�|$(���D$�����H���H9�x���H��@��躳���H�|$(L���H�l$0����H��xH�|$H9�XH���H���HC�XH����D$��,�=z�L��H�� ���H�=g;H��1����H�� H���s��@H�� ���H����H�� H�����H�T$0H9�xw�H��XH�� H�D$�{�H�D$H��H��@�:l�,������"����� H������&���D�#s����������z�����H���H�=a:1�����x���D���H����k�H�� ��o�L��H����H��H�=o:H��1��e��H�� �Y��ǃ,����HǃX����L��H���)����������E�@�sr���t��ztH�t$(H�=�91����H�|$A�e1�L��:H�
�;H��d荜���&r�H���H�5H:H�ߋ��� ���1����H�����B��f���AVAUATUSH��H��dH�%(H�D$1�H���H���t0H���1�H�L$dH3%(���|H��[]A\A]A^�@L���A��H����H��xH��H+�p�2x�H�����H����/H��H��xH+�p�	x�H��L��1�L��x����H��H�?t$��[k�H���UH��H�<�H�?u䋫�����H�� H����H��A��芩���H�$�o���oH���oP ���oX0���o`@���ohP���op`��oxp��o���(�����,����L����x���������n����p��H��H��A��H�=b8H��H��1��mk�ff.�f���AWAVAUATUSH��(H�$H�L$dH�%(H�D$1�H������I��H�?I���1�E1�H��u�����GAD��i��EI�<�H��L�<�H��uڅ���H��R+�8H�8H��P�uI��H�$H��M��XI�����I��H�D$J�6ADž,����I��H������M���H9��(��H��R+���H�8H��PL��L��I��H���Ӧ�1�D��1�H�L��I��H���I�E H���I�E(H�r�I�E0H�'���I�EHH�����I�E`H��I�EPH���I�ExA������	Ã�A���薭�I��H�t$赞�H�\$H��H��u(H�T$dH3%(I���uDH��([]A\A]A^A_�f�H��L���e��H��H��H����H�t$I��I����t���(��L�&+H�
�71���H�5X6H�=��� i���H��H�����L�M��t&1�A�@u
�,@A�@t!D�@L��N��M��u�H�������H���w�����USH��H�����H��H������H�H��H��t#1��Au�,@�At"�HH��H��H��u�H��H��[]�e��DH�����H��H��H��H���S��H�PƂ0H��[]Ð��H�WH�wH7H9�sH�=�61��~��fD�O1�H�=�6�f��fD��SH��1�H��H���dH�%(H�D$1�H�������H�$�o���oH���oP ���oX0���o`@���ohP���op`��oxp��o��H����(H���1�H�L$dH3%(uH��[�H����@����������������H���H��H����GuH97s�����ff.�@ATUH��SH���	@M��~TH������H���H��I�ċG�������W��߃� 	Ј���k��H��@H��xH9Ev�L��[]A\�ff.�@��AUATUSH��H��HH���H��dH�%(H�D$81�H���L�l$�0��H��pH)�xL��HǃpH����ؚ�H�T$H��@H9�x��H���E1�H��H+��H9��H�D$ ���H���H�T$H�D$(����H�L$�D$(H9�s=����H��xH�l$H9�r��� I�����H��x�DH�Մ��������H���H�|$���H�5�)H��H��1��B��H�l$H��xǃ� H9���I��H��xI)�I�������������+�L��H������H�T$H�D$(I��H���H�T$H�D$H���H�D$ ��������D$(H9�����H��xH9��m���M����H��xH�L$8dH3%(L���H��H[]A\A]�L��H���=���I��H���t�H���H�T$H��H+��H9��3���I����+���H���H�D$ ���H�l$H�T$H�D$(������T$(H��xH9������H��x����I�����C���������5�����D�����H���H�|$I��������H�5�'H��H��1��r��ǃ�������ff.�H�K+ATI��UH��SH�8H��PH��L���H��H�EH��XH��XH�����H�C(H�p���H�CHH�����H�C`����U���	Ј���U���	Ј���U����	Ј��菗�H��H��1ɉ�� ��H��[]A\����H���3���H�����H���H���H��H���D��USH��H��H�/H�7H�����H�+H��[]�ff.���H������H�PƂ�H�����H���#f�H�PƂ�H�����UH��SH��H�����H���H��H��hH��[]�f���SH��@��H��dH�%(H�D$1�H���H��H�8莞���H�$�o���oH���oP ���oX0���o`@���ohP���op`��oxp��o��1��(H�L$dH3%(u
H��[ø�������}���H���H��XH�8�l�fDUH��SH��H��H�?dH�%(H�D$1�H���Y��H����L�$��H��@H�MH���H��xH�	H��pH9�����H)�H��pH)�H�L9��f��H��xH�UH�H���H�UH�R������H���H��t/����y���HǃxHǃpH���H��u�H�D$dH3%(uH��[]��[|�ff.�H�GH��t4H�����H��pH9�s���HD�H���H��u�H�F�H���v�f�SH��H�?�j�H�sH��[������SH��H������H���H�8譮�H������H���[H�8餠�@��USH��H��H���H���H;EvH�EH�UH��tbH9�u��H9�t3H��H���H��u�H�������Hǃ�H��[]�fDH���H���H�H�}u�H�}H�uH�H9�����H)��i�H���\�H�5F+H��H�8H��P �H�U밐��H��������AUATUSH��H��H���dH�%(H�D$1�H�/����H��@��I��H��L��袒�H��xH���H�4$I��H�H+�pH9���HuH9�����H���H�w����H�$H9�x�=��L9�@����H�$I��L+�xM������H���H��xH�HEH+�pH9�����H�L$dH3%(L����H��[]A\A]ÐHUH9��d��H����W���H���\�I��H��~'H���H�w�'���L��H��蜑�I���H���@H���H��H�$I���uH��pt���E1��b���D�E����E�� ��������	Ј���4����H�w����r����x�ff.�f���U�SH��H��H�D+H�8H��PH�;H��uH���M��H�]H��H��[]��H��H�����艭�H�EH��H��[]�ff.���UH����SH��dH�%(H�D$1�H�H�$H��C+H�8H��PH�<$H���H��H�GH��XH��XH�@���H�C H�e���H�C(H�����H�C0H�/���H�CHH�����H�C`H�����H�CXH�EH���H�]�!��H�4$�H�߉�讞�H�<$H��蒘�H���H���C_�H���Y�H�T$dH3%(u
H��H��[]��|w�ff.����H�G������f.�ATI��UH��S���t&1�fDH�U��H�<�H�?t�#Y��A;$r�A�$H�uH��tH�BB+H�8H��P [H�E]A\�ff.����USH��H��H���H��t'H���H�����H��H���[]���f����;��r;��Dw�E����������������;����H���H�,�H���DY�u�H�E@H���H��tZH�@H��xH;�Pr�H;��r�H��H���4��H���H������H�������D��� H�����H��[]�1�H�5_*H���'��H�����ǃ���@���H���BZ�H�5K*H��H��1����H������D��UH��SH��@��t@H���H��t�-�����t%1ېH�����H�<�H��t�	���9��w�H��H���H���[]���D��AWI��AVAUATUSH��(H�?H�t$H���.M���A�1�H�D$ E1��2@I�>�G�ED�AD��0��SH��H��M�4I�>H��t"�u��H;D$r�I�>�f��H�D$��H�T$����H�
�?+�A����E��H�9H��PH�
r?+H�T$L��I��H�D$A���H�9I����,��L��1ɺ����I���H�����1�I�E H�D$I��XH�����I�EHA������A	�D	�A���H��([]A\A]A^A_霚�L��H�
�(1���H�5�(H�=��V�@��U��SH��H���H��赻�@��uH��[]�f�H���H��[]���ff.�����t�f�USH��H���H���[��H�=D;+H��������9�l)�L�
Ç=������Mb��L������H�5-(H�����)�i��)�1����H����ǃ�nH��[]�a�f����H��H�)����I�ى�?L�)���H�u'H�����H���H��[]�@H�=f'1���I���J���f���AUATUSH��L���H��H���H��H����>��L���&��H��H��xNH���H����H������tH��9+ƃ�o��H��H��[]A\A]�D�;Y���ht�� u�H���H��9+L� D+���V�D��H��H�5�&H��1�軶�H��H��[]A\A]�DD��E���c���H���Т�D��I�ٹuL����H�*&H��蟦�ƃ�L��H���H�"9+�o���b_��*���D�#��H��8+L��ƃ��o���-_�H��H��[]A\A]�ff.�@��H���t"SH��H��H������H���[�fD�ff.�@��H�u;+ATA��UH��SH�8H��PH��D��H��H�EH��X���H��XH�P8+H�H���H�����H�CHH�T���H�CpH�I���H�C ����U���	Ј���U���	Ј���U����	Ј���Ӈ�H��H��1�[��]A\�`����UA�H��L��$SH�����H�
J%1�H��$H���H��H����H��[]�'T����SH��H��dH�%(H�D$1�������������H�������H���/O������H�$H���H��xH�H�X���tƃ�H����H����t3H�xH�L$dH3%(��H��[�f������f��U���t,��t'������	����H����������u�1��H����������� H���������f�����m�ff.�f���USH������^��H��8+��H����H�8H��PH��1҉�ǀ�����E1�H���G��H�
���H�PH�J H�PH�
M���H�JHH��[]�f���H�Gƀ����H�Gƀ����H�W���ǂ�������SH��H��tH�H�OL�N�s��Mb���L��I��?���A��i��I�H��S㥛� H��L�C)�i��H��L)�Hi��H�H�C H=?B~I��H-@BL�CH�C [�fDH��_�L�K H�K�v���f�AUA��ATI��UH��SH��H��H�2H���H�3H�}H�{H���;��I�D$H�����H)�H�I�T$ H)�H�SxxH����H�{��i��H=�� ~H��� ����H���H��S㥛� H��H��?H��H��H��H)������H������H��[]A\A]�f.�H��H��@BH�H�SH���v���H�1�H�CH��[]A\A]�f�H��uE��t%1��c���fDH����]�H�u����H�C1��l������H��H���_��ff.�@ATI��USH��H�� H� dH�%(H�D$1�����H��H�����������H��1�L��H��H�$�7�����Mb�������i��)�i��fo$fH~�C`HChH�H�ChH�S`H=?B~H��H-@BH�S`H�ChH��2+H�$H��2+H���uVH�L$dH3%(����H�� []A\�������t>H���\�1�1�1�I�$I�D$�Y���f��E��u��EHu����fDH�����I�$�� �����I�D$H�C`H�Ch�a����i�f���H���É�H��H���f�H��H�=v"H��H��4�ׂ�CH��H��H��?H��H��H)�Hi�@BH)�1�H�������H�=%S+��L���H�=S+��L�ATI��USH���i�L��������H��I��I��H��4�ׂ�CH��H��H��H��H��?H��I��I��L)�I)�H��H��H�؍M�H��?Mi�@BM�T�H��H)�L)�Hi�@BI��I)�L���7@I�L�L�GH�O H��?B~I��H��@BL�GH�O H��I9�t<H�8L�GH�O H���I�L)�L�GH�O y�I��H��@BH��L�GH�O I9�u�[]A\�ff.����H����h��uH�G(�G���H���D���G����@�w����S�GH�B��?�H��t)1����H�C8H��H�x �2��H�C8H��[H�x �T�[�ff.���SH���S�����x[�DH�SH��t�H�zt�zt�H�R@H��u�H�=� 1��DJ�@�������@������@������@���wP���������Ð��SH�/+H���LY�H�H�/+H�[�ff.�f���H�wX����AWAVAUATUSH��dH�%(H�D$1�H�/2+H�(H9�tYH�8H�EP+H��tJH�L�`L�t$L�-�I�L9�t/DL��L�;�%��H��D$A��L����P�t-H��L9�u�H�D$dH3%(uH��[]A\A]A^A_���e����ff.�f���USH���=�O+��H��-+H���:X�H�-�0+H���H��-+H�}H�H��P� H�=K���H��裞�H�}�@H�����H�C �Lj�H�C0H�����H�C(H�1+H�H��tH�PXH�H��H�SX�i�H��H��[]��H�=���N+�F�H����N+�5���ff.���H��0+H��H��H�H��u��@��H��H�|$H�=�N+H��tH��N+H�t$�Ƒ�H��ÐH��/+� H�����H�8���H�=+����
H�SN+H�DN+�^�H�=8N+�fD��H��H��H�=N+H�7H�WH�H9�����H;t5H��H��H9�����H9u�H)�H����H��M+H��H���q��1���ff.�f���H��H�|$H�=�M+H��tH��M+H�t$�֐�H��ÐH��.+� H�����H�8���H�=K����
H�SM+H�DM+�]�H�=8M+�fD��H��H��H�=M+H�7H�WH�H9����H;t5H��H��H9�����H9u�H)�H����H��L+H��H��遞�1���ff.�f���ATI���8UH�-
.+SH�}H��P��H����H�}H��L�`�
��H�C H�CH��[]A\�fD��H������W���H���@AWAVAUATUSH��M������A����N��H�v-+H��A��E��M��H�L$�XH�8H��PH�L$D�(H��L�`H�D$PH�k(H�C H�KD�{�CHD�sLH�}H��t
H�{0�I�H�k(H�}@tKA���u5H�C(H�PH��tH�Z8H�C(H�PH�S@H�XH��H��[]A\A]A^A_�f�H����B��fD�uPH��F�����C��G���D��H��������H���t$���H���ff.���H��H��,+AQM��A��H�щ�H�8��r�H���D��AWM��AVM��AUA��ATI��UH��SH��H��H���$y�H��M��E��AWL���H�ߺ�V���H��H�hPH��XZ�5��H�{PH���9��H��H��[]A\A]A^A_����H�=,+M��I�ȉ�H��H��H�8鯀�ff.�@AWI���PAVA��AUI��ATM��UH��SH��H�g++H�8H��P�����H��L�xD�pH�h8L�h(L�`0H�}H��t	H�x@��G�H��H��[]A\A]A^A_�ff.�f���S��H�։�L��M��H��dH�%(H�D$1��U���H�$�X��uZH�P81����t;H���c�H�4$H�F8H�x �rL�H�\$dH3%(H�$u4H��[��H�5�'+��H�@8H��H�P0H�x(�\����%_�D��H��*+M��I�ȉ�H��H�8頔���鷬����釔����UH��H�։�SL��M��H���s����HH�oEH��H��@H�@8H�x �K�H��H��[]�f���H�M*+M��I�ȉ�H��H��H�8�?^�ff.�@��SH�H����������u@H�CH9X����H�{��A�H�{ ��A�H�Y)+H��[H�8H�H�@ ��f�[�ff.�USH��H�dH�%(H�D$1�H�{����H��{��H�CtH�S(�������������H�{0t	H�{0�*a���H�{PH�<$H��tH���|��H�C8H�S@H��tH�P@H�C@H��tH�S8H�P8H�C(H;Xtp�{L�t2@��H����x�H���&?�H�D$dH3%(uPH��[]��H�A(+H��H�8H��P ��H����h��fDH�C(H�P�x���H�S@H�P��\���H�?t1���������H�H��t$H�������H�����f��ff.�@SH�@H��t	H�@��_�H��'+H��[H�8H�H�@ ��D��SH�H����H�K8H��;�u_�CHui�C��tbH�y(H�7H�WH�H9�tOH;t\H���H��H9�t7H9u�H)�H����H�Q0H���L���f.�H�C8H��H�x �@��H��[�7����[�1��f.���H��8dH�%(H�D$(1�H��H�T$H�WH�H�4$H��H�D$H�L$�n��H�D$(dH3%(uH��8��$[�@��AUI��ATI��UH��1�SH��H��H����I�UH�rH�H9�u�7��fDH�� H9��$��H9Xu�H9(u�L9`u�H�H�@H�@H��[]A\A]���ATUSH��dH�%(H�D$1�H�GH�x����H�xH���YL�H�M H�E0H��t;H�A1�H�u(��t-L�!��I���f�H��H�;�b�H�C�L9�u�H�} 1��!e�H���A�H�}1���~�H��H�EH�hH�H9�t^�{�P��L�d$�f.��{�5��H�;t&H�=��ĭ�D$H�{�L���rD��Y���CH�� H9�u�H�D$dH3%(u	H��[]A\��Y�ff.�@��ATUSH�� H�WH�|$dH�%(H�D$1�H;z���H�1��~�H�l$H��H�EL�`I�L9�tTH�l$f��{t2H�{t'H�=Y��D$H�{�SH���C������CH�� I9�u�H�l$H�EH�\$H�@��H�U(H���ԅ�H�|$�
8��J�H�D$H;E0tJH���t��H�} H��u�H��#+� H�����H�8��{�H�E(�H��H�E �@H�E0H�l$1�1�H�}H�GL�H�u����u�H���9�s9��H��H��I�<u�H�UH���|��H�}1�H�GL�H�uH��9�r�@H�|$�f[�H�D$dH3%(u	H�� []A\��W����AWAVAUATUSH��H�=�H��XdH�%(H�D$H1�L�|$�j��H�-�+�D$�oEH��)D$��I�L��H���rw�I��H��?����ZL�k`H��L���Sw�H=ay����H�sxH���;w�H��HH�H�h +HCpHH�S8H��t�HB(H�RH��u�H�E�oUL�|$ H�l$0H�
+L�5*L�l$)T$0H��A�<$�tBH��L���n�I�|$H������I�D$8L��H�x ���I�D$8L��H�x �WC�I�|$@H��t�Xl�I�t$(L��1��A�I�|$0�D$A�T$(L����@��6��H�{H��t譫�H��!+H;�+�����H�{ ���I��H�����H��L��L���H���tA�D$H����I�D$8L��H�x �G���K���f�foL$0H�D$0AL$I�T$ H�JI�L$ H��?B�����H��H��?BI�D$I�T$ ���f.�H�|$�@��H��+H��>+H�H9�tH��u3H��>+H�D$HdH3%(��H��X[]A\A]A^A_�f��5�H�D+H���L�5� +M�&M��tf�I�|$ L����M�$$M��u�H��L���SXI;u^H���$G�����L�5I +H��I��M�&M��tI�|$ L���C�M�$$M��u�H��L��SXI;�1�������>T��������@��USH��H��H�o(dH�%(H�D$1��t��������������GH�{0H��t��i�H�sH�=�1��?�H�{ �D$�SH�|$�y>�����H�}H��t�C��H�d+H9(�o��H�D$dH3%(uH��[]��wS����AWAVAUATUSH��L�-+I9}����H�G(1�H��H�@H�w0��uxL�5q+�AoH��Cx��\����t0H�{�
��t&H�{H��t�H�W@H�S�t�������u�����I9]�
��H��[]A\A]A^A_��;�H�{(L�'L�M�M9���I�,$H�}����H�} ����EH���U���+��L�5�+L��H��I���?�H�{ H���S?�M9�t>I�,$H�}uLH�} �N��EHu@�E��u�����fDH���(M��:���H�{(1��]�����L�59+������{��ff.�f���SH�@H��tQH�{H��t�c��������������H���<�����u����[�f.��wP�F�����C��Jy�����SH�GH��H�xH��tH9�t&���H�{H�t	H����T�H��[�4g�@[�ff.���H�G����ATUSH�H��tl�H��������H9{(tXH��L�KD�CH�K�sL�s �a�H�{PI��XZH��t
I�|$P�9y��CL��u&H���m�I�|$PH��tL���$��H��[]A\�@L����R���ff.���H�+H��H�8��P�f.���USH��H�dH�%(H�D$1�H��t~H9{8txH�K(�SH��L�C0H�s���KH�PHH�$����	ʈPH�S�P�oC@�;�uV��ur������H�@8H��H�x(H�P0��|�H��H�$��f.�H�t$dH34%(H��u2H��[]�fDH�P8H��H�z �p<�H�$H��贗���f�H�����VO�fD��H�
+H��H�8��x�f.���H������H��(dH�%(H�D$1�H���������H�T$dH3%(uH��(���N���U1�SH��H�t
H����[]�@H��H� �4O�u�H�C(1�H�@H�s0��@��H����[]���H�Gp������H��������H�WH��t@9rLuH�R@H��u�H���ff.���H�u+ATI��0U��SH��H�8H��PH�X L�`�hH�H�S8H�PH��tH�H�C8[]A\���H��+��H��H�8鸪����H�H�H�H��tBH�HH�JH�PH��tH�H�
H�@H�H�V8H�PH��tH�H�F8H�p �H�H H�PH9A8u�H�Q8H�P���H�+H�0�͗�ff.�f���H�7H�H�H��t:H�VH�PH�FH��tH�H�H�FH�D+H�H�8H��` @H�V H�FH9r8u�H�B8H�F����AWAVAUATUSH��L�-+L�'dH�%(H�D$1�H�I�UL9��U��H�i6+H��tJH�L�pH��I�L9�t8f�H�=bL�;�a��I�}�$A��H���7��}H��L9�u�I�UH�:��P�I�|$HtL���B��I�D$H���8H��H�$�HH�=H�PH�pD�@L1����=�5+�`��H��H�=��1��q��H����h�I�D$H��u�A�A��$����8��I�D$(L�=�H�(L�pI�L9�tTfDH�]1�L��H�s(�KH�S��=95+H����H�=0�1�H�����H�����L9�u�A�I�|$(��.��KfDH�s(�K1�H�=XH�S蟙�=�4+H������H�=��1�A�苍�H����I�|$ 虌�H��H��u�I�|$ �G�I�D$8H����H��fDH�$�PH�=�H�p1��'��=a4+����H��H�=X�1�H�����H���ND�I�D$8H��u�H���*�thI�|$@tL����G�I�|$t
I�|$��M�H�o+L��H�8H��P H�D$dH3%(u?H��[]A\A]A^A_�E��t�H���f.�H�4$H�=X1��~���E1�������I��������D��H�G(����H�m+H�H��t
H�@H��tH�@0�f.�D��H��D�A��uA��uYA���y���
�1�Hc�H��H�H���f��H�01�9�tH�<�u+H��H��u�H������f�1�H���f���H�O�H�H��tH9�t1�H��H9�u��f.�H������AUI��ATI��U���PSH��H��H��+H�8H��PH�C+�H�L�hL�` H�P(�hHH�H��tH�B8H�H�P@H�H��[]A\A]�f���H�F8H�V@H��t/H�P@H�F@H��tH�V8H�P8H�S+H�8H��` f.�H���ff.���H�H��t;pHu�D9pHt	H�@@H��u����USH��HdH�%(H�D$81��uS�H��lj��ً�~MH�,$��蚛�H�=�H��H��1����H��H�=�1����H�D$8dH3%(u'H��H[]�fD���Q��H�=�H��1�����)G�f�AVAUATUSL��$���H��H�$L9�u�H����dH�%(H��$�1�I��I��L���Z�H��=t�v.�8�?��1�H��$�dH3%(��H���[]A\A]A^�@H��+H��H���9�H�H��+1�H��H��H)�H��~EM�dA�D$H9�����A�4$L��H�\�(r�H��tA�D$�t�@H����H���<��H9��H9��U��H���}���D����E�f.���SH���H�{H�����u�[Ð��AWM��AVM��AUI��ATA��UH��SH��H�p+H�$H�H�XHI�H�����{�uD�{��H����o�A�Å�xCH�{�H�$L��D��H����&�I�L�hI�D�`1�H��[]A\A]A^A_����,���t<��tt7������H�=�1�蠇��CH���[]A\A]A^A_��H���[]A\A]A^A_�@H��+� H�H��+H�8H�T$H��PH�T$H��H�BH�sg�C���u�6,�8�#������s����Ǿ�Da�{��9�����f��D$�{�|L�M���H��+H���L��j�D�\$H�C���@��UH��SH��H�G(�wHH�XH���uH��H���XQ�H�;t*H��[]��{��y��w+�8t��v��DH�{t�H��H�{[]�`�f���ATUSH��H�_HdH�%(H�D$1�H�H��t=I��H�-�fD�HH�PH�$H��H�pD�@H1����L���S`�H�H��u�1�H�{A��L��H�
�H��%U�H�N+H��H�8H��P H�D$dH3%(u	H��[]A\���B�@��USH��H�_HH��tZ�C���t4�e���t/H�H��t��@H����H�@@H��u�H�{�_�C�kH��[]��5*�8�H��������������f.�f�H�w1�H�H��t#�������E�������E�������E�H��H9�u��D��AUA���(ATUH��SH��L�%@
+I�<$H��PI�<$H��H�E@D��H��H�tmH���@e�H�C I�<$H�4�H�����H�C�e�H�CD��H�C�E�����l��H�����[]A\A]�U^�D��AU1�1�ATUH��SH��L�g@I�|$H�GI�t$I���!f�E��t4H��A�E�L�l�H�3H��tH�a+H�8H��P H�H��L9�u�A�<$�O�����H�E@H�x�$�H�E@H�x�$�H�u@H��tH�
+H�8H��P H�E@H��[]A\A]Ð��ATUSH��H�� �wLdH�%(H�D$1�H�G(L�`@I�|$�k�H�8H��H����H��蕐��D$L�D$H�D$A��H�EH�D$H�}�����D$E��uA�SLA�<$L�����Q��/��H�D$dH3%(��H�� []A\���SLA�<$L����Q�x^A�D$��t��A�D$�DI�t$ I�|$�1r�I�T$ 1�H����J��H��
+�H�8H��PH��H�E�����z?���D��AVA��AUATUSH��H�� �wLdH�%(H�D$1�H�G(H�h@H�}�F�H��H�8I���8m�A��E��tPE��u;H�T
+H��H�8H��P H�D$dH3%(��H�� []A\A]A^���E�f.�H�D$L�D$�D$I�$H�D$I�<$�H����SL�D$E��uL�}L����LP��i����SLH�5L�H�=I�1���I���&�����¿��ӿ�}L����P��X����SLH�5!���'>����AWAVAUATUSH��8L�g@dH�%(H�D$(1�M������H�t$I����?�I�|$1�M�t$ ��H�_�b�I�}H��tH��1�I��A9D$rD��������u5�L���@�H�D$(dH3%(�H��8[]A\A]A^A_�f.�A�<$�����w�Å���L���a@�A���t���t�I�L$I�l$ H9i���C�E1�H�D$@I��H)H�]L�sH�;H��t0�E�u���u��t������t�~�A����<���H��L9�u�L9|$�(���I�L$I�l$ 1�I��H�AH��L9�w��E��@�K$�8�%��L���?�����<����f.��SH��H�w0dH�%(H�D$1�H�G H9�t9H��H�H)��*�H�{H���ST�H�$H�C0H�C H�H�C(1�H��t!H�CH�D$dH3%(uH��[��H�CH�����;�f.�H��H�G0H�w(H9�tO��� wWH�&H��A�H��I��r!�8���� w(L��H��H��L��tH�G0H9�u�����1�H���@����H��ÐSH�wPH��H�W`H�G0�GPH�X�oh�H��[����fDSH��H�G0���H�{XH�K`1�H�GH���"��tLH��p��<��p���H���ҍ��SPH���kv�Sh���u[�D��1��Sh[�fD�C�CP
[���f�H��H�G0H�w(H9������"��L�(� fDH�W0H�BH�G0H9�tT�R��"tv��\u�H�PH�W0H9�t9�H��"��Sw@��Ic�L�>��H��H)�H��~SH�PH�BH�G0H9�u����1�H����H��H�G8�����H���H��H�G0�c����H���H�w0�������ff.�USH��H��H�dH�%(H�D$1�H�/�kl�H�SH�H9����H�{8��H�{H9�tGH���Q�H�$H�C0H�C H�H�C(�H�����H�L$dH3%(��H��[]���H��H���ttH��x-t1H�{H�/��k�H�H9C�[��H�CH�{���{mt
���fDH�{�k�H��t�H�{�G��u��Cm�G���fD������`���H��H�C8������K����8�@@����v<@��"��@��\��@��
���F�@��<_v;H�5��1��}r�D@��	t2@��
tD@��uкH�5k��Ee�D���y\�f��H�5Q��e���H�53��e���H�5���d���H�5���d���H�5?�d���H�5��d����H��H�H���H�GHH���H�G0H;G(t6SH���H�PH�{@H�S0�0�[�H�C0H;C(t��QЀ�	v׸[ø�f.�AVI��H��AUI��ATUH��S�G5�I�]L��H)�H9�v8H��H���J�uM�u[]A\A]A^�@[�����]A\A]A^�f.�H��H��H��I���J�¸������u�L�I�][]A\A]A^�ff.�@AWAVAUATUSH��(dH�%(H�D$1�H�G0�8"��H���lH��I��H�G0t	@���H�{@H���H�S(H9����0@��"tH�-�L�t$L�l$@����@��\u3H�HH�K0H9����p�Nހ�S����HcL�H�>��@H�{@�Z�H�K0H�S(H�AH�C0H9��S�q@��"u�H��H�{@H�C0�(�I�$���H��H�C8�����H�T$dH3%(�nH��([]A\A]A^A_�D1��@�H�C0����H��T����f�H�{@��RY�H�K0�F���f�H�{@��2Y�H�K0�&���f�H�{@�
�Y�H�K0����f�H�{@�
��X�H�K0���f�H�{@�	��X�H�K0����f�H�HH���D$H)��D$H�K0H��'H�S01����@H�D�H�C8����������@L��L��D$�^�xlD�|$D��%��=�tmD��%��=�t	A����v"D��H�5�H�;1��"�H�C8������d���E����H��H�C8������F���H��H�C8������1���H�s0H�K(�D$H�FH�C0H9�sfH��H)�H��~TH��_�~\u �~utH�xuu�L$�΁������tcD��H�5��Q���H�s@D���1�H�C0H�H�a����~\u�H�K01�����FL��L���D$��\��C���H�C0�8\t���2�A��(��H����
H�C0D��$D�|$���D��AUI��H�==�ATA��USH���{.�pH��H�H��P��H�(H�-��*H��D�`L�hH�}��X�H�}� H�����H�C@�U�H�C`L��H�CX�Z�A��t�CPH��H��[]A\A]�ff.����1��*�D��ATUH��SH�H�H�{8H��tJ�=9�H�EH�{��H�{X�G�H�{@�g�H�H��t	H�H��P1�H�}[��]A\���@H�{�G��uH�C(H9C0tCH�E�f����H�{I���R�L��H�=QlH��1���H�E�i���f�蛎�u��{P
t�H��H�E�H������AWAVAUATUSH��H�H�ܳ�H�I��I��I��H��L�5e�DL��������A�olL������cA�P
��A�GPHc�H�>��f�A�ltA�Gh��u	A�Gl@I�G0���]����,�GM�w8I9G(��I�G8I�H�/�b�H�I�o�^���fDI�G0�8}��A�GP1�L��L��������A�EA�GPL���V�@��������I�G0�8:�H�
��I�O8I9G(�`���H�������[]A\A]A^A_�f.�H���I�G8I�G0�$���@I�G0�8]��A�GPL��A�ol�V�������fDI�G0����A�lt
A�Wh��uA�GlI�G0���}����,��H�
l�I�O8���L���0��~�1�A�PA�ol����A�GP����DI�G0���{����[�WL��L����������A�E����I�G(I9G0�:��A�l� ���A�m������L�����A�P�	E�A�oPA�ol���fDI�G0�8{��H�
��I�O8����A�GPH��L��I�G0�p�A�ol�;���fDH��I�G8I�G0���@L���������A�E�H��[]A\A]A^A_�@H��A�GPL��I�G0��A�ol����fDL����A�ol���fDA�GP�K���H��I�W`I�XI�wPI�G0A�GP�GZ�L����A�ol@���A�Gh�\���I�@H���I�W0�<-�%<0�JI;W(�u��0<	�
L���d�������I�G0I;G(���I�@��.���߀�E�I���I�$A�EA�GP����������t|�CH�=g��u#�DL����������A�EH���[]A\A]A^A_�L����A�ol@�������A�E��Q���A�E��?���A�GP���A�GP
��A�GP
�����t]I�(I�G0H���H��H�D$����UH�
��A�EI�$����H�PI�W0�0��O�I�G0I�(H9���A�E����1��>6��Q���H�PI�W0�0�O�I�W0I;W(t���pՁ�u!H�BI�@I�G0�2�mO�I�G0I;G(t����0<	�6���L������"���I�G(I9G0uI�G�@ �k���I�@�2���H�BI�@I�G0�2�O�I�W0I;W(�@����<0�����H�BI�@I�G0�2��N��������0<	�����L����������I�G0I;G(�w����I�@���I�(H�t$H�+��!��xH�
�A�EI�$���I�(H�t$H�������xA�E	I�$�h���I�8I�G0�����H�
��I�O8������H���l����H�H�Ĭ�GP�P���v
�ƒ��u�Gl��
u�GPH���L�:�H�
;�1���H�5j�H�=�d�a���H���l�׬�H�H����GP��
w1��H��s&��t��t�Gl��
u�GPH���Gh��L�k�H�
��1���H�5��H�=Od���f���AUATUSH���l����H�HH���k��GPI��P���v	���I�$L�-��@H������~lH���z���H�C0tv�{P�����"udH��H��H�C0��1��{PH�{�����CP�t5�H��H�5��H�CHH���7�H�CHI�$H����[]A\A]�f�L�k8H9C(uVH�C8H�{H�/�Z�H�H�k�F���fD��:u�H���CPH��H�C0����H�C0t���?���@H�������[��]A\A]�L���H�
�1���H�5o�H�=�b�f
�fD����v%�������v
H����� %�H�5|�1��Ra�f���ff.���@���s���AWAVAUATUSH��(dH�%(H�D$1�H��t}I��I��H��1�L�t$L�=�	��L��L��H����S�H9�sKH��I�<L��H)��5�~ыt$��������t�����w�L��D$�7�HcD$H�H9�r�H�D$dH3%(uH��([]A\A]A^A_��(&����UH��H��SH��H���h$�H��H��H��[H��]��{�@AUA���0ATI��USH��H��H�?H��PL��H��H�CD�mH�EH�;�%[�H�E(H�CH��tH�hH�kH��[]A\A]�DH�CH�h H�kH��[]A\A]�f�H�H�@H��t@H�H�@H��u��USH��H��H�O�A��t,��u�B���1�H��[]�f�H�������[]�@�qH�oH��H�?�nZ�H�E(H�CH�@H�CH�P 1�H�SH��t�H�{�D$�b����D$H��[]����AT�A��H�=�US� � H��H�H��PH�߾0H��H�H��PA���DE�H�EH�ED�`H��[]A\�ff.���H��H�?H�H�H��tH��`��ff.�@����	�6H�
����ATHc�UH��SH��H�>��fDH�WH�BH�����z��H�CH�@ H�CH��t	H�{�K���1�[]A\�@�[���[]��A\�H�G�xuv1�1����L�cL�cI�D$ H�CH��t
H�{���L�cH�;H����X�I�$1�[]A\�@H�W�B��uU�B�@H�WH�BH��t�z�L����������]���fD1Ҿ�����x�H�C�"������u�1Ҿ�����1��f.���H�G����USH����ͦ�H�_ H��H��tH�;H��tH���;�t	H�[H��u�H��H��[]�f���ATUS�G�������H�_ H��I��H��u�H�H�[H��t7�{u�H��H����H��t�H�x(H��t�L���;�u�H��[]A\�@1�H��[]A\�fD���+�����=�+t�P�&�H�50��;��	�fD��ATA��UH��SH���	����1�[]A\�ff.���ATA��UH��SH���	���t�	�8���1�[��]A\�f.���H��*��ff.���U��SH��H��H�=+H����H�5+H�G1�H�H����t1�P�H��H��H�H;Zu�ED�P�H��H��H�H9Zt-��u��4S�H��
+1�H����+�(H�XH��[]�fD9*�7��H��[]ÐH���*��H��H�8��C�H�j
+H��H�X
+�fD��1��e�D��H�=4
+tRUH�5*���H�=#
+SH���iP�H�
+H�H�hH�H9�t�SH��H9�u�H��H�=�	+[]��f��ff.�@��@�=�	+�@��S�����8���m�����=�	+S�U���)J��d?���e�H�=^�1��<`�H���*����u �V��f����&�����-��~�Ǿ�;��0�����.N��D8�H�=����hY�	+[�ff.�@����+�@��H���=�+�֣���+�>����*���&������f����H�=%�*1�A��L�Z�H�
��H����s0��.M��)^��)��oB��H+H���AWI��AVA��AUI��ATUSH��8H�L$L�D$dH�%(H�D$(1�H��+L� H�XH�D$$H�D$L�I9�u�mDI��I9�t_H�=\�I�,$��q�L��L�D$L��D$$H�L$D����H�|$���j�t2@��u�H�T$(dH3%(��uH��8[]A\A]A^A_ý���t�鲢�ff.�@H���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�1�1�H�D$I��H�D$ �$�D$0H�D$���H�D$dH3%(uH������ff.�USH�����tsH����:vK�Vy�H� H�f��DZuYH���]��t=��:w�H���H��H�Ѓ�u�H��[]ÐH� ��H��H�Ѓ�u����H���[]�@H��1�[]��ATI��U��SH�w8H��H�GHH�GPH��t[�G|�u3���G|L���c�H�C8�C|�������	�H��@�k|[]A\�@H���*H�8H��P H�C8�fDH�L����P�H�C8�ff.�H��H��1��^�����H���DH��H;v����H�H�H�JH�H��H9�u�H��H9�tH;0u�H���1�H���f���H��H�q+H������H�]+H����ATI��UH��H��SH��H��dH�%(H�D$1��S�xSH��t^H�t$H���*�x-�D$=?Bw"H�C�H�T$dH3%(u8H��[]A\�H���I�$1��ؐH�!�I�$1��ȐH�9�I�$1����ff.��AWAVAUATUSH��(H�odH�%(H�D$1�H��t)H�L$dH3%(H����H��([]A\A]A^A_�I��H�?H��t���H�	+M�}H�L�pI�L9�u�T@H��I9�tGH�+L��L�e L���u2�u�I�EH��tL�EH�@I9����E(I�m�a���f.�H�y�*�0H�8H��PI��I�EH��t	H�@I�D$I�}L�t$L���U`�H�t$A�D$(I�D$I�D$ I�EM�d$I�$H�A+H�=2+L�d$L�d$��E�H�+H�=+L����E�H�+M�eH�L�hI�L9�u���fDH��I9������H�=�L�;�ll�L��D$A��L����u��'���L�ff.����ATUH��SH��XH��tYH��XtGI��1��<�H��I��$XL�`I�L9�t.H��X�DH��I9�tH�3H�������u�[1�]A\Ð[�]A\�fD��H���W�������H���WH���ff.�@AVI���AUA��ATI��H�=9�US�~�xH��H�H��PH���@H�|+H�kH���H���CxH�_+H�C(H�d�*�o���	�L��H���yL�D��HH��@�C0M��tKL�c L���C��A�T$|�C|�����	ЈC|A�T$|���	ЈC|A�T$x��SxA�T$|��	ЈC|H�=+H�H�CH��tH�H��H� +[]A\A]A^����S����1�H��H��1����H��[�f����G|��H�=�+SH���<���{?�H|�o��H��+���o�����o�����o�����o�����o�����o�����o���o���o� � �o�0�0H���*[�f�H�=��*H���*Ð��USH��H�H����H��C���R����C��H9��*�a��1��H�����H9��*��H�-<�*H�}�C|��H��PH��tH��P HǃPH�{ �h���H�H����H�SH�PH�CH��tH�H�H�CH�CH�H��tH�H�{H�@H��[]��f.�H��[]�f�H�s8H��t
H��P H�}H�C8�R���H��*�-���H9�*H�C�o���H���*�c�����H���*�@��SH���\��H�=��*H��tH�=�*H��t)H��*H�5c�*�@�H��H�T�*[�f.�H���*� H�����H�8�7�H��*H��H���*�fD��SH�����H9=�*H���4���=��H9�����H�=}�*H��tH�
y�*H�G1�H��uH���*1�[�D�p�H�H��H��H��H���*�N�H���*[�f.���H�m�*�@��SH�H��t;H�;�+��H��x����H���<�H���*H��[H�8H�H�@ ���[�fD��AWAVAUATUSH���?����:I�����I��I��������ș�L�����������L����L��H����L��H���x�H�|H��k�L��H���`�L��H��H���"?�:H���U6�L���=�L��H��H���>�A�]��tRM���!��m�I��H��H��4��6�A���t,��-t��:��� u;_H��I����5�A���u�H��H��[]A\A]A^A_��ff.���H��H�5"&�]:�ff.�f�����"���f���H��H��H�=��*H������� �H�9�*H���@��1����D��H��H��H�=^�*H�������h�H���*H���@��H���w@�D��AUI��ATI��U��SH��H���G|tH�w8H��tH���*H�8H��P �s|��L�kHH���L�cP��H�C8	�@�s|H��[]A\A]����H��H�wXH�W`���H��H9wX�ӗ�H9W`���H�GXH�G`H���ff.�@��UH��SH��H��H��PH��tH���*H�8H��P HǃPH����V�H��PH��H��[]���H��H��H�=�*H�������p��H���*H���@��AUA��ATA��UH��SH��H��H��@�:(�tE��t!H��@D��HH��H��[]A\A]�DH�{H���tD�H��H��@�����H��H��H�=n�*H������ʉ�H���K�H��*H���ff.����H���O|�@��H��H�=!�*H�������9�H���*H������H�M�*H���wx����WD�fD���Gx����AWI��AVAUI��ATUH��SH��H�hH��t|1��2�M�uhH��M�fI�L9�u�0H��I9�t'H�;H����&�u�L�{H��L��[]A\A]A^A_�f�I�upL���D@�I�Up1�H��H����I�}H���C�H��f�I�}�@H���0�I�Ep�I��I�Eh�f���H�GhH��tJATUH��SH�L�`I�L9�u�+H��I9�tH�;H���4&�u�H�C[]A\��[1�]A\�����AUI��ATUSH��H�H�*H�L�`I�L9�u�7�H��L9�t'H�+L��H�}��%�u�H��H��[]A\A]�fDH��1�[H��]A\A]���H��*1�H�@H�5�*�H��*H��ff.���AVAUATI��UH��SH��dH�%(H�D$1�H��X��I�<$L��X1�I��H��u�QD�CI�<�H��H��t=��L��H��H�$���u�H��XH��`L���9�CI�<�H��H��uËE0�P�U0��t7;U4t2H���*����EDH��H�L$dH3%(uOH��[]A\A]A^����E0���H�� H�������.�HDž`H��X�����L�ff.����H��H��H�=��*H���I���@R�H�Y�*H���@��H��(dH�%(H�D$1�H�4$H��H�D$�R�H�T$dH3%(uH��(���
�f���H��H��H�=>�*H���Β��O�H���*H���@��ATI��USH��hH��tIH��1��O/�H��I��$hL�`I�L9�u�&fDH��@I9�tH�;H���<#�u�H��[]A\�1�H��[]A\�fD��H��hH��t`ATI��1�UH��H��S��.�H��I��$hL�`I�L9�u�#H��@I9�tH�3H����O�H��u�[1�]A\�[�]A\�fD��f.�AWAVAUATUSH��(H�T$dH�%(H�D$1�H����I��H��I��H���cO�H�����x��H�@0L�8L�hM�M9�tmH�l$�fDI��M9�tWI�H���*H��H��H�D$�$�H��u�M��tH�t$L���f>�H�D$H�SH�;H��I���6�M9�u�f�I�|$ H�T$H��L������H�D$dH3%(uH��([]A\A]A^A_����AUA��ATI��USH��H���xN�H��t[H��E��u;�C0�P�S0��t;S4tH��H��[]A\A]����C0H��H��[]A\A]�@f�@@ @0�fDH��hH��t<H��p�:�H��p1�H��H���<�H�{L���P=�H�E�l����H�{�H�����?�(+�@Hǃp@H��H��h�ff.����UH��SH��H���fDH�[ H��tH��H���dM�H��t�H��[]���;��H��H��u�!�H�[ H��tH��H���,M�H��t���DH��1�[]����ATUH��SH��H�� dH�%(H�D$1��*�H�����P�����������������U�I��@H�����H���*�L��H��1�H��H�$H�D$�����i��H��1�L��H������H�r�*H�fGL��H�8��H�L$dH3%(uKH�� []A\��H�P(H�p H�=21��T����H�@�f.�H�x�Z�����H�=x����ff.�@��ATUSH��H��t(H�պ�#���H���@H�{I���
;�I�D$H��[]A\���H��H��H�=�*H������H��H���;�H���*H���ff.���ATI��1�UH��SH��dH�%(H�D$1�����xH��tf�@@ @0H�{0�CtPM��t+H�}L��I���\:�H���*H�{0L��H�$���H��tPH�L$dH3%(H��uOH��[]A\�@H�}�H������(�H�C8H�C0�f.�H�S8H�{0L���1���i�f���AUA��ATI��UH��SH��H�}�*H�8H��PH�����D��L��H���n-�H��H�5�3H�H���) �H�;���H��H��[]A\A]���H��H��H�=n�*H�����H��H�����H��*H���ff.���AUA��ATI��UH��SH�ӺH������@E��t'A�E�L�l��H�L��H��H���~�L9�u�H��H��[]A\A]�ff.���H��H��H�=��*H���]���H��H���
�H�Q�*H���ff.����ATI��UH��1�SH��H����1�H��H���H���H�����H�sH�H0H��L������H��[]A\�@��UH�պSH��H�������@H�hH��H��[]Ð��H��H��H�=��*H���ʊ�H��H���*L�H���*H���ff.���H��uH����K�ff.���H��H��H�=��*H���o��H��H���J��H�3�*H���ff.���ATI��UH��SH����G�H��t%�xuL`�C0�P�S0��t&;S4t!H��[]A\ÐL��H��H��[]A\�^K�fD���C0H��[]A\�f.���H��H��H�=��*H���ĉ�H��H�����H���*H���ff.���UH�պSH��H������@�oE@ H��H��[]�ff.����H��hH����AVAUATI��USH�L�hI�L9�tcf��C����������tW��u:H�K01�H�AH�)H�s8��t%��L�t�DH�UH�3L��H����L9�u�H��@I9�u�[]A\A]A^�fDH�3H�S L��H��@��I9��t�����f�H�SH�3L��H��@��I�I9��T����f�H�SH�3L��H��@�6�I9��4����f��ff.�@��H��H��H�=^�*H���9��H��H����H���*H���ff.���ATI��UH��SH�6H��tZH��1��"L���6�CH��H��H�D�H�0H��t1H�PH��u�H�xtH�PL������H�PL���I��f�L��[]A\����H��H��H�=��*H���~���0E�H�9�*H���@��H���p5���H��H��H�=^�*H���C���P�H���*H���@��H�G �����o������o��H�H��������H���uH��f.�SH��H���H�Ǡ�i�H��������H�[�f���H��hH��t H�@1�H��p�H��hH��fD��f���H��XH��t H�@1�H��`�H��XH��fD��f���ATI��H��USH��dH�%(H�D$1�H�t$�"�H�ŋD$��t#�@)�L���H�t��.B�D$9�s�H�D$dH3%(u	H��[]A\��(���UH��SH��H��H�v H9�t���H��H�����H��H��H��[]�JK�f.���H� ��USH��H����HH��@1��$�H��PH�����H�56�*H��H��t
1�H���l���H��H��1��_����o��H�����o�����o����H��[]��H�=��*�a������ff.�f���H��H��PH�|$H��tH�@�*H�8H��P H�|$HLJP�G|u	H���@H�|$�>%�H���f���AVAUI��ATI��UH��SH��H�ǠH��dH�%(H��$�1����H���uhH���u^M��L��H��H�������t�E��u}�C| uw�H���h��H��$�dH3%(ueH�Ġ[]A\A]A^�DI��L�����H���L���&�H�5E�H��H��HI��D��h���fDL��L��H����/����ff.���H���H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�H���$H�D$H�D$ H�D$�D$0�-��H�D$dH3%(uH���������AW1�AVAUI��ATUSH��H�5]�H��H������H���
4�I��@tA�	H���#�sH����I��@H����H�A��HH�5�1�H���3�A�E|�LI���H���fI��Pt)�	H����nH����I��PH���H�I��XH��tIH�(L�pI�L9�t:fDL�e�	H��H���k�cH���^�I�t$H���1H�I9�u�I��hH����H�(L�hI�L9���L�5&�f��	H����E�������������utH�M01ҾLH��H�AL�!H�u8I�����H�uH���G�1�D��H��H�5X�2�E��t.A�G�M�|�f��	H��I����I�t$�H���bG�M9�u�H��@I9��P���H��[]A\A]A^A_Ð�TH��H��@�O�H�u�H���#G�H�U�M�H��H�5;�1��1�I9�����밾IH��H��@��H�u�H����F�H�U�L��H��1���1�I9������t���@�SH��H��@���H�u�H���F�	H����H�u�H���F�I9�������,���@�	H����aH���~�I���H�������E����lH��1�H�5P��!1��x���ff.����AWAVAUI��ATUH��SH��H��HH��XdH�%(H�D$81�H��t1���H�}H����H�uH�L$(H������A�Ą��UH�UL�uH����H�D$$H�-(�H�D$H�D$0H�$H���H�D$fD�
L�z�A�<*����HcD�H�>���I�~H����H�4$�z��J�T$01�L��H���3��@H��PH��tH���*H�8H��P HǃPL����<�H��PM��I�QM�qH���V���fDH�\$8dH3%(D����H��H[]A\A]A^A_�f�I�vH�$L��H�T$�{�����M�NI�QM�qH��������@L���@A�H�D$0H���H��X�H��XH��������K���H��`H��XH�4$�!�M���/���fD�K|M�����zuH���I�EE1������L���H�߈L$���I�v�L$I��H����M�N��L��~P��S����T���@H�$H�P I�vI�~�b�����ZM�N����H��I�E�i�����I���@I�~H�pL�L$�L�L�L$�������I�vI�H�=�1��LB�I�E����H�*�E1�I�E�%���DH���I�E����@��uI�L�L$�A�L�L$���/���A�GI�vH�{L�L$�(�L�L$I�G����fDH�t$0H�=�E1��A�I�E���H�t$(H�=��1��A�I�E�|���@H�{� H������H�Hǃ`H��XH�D$0����@�@H�t$I�~L�L$�.�L�L$����t$$H�{L�L$H�����H�����I�G8L�L$I�G0�D$$���%���I�vA�H��u�D��I�4�H����H�{L�L$A���'�H�4$H�D$0I�W8I�0�8�D$$L�L$A9�v�M�������L��H�=��E1��n@�I�E�]���DH���I�E�)���I�VH�L$0H�=��I�7�8@�I�E����A9�s�I�7H�=�1��@�I�E���I�VI�7H�=�1��?�I�E�����]��H�=��|��ff.����UH��SH��H��H�����H��H��H��H��[]�$+�@��ATUSH��H����HH��@dH�%(H�D$1�H� �K���H����I�H��I��H�����L�����H��H��H����t+�o��H����H�L$dH3%(u)H��[]A\�H�$L�����H�=�H��H��1��{���V��fD��AUI��ATUH���SH��H�_ H����K4��� H���H���Q6����S4H�݅�u.H��hH��tH�xuH��XH����H�x��I�E L��H9�u	H9�������H��L��I��H����I9\$ tH��tH������I�|$ ��I�\$ H9�tH��tH������I�|$ ���I�l$ H��L��[]A\A]�@H�m H���r����E4���9����b���H�[ H�������1��K���@H��[]A\A]�i��f�H���'������H��H�i�*H�|$H�=U�*H�t$��H���fD��H��H��H�=.�*H�7H�WH�H9��Fw�H;t5H��H��H9��.w�H9u�H)�H����H���*H��H����)�1���ff.�f���H��H���*H�|$H�=��*H�t$�[�H���fD��H��H��H�=~�*H�7H�WH�H9���v�H;t5H��H��H9���v�H9u�H)�H����H�F�*H��H���Q)�1���ff.�f���H�ǰ�@����H�����S� H�Ÿ*H�;���H�;� H�����H���*H���*���H�;��H�����H���*H���*��H�;��H�����H�r�*H�o�*�r�[H�N�*H�?�*�ff.���AUATUH�-x�SH����C���4�����H�U�*H��t(H��@H�S H��1�D��HH���1/�H�[H��u�H���*H�L�hI�L9�t>L�%��*H�+I�<$H�u H��t
H��P I�<$H�E H�H��H��P I9�u�H�=��*����H�=��*����H�=u�*���H�=Y�*���H��H�=9�*[]A\A]���f.�@���ff.�SH�H�H��t�C����t���Ct[�H�{ ��H�H��tGH�SH�PH�CH��tH�H�H�CH���*H�H��[H�8H�H�@ ��f.�H9)�*H�Cu�H��*�f.�SH��H�� �S���H��tH�W�*H��[H�8H�H�@ ���[�ff.���SH��*H��u�%DH�[H��tH;{u�H�{ ���H�C[�fDATA��US��H��dH�%(H��$�1�H��H�}���s��H�_
H��D��H�$�1�%���$��H���5s�H��$�dH3%(uH�Ġ[]A\����ff.��ATA��U��SH��dH�%(H��$�1�H��H�{�����r�E��uLH���DŽ$�H�$1�H�މ������r�H��$�dH3%(u$H�Ġ[]A\�DŽ$�H�$��n��ff.�USH��H�3�*H��u�$@H�[H��tH;{u�CH��H��[]�H�a�*H���(H�8H��P�5r�*H��H�h���trH��A��H��jL�
�H�
ٻ��=��*1�H�C Z��YH��@����H���*H�H�CH��tH��CH��H�s�*H��[]��q��SH��H�� ���H�4�*H�8H��t���H�C [�f���*[��ATUH�-6�*SL���fDH�]H��u�MDH�{ tH�[H��t8�Ct�H�{ �)���H�{ u�H���*H�8���H�C H�[H��u�fDH��L9�u�[]���*A\�ff.�S���*@��tD�����*H�t�*H��t,�H�{ H��t�a�*1���@���l�H�[H��u�[Ð����p���7�*�ff.�f���AWAVAUATUSH��H�$H��H�$H��hD�=��*dH�%(H��$X!1�E���'H�\$H������H��$�1�H��H���E����p�=�*H��$!�@��H��X�lp��E��8��p�1�H������Up�H��$X!dH3%(��H��h![]A\A]A^A_�@H�!�*�L��$���*H��H��L���H�H��H��1�H�ȹ�H�������o�E1�L�5��*L��H��A�,��u I��I��?�]���L��H��A�,��t�K��H��t�H�S H����o�L�E1��5DH�a�*H�H9Bt+�K(A�H�[H��t*H�S H����C�t�t�H�sH��H�[H��u�E���j���H�5�*H����H�
�*H�F1�H��H������������n�D��A9���H���1��@�����n�H��9�t��9�u�H��H�=��*�.����H�
��*�~�*H������H�A1�H�5|�*�D$�������H�1�H�$A��L��H��H$Hc���rn�H�
o�*L�,�M���|I�M H����m�E1��.H��*H�H9At1E��DM�mM��t2I�M H����A�U����u�A�E(u�A�e(�I�uH��A�U��E��t��;l$�\������H���*L��H���*H�8H��H���V�H�1�H�AH�5��*H�D$H�H�$�H��*�H�����H�8��H�R�*�H��H�@�*�8���1�����_����l��Cm��tm�H��*H��tDH�@1�H�5�*��t3H��*H�H��*H��u�H�@H��tH;Pu�H�x �`��������H���*���*H�8t �:�*��~H�����H���l���@�c�������tX���t@���t+��tV��u
��t|��tgH�=�1��	1�f�H�q���H�Z���H�E�����tK��t6��u�H�_��f�H�:���H����H�ɶ��H�8�����ATUH�-��*SL���f.�H�]H��t'�H�{ tH�{ �����^�*H�[H��u�H��L9�u�[]A\�f����=:�*t#H�4�*H�8t�ȿ*��~������ff.�@��AWAVAUATUSH��H����k�?��k�H�-�*Lc�A��I��J�|�I��tYH�:�*�0H�8H��PD�pH��A��L�(L�xJ�D�H�CJ�\�t	�=+�*�t1H��H��[]A\A]A^A_�+����=��*t������H�=�*�����j�=޾*����=Ҿ*����=��*��,��=��*�����v������H����?��j�Hc�H��*H�<���j�@��H�����ff.�f���UHc�SH���*H��H�<�tC����H�<�H��H��t(f.�H�_�G(t�-��*�j�H��H��u�H��[]�ff.���ULc�H�q�*SJ��H��J��H���=j�H���fDH�XH�@H���!j�H90u�H9Pu�H9�t3H�+H�EH��E(uH��H��[]���1��Z���H��H��[]���H�xuƾ����f���Lc�H���*H��J��H��u�i�H�@H����i�H9u�H9Hu��P(�у�@8�uH��É��@����	ʈP(H������ff.���Hc�H�b�*H��H��H��u�Xi�H�@H���Ki�H90u�H9Pu�P���ri���Ai�H�����H������f���UH��AWAVAUI��ATSH��8dH�%(H�E�1����H�}�Hc0�8��L��I���-��L��H���"��H��L�4I��I�FI�NH��H%�H)�H���H��H9�tH��H��$�H9�u��u[H��L��H��H�M����H�<L��L���
��H�M�H��B�4
H���a�H�E�dH3%(uH�e�[A\A]A^A_]�H)�H�L�������AWAVAUATUHc�SH��dH�%(H�D$1��D$��?��E�I���.���%�p��I��D�0H���*H��H����H��H�-|�*L�|$H��H��fDH�sL��H�[H�����Ct�E��u��Ao$�=�*)E�AoL$)M�AoT$ )U �Ao\$0)]0�Aod$@)e@�Aol$P)mP�Aot$`)u`�Ao|$p)}pu��=k�*�L���r��H��tH�=e��`,�H�[���*H���Z���@E�uH�D$dH3%(u'H��[]A\A]A^A_�DH�i�*��������������UH�=����H�-m�*S1�H���K�*����H�=c����fDH�D�H��t
�p����H��H��?u�H��[]���UH�-�*S1�H��DH�|�t���)��H��H��?u���*���uf�=C�*���u+H�=��*tH�=��*�p��H�=��*�nf�H��[]��f���f�=�*�S���f�H�=S�*H��*����u��@��SH���0��t
H�s�S�{09{w�C0[�f�H�{8�"��C0[�ff.���ATUS����f�GH������e�H�9�*H��I��@H�8H��PH�H��K�H��u�@�H��*L�`H�h�o@ []A\�f���SH�H�H�{8��!�H��tH�̤*H��[H�8H�H�@ ��@[�fD��H�8t
�G01��fDUH�w SH��H��H�-��*H���,��{9�~�C0�P��S0;w#H��[]�@�oE�C0�C �ސ�C0I��H�
����KH�5��&�H�C81��fDAWI��AVAUI��ATUS�G�D$�G�D$ċG �D$ȋG(�D$�H�H�D$�A��|$̋t$�I�EpH�ŋD$�A�I��1�I�MxH�ʉ�!�1�E�Q�T$�1��\$�D�T$��M���E�A!�1�M���E�aщ��1�M���E�q��!�M���1�D�M��A��A1��D�T$��D��M��A��!�A1�D�D$�1�D���
A!�A��A1�E�A�L��A��A1�A���\$�E��E�qE��E!�A1�E1�D�t$�A�M���A�A�IA��E!�E1�D��I���A1ljL$�E�A�A��E!�D1�E��E1�A�A�I A�A��
H��I���D!�E1�D��D1��A�I$D��I���A!�1��L$�E1�A�A�I(E�A��I���I��D!�E��D1��D�E�y,��M���L��A��A1�E1�A�A0�L$�E��A!�I���A1�A�E�I��A��
E!�D��E1�A�A�A4A�I���H�lj�A��D1�D1�A�A8D!�1�I����D�I����!�A��D1��A�A<�I���H��D���1�!�D1��D�F��%�y�ZA���
A	�A!�A!�E	�A��E�D�t$�A!�A��E���y�Z��	�D!�D	�A��D�D���y�Z��E!�D	�!�D	�E��D�E���y�ZD��A!��		�!�D	�D�|$�D�G��'�y�ZA���
A��A	�A!�A!�E	�A��E�D�t$�A��E���y�Z��	�D!�A!�D	�D�|$�D�E���y�Z���A��D	�E!獄�y�Z!�D	�E��D�E��A!��	A	�A!�E	�D�|$�AƉ�A��
G��'�y�Z	�A��A!�D!�D	�A��D�D�d$�E!���E���y�Z��A���y�ZD	�!�D	�E��D�E��A!��A	�G��0�y�ZA!�E	�A��Aԉ�A!�A��		�D!�D	�A��D�D�t$�E!��
E���y�Z��D	�!�D	�E��D�D�t$�A!��E���y�ZD�፬���n	�!�D	�D�|$�D�G��'�y�ZA���A��A	�A!Ǎ����nA!�E	�A��E�D���y�Z��A!�A��		ʉ�D!�D	�D�|$�D�D�t$��
D1�1�E�����n�D��1����1�ً\$�	B��#���n��E��
���nD�d$�1�1���1�����1�1�D�D�\$��E�����n���1�E�����nD�A��A1��D��1�E�����n�\$�1�D�A��	A1�E�A��A1�A��D��A��D1�D�E�����nD�|$��E1�D�؍����n1�D�E�����nD��D�|$��1�F�����n1�D�A�Љ��	A1�A1�1�E�D�T$�A��D1��A�����nA��E1��D��A�ҍ����n1��A�����nD����1�G�����n1�A1‰��D���	1�1�D��1���D$�I��@T$�|$�L$�L;L$����D$�I�E�D$�I�E�D$�I�E �D$�[]I�E(A\L��A]A^A_�ff.�f��������H�G#EgH�GH-��WH�G H�G(vT2H�H�G�f��������AUL�o0ATI��UH��SH��H��H�H�OH��H9�H�H��H��H��Hʃ�?H�WtV�@H�|0H)�H9���������`��t�����aL�m0I�H��@L��H�\����H��?���؃�rYI�$I�}L��H��I�E��I�T�I�T�I)�B�+L)���r��1҉у�L�L�9�r�H��[]A\A]��������t�A�$A�U�t�A�T�fA�T���H��L��H���?H�����I���[���H��H��[]A\A]�N��fDH�L�GM��I��H���H�t�H�t�L)�I)�׃�������1ɉ΃�M�2M�09�r�����@A�$A�UA�T�A�T��'�������ыt��t�������t�f�t����ff.����������AT�@L�g0UH��SH�H����?H�r�D0�H�L1H)�H���P�8H)��1�����������t����H�L��H�ߺ@H��H��Ch�C�Cl���H�CH��1����EH�CH���EH�CH���EH�CH���EH�C�EH�CH���EH�CH���EH�CH���EH�C �EH�C H���E	H�C H���E
H�C H���EH�C(�EH�C(H���E
H�C(H���EH�C(H���E[]A\�U��DH�q��H�H�D�H��H)�
����������1҉у�H�<9�r����D1���s9�����t�����@L��H���j���L��8�}���DH�q��H�H�D�H��H)�ȃ��r���1҉у�H�<9�r��D��D��J���D1�f�T��9���@����D��a�����1�f�t��S���ff.�f���鷽����AUI��ATI��UH��SH��dH�%(H��$�1�H��H�����L��L��H���*�H��H���_��H��$�dH3%(uH��[]A\A]��	��f�AWAVAUATI��UH��SH�GL�oH�D$�H�G M��H�D$�H�G(H�D$�H�H�D$�D�]�x�j�HD$�A��ν�H�t$�A��|�I�\$pH�<�UH�\$�H�\$�I�T$xH��H�T$�H1�L!�H1�H�H��H��H����H	�I�<�V���H�H�4H��L1�H!�H1�H�H��H��H��%�H	ȋMH�4L��H1�H���p $H�L$�H!�I��$�L1�H�I��H��I��%��L	�D�}H�K�J�8H��I��L�|$�H1�M��$�D�MH!�H1�M��$�H�L�L$�I��I��L��I��I��
A��?M�L�I��I	�I1�I�L��D�mM1�M��L!�H1�M��$�H�L�l$�H��H����H��H	�I��5*ƇGL��L�H!�I1�H1�HιF0�H��I��H��I����L	�D�UH�L�M��$�D�}H�L��L�T$�H!�M��$�D�m L1�H�M��$�I��H��I��H��M��A��F�A��I	�K�L�I��I�I1�M!�I1�I�I��ؘ�iH��M��I��
L1�I��A��?L��A��[��L	�I�2H!�H1�Hȹ��D�I��H����I��I	��E$I�H�I��$�H�L��H�D$�H1�L!�L1�H�H��H����H��H	��}(I�J�I��I��$�M1�L�M��D�],I!�I1�M��$�Iʹ��\�L�\$�L��I��L�A��H��L	�L�0H�4L��H1�L!�L1�H�u0H��H��
��?H��H�t$�H	�J��"�kI��I��$�M1�Lʋ]4L��H!�I��$�H1�H�I��I��L��I��I��M��A��q��J�4A��M��I1�I	�H�I�L��L!�L1�H�I��I��L��I��I��L��D�E8%�H	ȹ�Cy�M��$�L�L�J�4	H��L1�H!�H1�H�u<I��H����I��I��$�I	�H��!�IL��I�H1�L!�L1�H�H��H��
I��H��L��A��?I	ʹb%�HL$�M�L�L1�I��I!�M1�I�L��L��H��H����H	ʹ@�@�L�HL$�H�L��H1�L!�L1�H�H��H��H��	%�I��H�L$�I	�H��I�J��	QZ^&L1�L!�H1�H�I��I��L��I��I��A��?I	ɹ�Ƕ�HL$�M�L�M��M1�I!�M1�I�L��I��L��H��%��H	ȹ]/�L�HL$�H�L��H1�L!�L1�H�J��SDI��H����I��I	�H��I�L1�L!�H1�H�H��H��I��H��	A��I	˹���H�M�L�M��M1�I!�M1�I�L��I��H��H��L��M�ف�?H	ʹ���HL$�L�H�I1�L��L!�L1�H�I��H��%��I��I	�H�D$�I�J�����!H��L1�L!�H1�H�H��H��I��H��L��A��I	ʹ�7�M�L�L1�L�I��I!�M1�I�L��H��	H��L��H��%�H	ȹ�
��HL$�L�H�L��H1�L!�L1�H�H��H��H����?I��K��
�ZEI	�H��I�L1�L!�H1�Hʹ��I��H��Hف�I��L�M��I	�M�M1�I!�M1�Iʹ���HL$�L��I��H�L��A��H��L	�L�H1�L!�L1�H�H��H��H��	%�I��K���ogI	�H��I�L1�L!�H1�H�H��H��H��%�?I�˹�L*�HL$�I	�L��I�M�L1�H��H!�L1�L�I��H����I��I	ɹB9��HL$�M�Hʹ��q�L1�H�H��H��H��L��L�M��H	�M1�L�I1�I�H�L$�L��I��A��H��N��"a�mL��L	�H1�H�H1�L�I��H��I����I	ʹ8�L�I�L�I��I1�M1�I�L��I��	A��H��L	�A�D꾤L�LL$�L�I��M1�I1�I�L��H��I��L��L�L$�H����L	�M�����KM��I1�H�L��H1�L�I��H��%�I��I	��`K��L�I�I�H��H1�L1�L�I��H��I��M��D�иp���H�M	�L���~�(H�H��M�L��L1�L1�H�H��H��H��	L1ҁ�H	�H��L�H1�L�H��H����H��H	ʹ�'��HL$�I�L��H�H1�H1�L�I��H��I����L	�L�
��0��HL$�L�I��I1�M1�I�L��I��H��E��L	�L�T$�L�M���H��L1�H1�L�I��H��	%��I��I	¸9���HD$�H�L��I�H1�L1�H�H��H��H����I��L��I	Ӻ���HT$�L�I��M�M1�L1�M1�I�L��I��A��H��L	�L���|�L�H1�L�I��H��I����L��H	��eV��HD$�L�M��H�I1�I1�I�L��I��	H��A��I���D")�HD$�I�M	�H��I�H��I����*CL	�H1�L�I��H����?I��I	�H��M�H��L	�L1�H�H��H��%�H��
H	¸�#��I�L�I�L��H��H	�H�|�PHD$�L1�L�I��H��I����M��M��I	�I��J�H��I�M��H��L�D$�M	�M��I1�I��I�L��I��H��A��I	�K���Y[eM�L	�L1�Hȹ}��I��H��I����?L	�M�����HD$�H�L��L	�L1�H�I��H��I��
��H�L	�M��L�I��L�M��M��I	�I��M1�O��O~�oI˹�]��HL$�L��I��L�M��A��H��L	�A�C�H�I	�I1�I�M��I��I��A��L��I��L	�I��H�L��H	�H1�L�I��H����?I��I	ȹ��,�H�I�H�H��L\$�H��I�H��L	�H��H1�H�H��;�NI��H��I��
��M��I	�M�L	�L1�L�H��H��H��%�H	�L��L�H��H	�L1�H�I��H��I����L��H	Ѻ�~S�HT$�L�M��H�I��I	�I1�Iк5�:�M��I��I��HT$�A��?L��I��L�L	�I��H�M��Ht$�I	�I1�I�H��M��I��H��I��
A��M	�J�<L�L$�H	�I�����*H1�H�H��H��H����H	�H���ӆ�HT$�H�H��H��H	�H1�H�H��H��H����H	�H�I�HD$�H��@H|$�H;l$��?�H�D$�M�t$I�D$H�D$�I�D$ H�D$�[I�D$(H��]A\A]A^A_�ff.��������ܺ�H�G#EgH��H�WH�xH�w�H�G�vT2H�G�H�G�H�G�H�GpH��)����1����H��ff.��������AUL�o0ATI��UH��SH��H��H�H�OH��H9�H�H��H��H��Hʃ�?H�WtV�@H�|0H)�H9���������`��t�����aL�m0I�H��@L��H�\���H��?���؃�rYI�$I�}L��H��I�E��I�T�I�T�I)�B�+L)���r��1҉у�L�L�9�r�H��[]A\A]��������t�A�$A�U�t�A�T�fA�T���H��L��H���?H����I���[���H��H��[]A\A]���fDH�L�GM��I��H���H�t�H�t�L)�I)�׃�������1ɉ΃�M�2M�09�r�����@A�$A�UA�T�A�T��'�������ыt��t�������t�f�t����ff.�����w�����AT�@L�g0UH��SH�H����?H�r�D0�H�L1H)�H���P�8H)��1�����������t����H�L��H�ߺ@H��H��Ch�C�Cl��H�CH��1����EH�CH���EH�CH���EH�CH���EH�C�EH�CH���EH�CH���EH�CH���EH�C �EH�C H���E	H�C H���E
H�C H���EH�C(�EH�C(H���E
H�C(H���EH�C(H���E[]A\���DH�q��H�H�D�H��H)�
����������1҉у�H�<9�r����D1���s9�����t�����@L��H���z�L��8�}���DH�q��H�H�D�H��H)�ȃ��r���1҉у�H�<9�r��D��D��J���D1�f�T��9���@����D��a�����1�f�t��S���ff.�f��������AUI��ATI��UH��SH��dH�%(H��$�1�H��H���X�L��L��H�����H��H��蟴�H��$�dH3%(uH��[]A\A]��I��f���AUATUSH��H���]E�H�b�*I��I��H��H�;(H�8H��PL�(L�`H�XH�h�@ H��[]A\A]����H���r�*���&E��a�*H�:�*H���D��H���G ���!E��G H���f���SH�H��C ���JE���C u.H��*H9��
E�H�{�SH���*H��[H�8H�H�@ ��[�ff.���H���G ���E�H������SH�H�H������E�H��tH�$�*H��[H�8H�H�@ ��@[�ff.���H�GH�H���H�G�����f.����AUATUSH��H9���D�I��H��H��H���X��L��I��I�$�P8H�I9�vH9�wH��[]A\A]�L��L9���D�H��[]A\A]�f���H���@��1��f�H��H���E�H�F�H9v���D�H�N�H��ukH�V�H��urL�N�L9O rrH���D�H��t8H�QH�V�H��tH�N�H�
H�F�H�F�H�V�H)W H�oH���f�H9G(u�H�W(H�V��H9At��D�DH9t���C��D���USH��H���>����{0H��uH��H��[]����H�@H��1�H�P ���H��H��[]����AVAUI��ATI��UM�t$ H��S���L��H�����H���\D�H��M9�wML�cM���]D�H�H�E(H�CH��tH�H�C H�](H�CH�CH�EHE H�C[]A\A]A^�L��J�|( 1�L)����@��H���G����C��GH���f���UH��SH��H�G(H��t"f.�H�XH�pH�����H��H��u�H�} ��C�H�}��C�H��[]�ff.���SH��C����C�H��C���C��~	[��H���h����{0uH��[�Y��f�H�ߺ81��!��H��[�8�����ATL�f UH��L��SH������H���jC�H��H�hH���pC�H�H�C(H�BH��tH�H�jH�B Hk H�BH�S(H�C[]A\���H���8��I��H���C�H�
�'*�`�H��@H���fD��H���S���@0H���f.���H�G ����H�GH�W H��H�D8�f.���H�
��@���G����H�GH�@���H�OH�AH�QH�� H+AH)�H�H9�t�@SH��H��1�H���W��H�CH�PHPH�CH�@[�ff.�f�SH��@��uH��[鎖�fDH�FH��1�H�P �V��H��[�m��ff.�f���USH��H��H�wH�H��t �H�C�{ ���H�sH�H��u�H�FH�~HH�h�H��H+V1�蝽�H�CH�hH�CH�@H��[]�f���SH�H��C���C��~[�f�H�C�{ �#���H�sH�H��u��{ [�
���ff.�f�AUATUSH��H�� �!A�H��H��H��?����LA�H�/I��H��t2I��������H�EH9�H�HF�L9�H��L��IG��s��L9�HFؾH������H����@�H�� H�(I�$H�XH�XH��[]A\A]����UH��SH�^H��H��H�OH�QH9�r&H�AH)�H)�H�QH�UH�D H�ZH��[]�@H�s H�����H�MH�Q�Ð��I��H9�vqL�OH��H��I�AM�QM�YH�� L)�L)�L�H9�t*UH��SH��H��H���V���H��H��H���8��H��[]ÐH��L)�I9�r�M�I)�M�QH�GH�HL���ff.�@��Sf�H��0dH�%(H�D$(1�H��H�)$*D$H�$C�D$�D$H��GwH�~H����H��H�{����H�$�(H��Pfo$foT$PH�T$ H�P H�PH�:�w?�H�L$(dH3%(uH��0[�衯���H��裫��@ H���f.���H��H�q#*H9�K?�H�W1�H��tDHBH+BH�H��u�H�����H��H�1#*H9�3?�H�W1�H��tDH�JH�H�D H��u�H���f���H� ��@���ff.����������H��H��w*�9G��>�H��Ð��H��H��w*�9G��>�H��H���j��f.���H��H��w*�9G��>�GH���ff.�f���H��H�Yw*H��9B��>�j��>�H�H���ff.�f���H�w*ATUS�9G��>�I��H��H��H9�rL��[]A\�H��L�����t!H��I�<1�H)����L��[]A\��H�����L��H��H���J��I����D��H����^��H��v*H�
0�*H���H�@�PH������H�k��@���ff.���1��f���SH��H���k��H����=�[���H��鴐�@��ATI��UH��SH��H���tH��uDL��H���y��I��H����=�H9�rL��[]A\�H��H�<1�H)����L��[]A\��H�����H9��K=��ff.�f����f.����H�y��@���ff.����ff.����'�����H�����@��ATI��USH9�rL��[]A\��H��L��H��H�����tH��I�<1�H)����L��[]A\�f�H������L��H��H���Z��I����D���ff.����f.��AWAVA��AUA��ATUH��S1�H��h�T$L�D$dH�%(H�D$X1��D$����1�����H��D��A�����D��A������E��x91�H��1����A�ĉD$���uy贒�8�C<��:<���D蓒�������&��D�d$A�����;�H�L$XdH3%(D���]H��h[]A\A]A^A_�f.��t$D����r����A���t<A��u3�|$D������y#���H��H��D� 舧���;��;�H�|$A�a1�E1�L�W�H�
��H�8�����I���f���&���H�|$1�A�2L��H�
Z�H����޻��y��H��H��D� ����D�#A�����|$�����I�ŋL$H�5ɈL��1�H��I�����H�t$ D�����~H�T$ H�5T�L��1����A���tvH�5��L��1�D���r��|$H�t$ �Ԩ�~H�T$ H�5�L��1��J��D�#L��A������I��H�=�SH��1��H���#����;�'�����9�DH�����H�5�L��1����묿��|$�I������H��H�����H��1�H�5·�����2���H�L$D��H��H�=C-�'��H�=8PH��1���D�d$����G���AWAVM��AUA��ATA��U��SH��H��(dH�%(H�D$1����1҅�x)H�L$dH3%(����H��([]A\A]A^A_�@苏�8I�����/H���b��H��t}H9�H�D$tsH�=���H�t$H�߉D$���M��D��D��H�lj��C���H�|$�D$�5���'9�D$��yA�?uD��M��D���H��������=���fD������-����1����E1����@��I�ȉѺ�������ff.�f���E1����@��I�ȉѺ�������ff.�f���������������AUI��ATI��UH�-��SH��H���5�K��8uV�H��H�������t@�/H�����H��uFH��L��H�޿���x�I�]H��1�[]A\A]�fDI�]H�������[]A\A]�@H��H�����H������H��E1�A�����1��"��Ϧ�ff.�@��1����D���w�����ATA��UH����S���H��dH�%(H��$�1�H�����xcH�t$0H�uH��teH��������H�V�H9��&7�E1�A�عD��1��)��H��$�dH3%(u*H�Ġ[]A\�f.�H��������1������������f�����r��f���H���C��1҅�y�x��1҃8&��ډ�H������H���*H��u H�����H�H���*H���f��f.�D��H�L�<�H��L��H���H�pL�������ɹHD�H���H�rH��������HD�H�����f.�SH���g��H��v H���H�=σH�4��€���t	H��[�@H��H��[�l��ff.��USH��H��H�G H��t�G(uhH�=��輄�H��t_H�3H�-�n*H��t
H�}H��P H�sH�H�}H��t
H��P H�}H�CH�H��H�@ H��[]��fD���@H�{����5��D��UH��SH��H�����H�}H��H��[]�	��f���ATI��UH��S�݋�H��H��t
H��[]A\�D���H����4�H��[]A\�f���AVI��H��AUATI��US��M��tLH��L�-e��I�^H��L��H���΋�uH�4+�>t1�L�������tM�v0M��u�[1�]A\A]A^�f.�[L��]A\A]A^�@��USH��dH�%(H�D$1�H��tUH��H�l$f��C(�u3��H�{�C(t&H�=Ձ���H�߉D$�SH���}����3�H�[0H��u�H�D$dH3%(uH��[]�萡���AVAUATUSH��dH�%(H�D$1�H����H��H��1��H�x t
�P(������H�@0H��u����H�=>��'���H���$��1ҍM�@H�{ t�C(t��)փ�H��H�[09�r�H��L�t�L�l$L�%��@L��H�+����D$�U L���~����2�H���e(�L9�u�H���a����2�H�D$dH3%(u
H��[]A\A]A^��w�����UH��SH��H�?�[��H�}H��tf�H�_0���H��H��u�H�EH��[]���SH���H�=�H��H�S�����HD����t$�PЀ�	H��v�<@�HЀ�	w0H�����u�H�5
�H����H��t!H��H��[�-��DH��<_HD���@H��[���AWAVI��AUATUSH��H���H�|$ H�=�H�t$H�L$L�D$(dH�%(H��$�1��R��$�M���
L��H�5��s��H�8I��H����H��1�����sH�EI�,�H��H�}H��u�H�
�j*�L���(��I�^H���;A��A�f.��E�H��I�<�豷�K��tE�eH�M��K��EI��H��H��u�H�D$ H�I�6H�(H�l$0H���1����CI�4�H��H����H���U��H��u�H�D$�@(�H�|$���I��H����H�=X~���H�����H��H��$��[��HDŽ$�H��$�HDŽ$��v��L��L�t$@I���H��$�H�D$H��$�H�D$8H��$�H�D$H�Y��H��tMH�h�x.H��$�t&H�5�}H���3��H��tH��趛�H���,A�EL�����H��u�I��A�EL�t$@���3L��軭���	H�5����H��$��_��H��$�1�H�AH�	H��$�H�L$8H�L$0H��$�H�ΉD$HH��u�+H��H�V0H��u�H�N0H�L$����H��$�L�|$XH�\$E1�H�D$@f�H�=�|�t��H�L$8��$�D��H�<�H��$�����H��I���9���H��H�CH��t
H�s H��Є�tXM��t5I�>H��tKM���fDI��I�?H��t4H�����u�H�ٰI�H�|$0H�����H�D$PH����H�|$@莆��9.�A��D9l$H�7���H��$�L�|$XH�D$0H��$�H��tH�H��$��PM���M����H�D$ H�L$0�����H��H�D$ H�L$0H�@H��$������1�1��¢�H�L$(H��DH�=p{���$�H��$�H��H�D$P�h��H��$�1�I��H�AH�H��$���tQ��L�|�H�=1{����$�H�;�%��L��H��誳���,�H�|$�X���-�H��I9�u�H�|$8�=����H��$�H������H��$�H�t$HH��$�H��$��s����fDH�H�D$0H�D$�@(��H�t$H�=�{1�螀�����f�H�t$H�=�+1��������I��M��u苁�1ۃ8���H��$�脄��L���D��H�L$(L��H�H��d*H�8H��P H��$�dH3%(����H���[]A\A]A^A_�fDH�D$ H�L$0H�M������������w����H��$�H�|$1�H�5�赽�H��$��H�D$`H�L$p�C(�H���|��I��H����H�)d*�8H�8H��PH�|$`H�����L��H�E���L�}H�EH�;� 1�H�5EyL��1��-��H��H��蒁�H����H�0H��:u:����<(����DH��������(���:t�H�=;{1�����H��H�D$P�g�H�T$PH�t$`M���t*�H�=�z1����D�l$HH�D$X�����H�t$H�=�*1����L��I���r��H��$�H���o���H�H��$�������P����f�I�V�����D�{(H�5�}1�1�L�����A��H��H��E���5���H�ED�{(L��1�H�5�w1�A���л�H��H��E�������H�E 1�H�5�wL��1�襻�H��H���
��H��t��H�}�xH�} ��H�{H�}��1�H�5�w1��^��H�}H������I��H����H�5��H�����H�sH��I���؉��p�����H�UH�5�xH�D$PH��1����I�|$L����H�|$PH�5&w1����L�|$PH�SH�5w1�L���p��L���x��H�D$PH�|$P���C(��H�D$H�(H�E0H�D$�����H�|$`�f��I��H���������H�=XvH��1��T��H�|$`�H�D$P�0��I��H��������x����H��$�H�L$����fD�C(�����H�5�{H�=�w1�����H�D$PH�E H����� �����;~��
���fD�+~�����fDH�}1�H�5v1�蜹�H�}H�����H�D$hH������H�D$hH�H�������L�|$pD�l$|I��H�l$pL��$�H��$�H�\$hf.�L�����H��M��tOM��DM�uH��L��L����}�u(I�4.�>���H�=Gt�������M�m0M��u���H�\$hH�l$pH��$�D�l$|L��$��(��H�5fuI��H�D$hL��H�1��L��H�SH��t#H�D$hH��H�5�tL��L�1��'���L���(��H�D$P���fDH��L�#M������H�l$pD�l$|L��$�H��$��v���f�H�D$�@(� ���I�6H��u����@I��I�6H��������>t�H�T$H�='v1��X��I������H�t$H�="%1��=��I���S���H�5��C(������"���H�t$`H�=t1��y�����C(��������L��H�=�tH��1��dy����H�|$PH�5�s1�����m���貒�� %��%��%���SH��H�� dH�%(H�D$1�L�D$H�|$H�|$������$�H�T$dH3%(H�D$uH�� [��H�����H��H��H��1�霕�ff.����H�����H�E]*S�8H�8H��PH�5JSH�=uH�����H�H���w$�H��[�ff.�@��AVI��AUATUSH��H�?dH�%(H��$�1�H����I�^f�H�-�tAFL�%��L�-�tH�C C�H��H����L�@�H��L����€������L��L����€���ti�L��L����€���tRH��I�VH�PI�VH�PI�VH�pH���z��t>H��H��$�dH3%(u;H�Ġ[]A\A]A^�I�>蘻�H���P���1���H�$I�F H�D$8A�F(�耐���USH��H�/�]0H�H�}��H��t�hu�H��[*H��H�8H��P H����[]�ff.����ATf�I��UH��H���SH��H��dH�%(H��$�1�H�B BH�T$耵�y<�w�8��"�1�H��$�dH3%(�H�İ[]A\�f��{{�H��H�D$��H�|$膕�I��H����I�t$H�L$H��@����H��0�	�H��H��0�	�9�u�H��H��H�� H��H�����H�� %������	�	�9�u�I�4$H���~��H��H�I�t$�n��H��H�CI�t$�]��H�|$H�CI�D$H�CH�D$H�C ������@H�|$�������詎�f�����f9�t	)��fDf��t*f��
uH��H���隢�f.�1��DH��H����v��fD��H���C����H���f���f�?
uFH�W�GH��f.�H��H9�t%�
��ȉ����t�%�����H��1�H9�u�Ð�G�ff.����ATf�1ҾUH��SH��@�?dH�%(H�D$81�L�d$1�D$f�|$I�D$fA�D$���ÉD$����9 ��Ef�D$f��
th�E��D$��L���:��H�|$���tWA�
L��p1�1�H�
�rH�4g���H�L$8dH3%(��uEH��@[]A\���oM�L$�A�L�ApH�
Kr1�H��f�Ş��讌�ff.���H���S��xH���f.��+t�8h�_�H���ff.�f���@�������AT�lUH��SH��H��dH�%(H��$�1�H�\$H�D$L�CH�{H�CfL��H)���l���H��L��f�D$�4����1Ҿ����A�ĉD$���������l�|$�nH������x*D�d$H��$�dH3%(D��ubH�Đ[]A\��s�8st�H�|$A�+1�A�����L��nH�
�pH�ce�I������r�A������$�������AVA��AUI��ATUSH��0dH�%(H�D$(1�I��H�l$L���j}��I��{r���t��ou?�
���xi�'���H���/}�L��H��脝�A9�~L��觪�Ã��t�H�T$(dH3%(��u
H��0[]A\A]A^��\��ff.����H��@���A�dH�%(H�D$1�H�L$�t$��f{�H�T$dH3%(uH�����ff.����H��@���A�dH�%(H�D$1�H�L$�t$��{�H�T$dH3%(uH���蜉�ff.����H��@���A�dH�%(H�D$1�H�L$�t$��z�H�T$dH3%(uH����<��ff.����H��dH�%(H�D$1�H�����w7�t$H�L$A����Az�H�T$dH3%(uH���@�p�������������H��dH�%(H�D$1�H�����w7�t$H�L$A�����y�H�T$dH3%(uH���@�p����������Q����AU�lATU��SH��H��H��dH�%(H��$�1�L�l$H�D$M�EI�}I�EfL��H)���l���H��L��f�D$�0����1Ҿ����A�ĉD$������nL���������|$��腵�u1D�d$H��$�dH3%(D���xH�Ę[]A\A]�@�o�8b�w�H�|$A�*1�A�����L��jH�
�lH�Oa�5�����n�8bt��I��n�A������$�n�����D��AVA��AUE1�ATUH��SH��dH�%(H�D$1�D��H���̓�ÉD$���uQ�\n�8bI��uDE��u?H��跦�D$���uNA�<$ouG�@H�5�iH��A���y�A�$b�H�L$dH3%(��u?H��[]A\A]A^ÐH�|$A�:1�L��iH�
UkH�C`�)��A�$b��
��f.���USH��HdH�%(H�D$81����,�f�H��H��H�D$ H�t$H�T$)D$�D$(�D$���f��xO�T$f��t|H����1�Cf�Kf�f��
��f����CH��t'1�f�U�f��l���tt��gto�����H�L$8dH3%(��H��H[]��H��t
�CH��t�1�f�u��@H��t�f��
t
f��u���T$f���s���f�������f��T$�SH��u��u�����oL$KH��u��Z���菄�ff.�@��S����H��H��?�������>��H��H��tBH��?���t
H��[����k���t��t��ht��nu�H�������@1����k�H���������ATf�I��USH��0dH�%(H��$(1�)$H�D$�D$H�����f�$f��
tl�G�D$H�l$ H��H��E1�jH��E1�������XZ��uH����I�$H��$(dH3%(��uDH��0[]A\�f.��oOL$�@H��J*�
f�$�oT$�m����
��ff.�f���USH��HdH�%(H�D$81������H��H��f�H�D$ H�t$H�T$)D$�D$(�D$����tB�D$f�f��tkH��tN1�Cf�Sf�f��
��f��tqCH��t1�f�E1�H�L$8dH3%(��H��H[]�DH��t�f��
tAf��u��9DH��t
�CH��t�1�1�f�M�f.��D$�CH��t��D$f���f��oL$KH��u�1��j�����D��USH��HdH�%(H�D$81������H��H��f�H�D$ H�t$H�T$)D$�D$(�D$�y��tB�D$f�f��tkH��tN1�Cf�Sf�f��
��f��tqCH��t1�f�E1�H�L$8dH3%(��H��H[]�DH��t�f��
tAf��u��9DH��t
�CH��t�1�1�f�M�f.��D$�CH��t��D$f���f��oL$KH��u�1��j���腀�D��UA���
H��SH��dH�%(H��$�1�H�\$H�T$�D$nH��H���H�1��f�GD�����xLf�|$u2H�{衇�H�E1�H��$�dH3%(u)H�Ę[]�fD�g��X������˸���������f.���S�H��H�� dH�%(H�D$1�H�L$L�D$�D$�#�����H�D$H��D$�C1�H�T$dH3%(uH�� [��O�ff.�@��UH���/SH���9���}H�u�.H��H���!`�H��H��HD�H��H��[]�f�AWA��AVI��AUA�ATI��USH��hD�D$H�\$0dH�%(H�D$X1��ƉD$H�D$,H�D$H�D$(H�D$�)@�D$(�����A�����,f�8c���D$,M���zA�<$L��fA;>tH�=�b1�1����A�<$f�1�1�D��CH�Cf�Cf�|$0�Z��D$(����9�H�L$A���Ǿ�Ao�A����|$�|$(��H��t4�Ef�D$0f��
��E��D$4H��謸���/�|$(A�$�T$f�D$0f��f��
tfA�D$f�T$2��D$4H����������e�8s�����H�|$A��1�L��`H�
�bH�XW�>�����f��AoL$f�T$2�L$8����]�|$(����D1�A�<$���@H�L$�|$(A��	��
n�����D�oU�T$8���@�����H�L$XdH3%(uTH��h[]A\A]A^A_�H�����H�=`H��1����H�|$1�A��L��_H�
�aH�^V�D������*|�f.�����E1������ff.������A�����f�����E1������ff.����AWf�AVAUA��ATI��UH��SH��H��HdH�%(H�D$81��)D$�D$f���D$(H�D$ f�D$H���+�?f�|$f��
�	�C�D$1Ҿ�v��D$����JL�t$A����L���Zl�|$A�L��	��>l�A�$�sf�|$
�|$A��L�d$D��L��轵���f�|$
��|$L��E�H�T$�D$�����D$1҃�f����f�U�|$D���Q�����D$H�\$8dH3%(��H��H[]A\A]A^A_�f��
��
H��A*f�T$1��oL$�E��D$��������a�������a��1�H�=9]�1����t���f��T$f���A���f�A�L���)�D$��j�f�|$
�|$�����A����D�|$A�L����j��i���A�$$��_���f��oST$�����1Ҿ�f�D$�D$�M��D$����@�`�8bt.�mH���;
�H���1��H�Ɖ�H�=�\1��.��fDH�|$A��1�L�+\H�

^H��R豊�����B�����;`�8bt����|x�ff.����H����dH�%(H�D$1�H�D$�D$H��豃�H�L$dH3%(uH����'x����AWAVL�vAUATUH��SH��H��8dH�%(H�D$(1�L�d$ L�l$H�|$ L��L������xfH�T$ �D$�:��H�MM��H�L$=�wAA�H�|$ L9|$���?.u)H��L��L��I��H�|$ ���x
�D$=�v�f��:H���z�H����H�=U[�N��;[�D$ ��H�޿
L��葙�L�����a��}��tz�
1�f�UH�L$(dH3%(��H��8[]A\A]A^A_�D�ȉE1�f�M��fD�?�W����f�E1��f.�L��H��襛�uڸ�����f.�H����t�|�]�<���H�{H�p����H���'����cv���AUI��ATI��USH��H��hdH�%(H�D$X1�H���?[��f�H�T$H�L$1�L��)D$)D$ )D$0�D$�t��Ņ��L�d$M���1�L���H�@(��H��u�A�UHc�H�D$H�<�H���p�L�d$L��1�H��*�@H�D$H��H�P(H�T$H����H�H�rH�f��@�f�f��
tf��u��V�P���oNH�DH�t$@�Έ�Ņ���A�E���o�T$PfoT$@H��P�H�|$XdH3<%(��u8H��h[]A\A]�A�E1��o�H�D$H�DL���@����t�f���SH��H��dH�%(H�D$1�H�����x0H�$H�P�H����wf�1�H�L$dH3%(uH��[�@��������,t�ff.����SH��H��dH�%(H�D$1�H��謍�x(H�$H=��wf�1�H�T$dH3%(uH��[Ð���������s�@��AVA��AUI��ATI��USH��H��dH�%(H�D$1��?[t_�:�v�H��H��tH�x�:�v�H����I�]1�fE�4$H�T$dH3%(��H��[]A\A]A^�f.��]�Vv�H��taH�{H��H�h聴�H���E��t�<:uBH�t$H�}�ė�x0�D$I�]fA�$1��fDH��H���=��H����������[����r��������f��ufAVf��
L�5q�AUL�-��ATME�I��U��SH������f�;
A��L��H�5#"H��H�=cVIE�1����I�$1�[]A\A]A^�D������f���f�?
u
H�
�Q*H9Ot	��������Q*9Wu�1�f�1�Ff�Vf��W�V�fD��H����dH�%(H�D$1�H��L�D$�D$�I��$���t!H�t$dH34%(��uH���f.��+Y����rq�f���H�������H����w����H��hdH�%(H�D$X1�H��H�����H�$H�����H�D$�����H�D$H�����H�D$�����H�D$ H��H�D$(H�����H�D$0H��H�D$8�����H�D$@H��H�D$HH��H�D$P1�fD��9<�t)H��H��u�1�H�t$XdH34%(uH��h���D����up�D��1���t����������	������f��H��H�5^T���E��H��tH�H������USH�����t'H��@��.t����H��DXtH���]��u�H���[]�@H��1�[]�ff.�@��ATE1�UH��S���[u�_H��A���t+���:t�V����H��DQtH���]��uݸ[]A\���]��D �t�}[��]A\�f���AVAUI��ATI��/UH��SH��dH�%(H�D$1��=r�H��H��tH��H��L�p�f��L��H��L��H��蕂�xafA�<$� ��D�H��tAH�t$H���L~�x8�D$9�w0A�E1�H�L$dH3%(u!H��[]A\A]A^�D����@��������tn�@��AUI��ATU��SH��H��(dH�%(H�D$1�I��L���p�ID��f����A�Uf����f��@��f����@8���f��
��f��
��8����L�KM�E����A�E9C��1�� �f.���9�uz�P�O H��A�4�A��9�v�O��9���A���A1�A���t	�@��D��u9�y��9�v����)�t1օ�t
�@��u���u���fD1�H�\$dH3%(u"H��([]A\A]ËsA�U�1��n�������m����SH��6��e���C[������Ð��H��H����l��ff.����H��H����l�ff.��SH��H���H��dH�%(H��$�1�H�����t>�T���tt���5�H���aH��$�dH3%(u:H�Ġ[�D�t$H�߁����y���S���t���t����k�ff.�@U�/SH��H��dH�%(H�D$1��mr�H�=�RH��辿�D$H��tEH��H�����H������H�|$�XV����H�D$dH3%(uH��[]�f�H�=�������]k�ff.�f���ATUH��SH��H��dH�%(H��$�1���u\H��H��贐���H��H��L�d$�ܸ�uE�1�H��$�dH3%(ubH�Ġ[]A\��H��H��A�藸�t��^R�8H��u&H��H�޿�6��xL9d$u��E@�������tj�@��S1�H��H��dH�%(H�D$1��-��D$���u4��Q�8tuH�D$dH3%(uCH��[�@H���(�����fDH�|$A�1�L��PH�
QH�D�{����i�f����7�������ff.��������AVI��AUI��ATI��US�����
t$L������L��L��A�։Ņ�t
�Q�8tt�[��]A\A]A^�ff.����H��dH�%(H�D$1�@��@�.��4$H��H�5!����l�����x�D$H�L$dH3%(uH��ø��������h���H��H�5����-���ff.�f���H��H�5����
���ff.�f����ff.���AUATI��US��H��8dH�%(H�D$(1��=~u*t,��L���*H�H�D$(dH3%(��H��8[]A\A]��<H���$H�D$H�D$�Bv��1�H����[�1�A���'v�E��x"�H����f�$1��[��y����O�8%������t*�R����g���UH��SH��H��H��v%f.���H��H���΀@����H��w�H����H��[]���D��L�I9���A�I��A����yM�A��	fDM��L9�t`A�I��A��I��M	ʄ�y3��M�H��Fu�A�@��t6����)��A ��@w&I��1�L�L�ÐM��u�I��1�L�L��fD������t�1��ff.����SH��H��dH�%(H�D$1�H���\X�x(H�$�����H9�w�1�H�L$dH3%(u
H��[ø�������df�@��LJ�������ff.����LJ�������ff.��L�O�����AUD�B�H�FATI��UN�DS1�H��@HH��L9�u�H��twH��I��A����	��L��A���I��H��M��~&H�
�-*I�U�o��I9�uFH��[]A\A]�I9�t�M��y1A�]������%M�L����fDH��1�[]A\A]�1��A�E�����A�EL���E����UH��SH��H��H�GH�pH��tH�L0*H�8H��P H�CH�@H��H�[�;��H�CH��[]����f.�H���H��tH�WH�BH��t��fDH��y����H�G������O��u�3�G��tH�WH�BH��u#H���H��u���Y��f�H�:�����H��1����f���H��g���USH��H�/H��t&H��H�}����t�t�cK�t/H�H��[]�?u�H���C\�H�=LH��1���F�f�H�}�gZ���D��H���0X���H��~���H���_���H��gXD��ATI��UH��SH��H���H��t�>��L���H���[]A\�ff.���H�1�1�H�GX��ff.���H���_���UH��SH��H��H���H��t�/��H���H��[]��H�GH������H�����H��H�H�PuH�GH���f.��ff.�@��H�����H��H�H�Pu
H�GH1���D����H�G������ff.�f���H�����H��H�H�Pu
@���g`fD����H���H��t@���V���ff.�@��H��ghD��SH��H����|L�H���[H��H)�H9��HG�Ð��H���H��t�KL�1��D��H��gpD��H�����SH��H�GH�WuH��Px���x��[Ð��H�S����������[������H�������ff.�@��H��(dH�%(H�D$1�H�����H�Gu(H�L$���H�L$dH3%(u+H��(�f�H�|$�FH�H�|$�W�H��������~`�ff.���H��(dH�%(H�D$1�H�4$H��H�T$����H�L$dH3%(uH��(��(`����UH��H��SH��H���h^�H��H��H��[H��]���@��SH��dH�%(H�D$1�H�����H�Gu,H�GH����� uH�L$����|$u&H�C���H�D$dH3%(uH��[�DH�C��� ���n_�ff.���H��(dH�%(H�D$1�H�4$H��H�T$��BC�H�D$dH3%(uH��(��_����UH��H��SH��H���X]�H��H��H��[H��]�\�@��H�W�����������	�@����ff.����H�W��������	�@����ff.�@��� f.�H�G����H�GH���H��u��@��USH��H��H�o�@�H�����H�Cu"��� u1H��UP�Ņ�x]H����[]�@�E�S���������H���X��H��H�5VF�����H��1��?���Ci�sE��i��[�������XE��@U��SH��H���p}�uH�C�������CuH�S����t�C��u�C H��[]Ð��@�����H�{�
W�C�K��u���ff.�f���H��dH�%(H�D$1�H�H�$H��tH�1�H���K���H���sQ�H�D$dH3%(uH�����\�f���H��t��
���D����H�G����l|�ff.������������	Ј��@��t H���H��t�?�����SH��H����|�H������H��t
[�7���[�ff.���U��SH��H�ǠH����{�@��uH��[]�f�H���H��[]�n��ff.���SH���#>�C��t[�f.�H�{H�5�B1�����C [�D��H�W������������	�@����ff.����H�����AVAUATUH��SH�F�-H��H�G�8H�G����U��L�/L�6H����A�ă�w/H�
�D��Hc�H�>��D�C�l��H���YO�H�H�EH��L)�L)�H9����L9�tH��"*H�C�o��[D��]A\A]A^�f��U������[D��]A\A]A^�f��C������[D��]A\A]A^�f��u���k��K���8��H��袷��Q������D�E�=�������A�UA���V����A�SA���>�����ATUS�F�D��H��H���[�tf��t���N��H�E���[]A\ËCH�߉E�">�H��I���Gz�H�}L��H�5�BH��1�连�H�E���[]A\��H�E��� H�E���[]A\�ff.�f���H�����USH��H��H�GucH�G�������H�����Ņ�~#H�!*H�C�o��H����[]�@y�[�������N@���f.��;@�S��������ff.�@��H�G�o���ff.����AVI��AUATUSH��H��0dH�%(H�D$(1�H�l$L�l$L�e1�L��L��H��謫���"��~/H�D$�H��L��H�D$襔�H��xHtNH��H���SF�뵐�S���uH���L����H�L$(dH3%(u H��0[]A\A]A^�@��ؐ����W�@��H�Ǡ�����UH��SH��H�_H����[�H���H��H��H��[]��f���H���H��t�Kl�����H��"*H�0�-l�ff.�f���H��H����B���-�������J���	Ȉ���Bu	H���@H�ǠH���X�����SH��H����L��H��x	H��[�H���ր�H�����[�ff.�f���UH��SH��H���H���A�H=�wH����[]�fDH���v�x$H�����@�1�H=���H����[]�@H���P������f���SH��H��H���H���3������t�@u�u�x$H��[�fDH�G���y��b���@H�߉D$���D$H��[�f���H���t
�݆�D��f���USH��H���������H���H��������VH������	Ј��H��H����KO�H�EH���H���H�EH���H���H�EH���H���H�E�������������	Ј��H�{ ��H�{(��H�{0��H�{H��H�{P��H�{X��H�{`��H�{h�H�{p�H�{x�H����&H����4H����BH����PH���m�H��H���[]��H����H�{(H�C �=���H��H�{0H�C(�2���H���H�{HH�C0�'���H����H�{PH�CH����H����H�{XH�CP����H���H�{`H�CX����H�U�H�{hH�C`�����H���H�{pH�Ch��H�i�H�{xH�Cp���H���H���H�Cx����H�Z���H���H�������H���H���H��������H�B���H���H��������H�f���H������f.���H��*S����H�8H��P�����1����H�lj���(;�H��H���XX�H��H�5���d�H��[�@��UH��SH���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$��$H�D$H�D$ �D$0H�D$�G�H��H��H�xH����a�H��H�L$dH3%(u
H���[]��bQ�f���U��SH��H��H��*H�8H��PH��H���S��H��H��H��[��]��9���Ƈ�H�������H���H�@���H��H��H���H��H��H���\�1�H���f���AWAVAUATUSH������L���E1��tx��I��H���E1�H��H�nL�t�
@H��I9�tLI��$�H�U�L��I��$�H)�H�EH9�HG�H��I�I��t[�I��$�H�I��$�H9]t�H��L��[]A\A]A^A_�f�H���L�x�V�����H�%*SH���H�8H��PH�
����H�����H�5���H�HxH�
�H��H���H�
����H���H���1�H�HhH����R8�H�5�H��H����a�H��[�f.����SH���H��H��tH��*H�8H��P Hǃ�H���[�C�@��AW1�AVAUA��ATI��USH��H�����t1��t-�R�H�FH��H�TfDHH��H9�u�H�A�H��HE�I��$�M��$H�I9���D��H�-�*I)�H������H��H�V�H�}H9����H��PI��E��tG�oL�@H�s1�L;pw(���oL��H��M�@A@�L9psV�ύOA9�u�I��$�L��D���ي�H�}L��H��H��P H��xxI�$�H��H��[]A\A]A^A_�f.�D�oL�p�A���I��$�H�5��L��1�H���������Y5��ADŽ$�AƄ$�L��H�������w��|��������u��~�fDSH���1�H��H�5�诒���4�������ǃ�[���AUI���ATI��UH��SH��H�=*H�8H��PL��H��H����H���H�i���H�CPH�n���L��H�C(���H��H�����~�H��H��H�߉�[]A\A]�h5����H��*ATI��UH��SH�8H��PL��H��H��H�CPH�����H�C(蜓�ƃH��H����V~�H��H��[��]A\�4�D��SH�� H��H��tH�E*H�8H��P Hǃ [�ff.�@SH��H����h�It�����uǃ�������[�f��[Z�y��B3�8ht�H�����C�H�=b6H��1��Л��ff.����w�������������H��	Ј�H@��t���u
H��t�DUSH��H�����|�H��L�
�
A��S��H�
�6�H���\�H��H��[]�fDATUSL��(H��I�<4虍�H���H9�r���t$H9�0HF�0H9�HB�I9�r[]A\�@H��I9�s�H�� L��H���F3�H��8H�� H9�@w1u	��Ht&H��(I��I)�H)�H�I�J�< �u��L��8H��(��H�[]A\�ff.�SH��H����dH�%(H��$�1���H�H���8w�x4H�D$8H;�0vH=�HO�H��0�D$%�=�t H��$�dH3%(uH�Ġ[�@��Hr���RI�f�H��8H��@H9�w	sH�(H)��1���HuH��(�ff.�f������H��(H)�H���f�AWI��AVAUI��ATUSH��H�����L9��M�����H��H��@H��8E1�E1��+�E��������A���H��H��H)�H9�r
H��(H)�L��K�t5L)�H9�HG�H� H��I���g�H��@H��(H�H��@H9�u
Hǃ@1�M9�H��8��H���c���H9��Z�����HM��t&H��t<H��L��[]A\A]A^A_�f.�E1���L��H)������������u���Hu�H�ߋ��0y�H���L�
 SA�KH�
3��H���8Y�H��XZ�n���f.�U1�SH��H��H9�t(H����1��N�H��x>H��H9�uH��H����[]�H�5�2H��1�������Q��ǃ���H�5�2H��1�������/���j.�������AVAUATI��USH��uRH�VH���3��H�6��A��$HtI��$I9�$����:�H��~I�$[]A\A]A^�A���������A����H��@E1�H������H�����1�HH��H9�u�A��$��B3�H9�uAA��I�$I�I�$H�]�H��@A��w�A��$D��H���2�H��~![I�$L�]A\A]A^�[]A\A]A^�V4�A��$H�'���M��[]IE�A\A]A^�E1��H���������fD���t��H�u�t��SH�����謚�x��H[����H[�ff.�@AVI��AUATI��U��SH�� dH�%(H�D$1����d�R�H�FH��H�L1�f�HH��H9�u�H��L���I�����L��L��A���I��H�����zI�H9���A��H����t,I�T$H9�s���I�T$H9�w6H)�I����u�L�$0H�
�11��	H�5�/H�=��"'�f�H������L��L�����L��I��M������x	I��H�\$dH3%(L���BH�� []A\A]A^�@�S+�A��Ht������L��L�����I���@��t	����E1��D1����I�$I�t$L��H�H)�H�$�H�t$H���A���H��~#H9D$���v�U�I�t$L��I�����L��I������A��H� ���Adž�L��I������������A���L��I������������A��H����L9�����L��-H�
!01��%H�5;.H�=~�%��rB�f�SH��H��0H��@dH�%(H�D$(1�H��8H9��	H�� H���H��(H�$�H)�H�|$H����H��H������H����H��8H��@H9���H��t?H9���H��H)�H9�����H�H��(H��8H9��-H9���@1�H�|$(dH3<%(�"H��0[�@H)�H�$H��H��H�L$�t���H���`���������@H�t$�H�L$�-���@��H��H�� H������HtoH���f���fDH��(H��H)�H9�r^H�H��8��H��"����Hǃ8H��������H�����
���f.�����fDH)�H�H9�s�����Hǃ@Hǃ8��c@���������ATUSH��H�ǠH�����dH�%(H�D$1���H���H�<$���]:�@����H���H����H�����A��@��usE��t^��H�uH��@H9�8�����uH����H���04�H�D$dH3%(��H��[]A\���H��H�<$�l��DH�<$�Gp�H���H���S���H������A���O������i���H���,\��o����H�ߋ��p�H���L�
����SA� H�
�*��H���P�H��XZ�$�����>����AWAVI��AUATI��UH��SH��H��(L��8H��@I9��H��rVH�(L)�H��uJH�����������H��L��L���L��|1�H��([]A\A]A^A_�f.�L)�H��I�.H9�s�H�H9�v�H9���I�(E1�H)�L��L��(1�I��K�,H�D$I9���I��I)�H9��A��I9�K�4,H�L$LG�H� H��L���`]�H�L$L)���H��@H9�8srM������L�d$I)�L�M�I�������H���H��(�����I)��v����H��I��H)�I)�H��L��L��'���fDH9�H�� H�L$HF�I��K�,L��J�48L�D$�\�L�D$H�L$L)��P���f�M��M���]�������z$�H�ߋ�����������g���������]���fD�������@8���������ATU��SH��@����H��tH���bY�����ud��H���@������1�貑�y��H��H���H� tc�@����������	�@���[]A\�fD���[������H��tr����c���fD@��u�뚐����V�����H�� ��H�p�������A��]�����H@�Q���@��t
��H�}�����������H��D����l�H���L�
����SA�yD��H��H�
�&��L�H��XZ�(���f���1���U��C�����H���ff.�@��AWA��AVI��AUATI��USH��L��8L��@�����R�H�^1�H��H�vH��H��H�DH(H��H9�u�L��H�t$�L$���L$H�t$H9��M9���A��$H��I��$�I9�$0IF�$0A��$�t	H9��kD��L��L�����I��H����H������E���q���iI�VL��I9�r,DI��H)�����A���E���=I�VH9�v�I�6H)�L��H���I�VI�LH)�I��H9��(I�$��L��H�t$�L$�������M��$8M��$@�L$H�t$M9�thE1�H��L�4�
@H��I9�tH�s�H�L����I�LI��H9t�I�$�H9�����L9�u]H��L��[]A\A]A^A_�1�M9�uqI��$0I9�$�IF�$�A��$H�����E��tDE1�I�^A�O�I�v�Z���A��$Ht��?���L��E��u4���e������E1��f���I��A��u��F����I������O���I�V���ff.���AWAVAUATUH��SH��H��XdH�%(H�D$H1��F��H���P�9�u���u7H���H���8o�H�L$HdH3%(��H��X[]A\A]A^A_�DH�T$0�H���~Y�H�H����t�H�D$0H9���H���.�L���L��H)�H�����x���H�t$0H�t$H9��e����C�q��H��@H9�8�5��H�(��H�CL��(H��PH��t	L9��QH��0L9��QH�D$H�3H��H�t$I��I��H)�H�L$(I�H�L$@H�$H�L$8H�L$H9���H�l$ L��H+D$L9�IG�I)�I)�M9�����L��H��H��M���y�I)��W��H�$H�t$I�O�H���҉�����H�D$@I9���M��I)�L)�H�I�(M�I�I9��5��H����H���8N�HA���
����������9�������C���H�T$8�H���W�H�H��x u.��H�����f�1����f������fDH����H�����Lc�M������H��������I��������L�;H����+�L)�H�$H�D$@H�D$H�L$8I9�sWH�$L)���D��H�T$L�L9�IG�H�D$@��L�I��H���sH�L$8I�H�H�H��I9�r�L��H���w�L;|$8��M���0��������fDI������L)�H����L��(L������f�L��I��H�D$@H��C�CH�D$ H;�(���H�D$ H�t$8H��H�� �S�H�D$ H�l$@H�� H�t$8H�D$ L��H��I)틸�B��H�t$@H���I"�L9|$�?���H�l$ H�t$H���v�H�D$(�K H��1������t��uGL��H����v�L;|$8tyf���������H�����Ht����,���H�$��tPH�5�1�H���x�H�$H������6�L��H���[v�L9|$8�p����K 1��M���H�t$8��L��H���0v�L;|$8�7�������2��y�H�l$ �����G���L��H���u�K 1�������H��xW��HuLJ�������fDUH��SH��H�����¸������xH����H��H��[]�f�LJ���������H��t"SH��H��H���2�H��[�fD�ff.�@��U��H��S��H��H����I��H�����1�HLJ0 ��	�H��)��IH�G H�{�H�G(H���H�GHH�%�H�GPH�*�H�G`H�_�H�GhH����H�GxH��)H���H���H���H�=���H���H�����H���H��)H������H��uH��0H���H��[]�ff.�AUI���PATA��U��SH��(dH�%(H�D$1�H��)H�8H��P@��L��D��H��H���r�1��D��H���8�H��x=H�EH��H��H����H�L$dH3%(H��uAH��([]A\A]�D1�H��D���-�xf�<$uŀ�Hp����H���0�f.���1�����D��SH���?���������[�@��AUA��ATA��UH��SH��H���tsH���)�PH�8H��PA��1�D��H��H���zq�H��I������HH��H����A�T$I�,$����	�L��A�T$H��[]A\A]��1��6�H���y���ff.����SH���?���U������[�@��S��H��H��dH�%(H�D$1�����������A�o�D$��x#H�|$H���fw�H�\$dH3%(uH��[��[�8��$����.�f.���AWAVAUATI��UH��S��H��H����*k�H�D$H��xrtOL�l$E1���tCf�D��M��M��$�I��$H��H�L9hLFxA��H�0L��M)�A�P D9�vM��u�H�D$I�$�H�D$H��[]A\A]A^A_�L���FX�H�D$������ff.���AUI���ATI��UH��SH��H��)H�8H��PH��H��H����L���L��H����_�H��H��H�߉�[]A\A]�6�fD��H���H����ff.�f���USH��H��H���!�H��tH����H���1�H�x0��Q�H���H�}0H�OH�4H9�t-�H�H��tD��D8���H��H9�u�H�H�H9�u�@H��H9�tH�8t�H��[]�f�H�}H�H�WH9������H�uH�U�Wj�H���� �H�}0��H���)H��H�8H�H�@ H��[]��f.�H�H���H�}0H�O�[���D��SH��H����|-�H���H9B HFB H��H��H�H1�H�qH9�s
H��H)�H��[��AWAVAUATU�����SH��H��hL�(L�'dH�%(H�D$X1�H�G0L�L�XH�D$H�$H�D$ H�D$K�<L��I9��CL��E1��H�H��t H��H9�wL��I�xHE�LE�H��H9�u�M����I��L�hM��t�L���,�H���#H��L��I9�L��HG�H9�HF�I��� ���D��H�t$H�;�H�D$(ȉD$I��H�D$ H�$H�D$8H�D$0I��H�L�|$HH�D$@�>g�H����I�WH9�����I��L��1���e�H�C(H��H�C(I��H�C0L�{(L�#L�L�XK�<L��I9�������L�����u.H�\$XdH3%(��usH��h[]A\A]A^A_�H�;��Z�����H�;�V���1��H�S0L�#H�H�JA�t$H�H9�t�f.�H�H��t���H��H9�u�L�#��o����)����AVAUATUSH��H�?�II���H�C0E1�1�A�H�L�p�I�L9�u�S@AD�H��I9�t0H�H��t�H���H��t�H����҅�y�H��A�I9�uЃ������E��@��D�[]A\A]A^�H���������o���[1�]A\A]A^�D��UH��SH��H���H�;�H�Hc�H��~$H������H��H�x����H��[]�H���u�H�H�S0�pH�JH�H�H9�t f�H�H��t���H��H9�u�H�������[]�ff.�f���SH��H�������@8�t@��t�������	�@��H��[Ét$�����t$�Ӑ����@��tHH���H�V0H�H�JH�H9�t fDH�H��t	��tH��H9�u�H�>�.X�fD����SH���H��H�8�)�H��[HB�ff.����AWAVAUI��ATA��UH���SH��H��H�t$�(�H�$E���H�t$E�t$�1�I��L�~J�t6L��L���HH��H9�u�H9$��H�$H����I��M�L��E1���L��H��L)�t)H9+H��H�s�HFI���S�H9+HF+I�I9�u�L��M��A��t!H�$I��� H�� HF�H9BrI����r���H��H��[]A\A]A^A_�I����T���H��1��'�I��H���D�����@1�E1��~���1��f.�AUA��� ATUH��SH��L�%�)dH�%(H�D$1�I�<$H��PI�<$�D��H��H�$�>@�H��H�$H�\���H�CHH�����H�CPH�&���H���H�����H�CXH����H�ChH�2���H�CpH�g���H�C H���H���H�C(H�}�8W�H�扃�H�$H���H�P8H�x0�'R�H�uH�<$������
�H�$Hǀ�H�H�@HH�L$dH3%(uH��[]A\A]��$����H��H�GH���H���4��H�W0A��@��H�H�JH�H9�t$f.�H�H��t	D:�tH��H9�u�H���]���L���H�
1��TH�5wH�=�_�5�D��AUI���HATUH��SH��L�%0�)I�<$H��PH��H�5\���H��H�(L�h H�EH���H�SH���H��H�C�a�I�<$�@H������G�H�C8H��H�C0���H��H��1�[]A\A]�����H�G�������t8��H�FH��H�L1�fDHH��H9�u�H��H���f�1�1�H���@��H�E�)S��H�8H��PH�
���������1����H��H�����H��H����(�H��H�5��35�H��[�f.�@��U��SH��H��H�����@��uH��[]�f�H���H��[]�S�ff.���AWAVAUATA��UH��SH��H�|$H�����^�H�$H����~fE��taH�D$H�UH��E1�L���H�$I��H9�v1�H�3L��A���z�L+sE9�v&M��~!D��H��H�H�SL9�r�H�3L��L���Rz�H�D$H�$H��H�$H��[]A\A]A^A_�H�|$��K�H�$������ff.���AUI��� ATA��UH��SH��H���)H�8H��PD��1�H��H���H���H�����H���H�C L���&�H���(S�H��H��H�߉�[]A\A]�	���AU��AT��USH���T$H���м�I���|$�������H���˅�uG1��g�I��H��H�=��1��,o�L��H���3��L��L���f�H��[]A\A]�f�H�|$1��k�I���f.�D����P�����AUATUSH����twH�NA��H��H��H���A��H������1�I��H��x8H�ǃP����H9Ew!A��tH��A�U�H�u�7�H��H��x4I�H��L��[]A\A]�H��E1�[L��]A\A]����6��C���tÃ�LE����UA�H��L��SH��P��H�
�1�H��H���X1�H����H��[]��f����ATUS����o��H�X�)��I��XH�8H��PL��1ɉ�ǀP����H��H����`�H�
b���H�PH�J H�����H���[]A\����H��H�W���$��P1���y��P�H�����SH���H���t6H��pH��tH�@H��H)�H9ûHG�H��xH��t���H�H��[���SH��p1�H��tH�XH��xH��t���H�H��[���SH��H�ǘ�Lf�H��x��H��`���H��t
H��[���[�ff.���SH��H�ǘ�e�H���H��tH���)H�8H��P H��hHǃ�H��tH���H��p��H��x���H���[�F�ff.�@H�����H��t�������S��u=�����t#���uH��pH��tHrH;��r��u�����[�ff.�H�� H��t��f��ff.�@��UH��SH��H��H9��tH��XH��t��H���tH���H����E�H���H��[]�f�H��H��xH�����P���$����@���������	Ј��H���ff.�SH�����H��x�@uH��H��t&H��[���H����tL�H��H��u�[�fDAUATUSH�������߸�����H��H��H������I��A��H��x�Є�tIH���и� H���:�L��H��D���X�H�����H��I���:�M��xH��L��[]A\A]�H��E1�[L��]A\A]�H��I�����������ff.����������������	Ј��@��tKSH���t����N��[�@H���u�I��H�
���1�H�5���5�H���[��ff.�@��H���H������uH��tHH���t
H���t�SI��H��H�
j��H�5f1��g5�H���[�fDH�ǘ�Lb�ff.��SH���H��H��t`H�5��1��B_��H���ǃ����������H��tH���)H�8H��P Hǃ������[Ë�����LJ���������f.�USH��H�����t�������H��[]�@H��H������Є�trH��x���H��tH���F�H����8���H��H������H��Ѕ�t.x<�������H��x�:
���n���fDH��1�[]�������u~�������L��H�
�
1��H�5�
H�=�S�h���H���8���H��x��������H���*��������f����������fDH�������fDH��������*��������u��a���H���������AT1�US���H���u H��pH��t(H�j�H��t1��uH��0H��[]A\��@���L���H��xH��t��p�I9�vH��x�p�I��@I���� LD�1�L9�@��������ƒ���AUATUSH��H��@��ut�����1���H��p@��H��tmL�`M��td�������u	���uNH��(H��tH���H��xH��t��uOH��[]A\A]�@H��p�H��t�L�`M��u���u�H��H��[]A\A]������H���[]A\A]��
�@H��xL���H��t�o�I9�wS�����I���� LD�M9�r��u���t;���K����s���D��t���%��������H��x�$o�I��뜄��������f�AWAVAUATUSH��H�����dH�%(H�D$1�@������@���E������ �m��H�������H��8����H��@���H��xH��t��
�A��E1����L���H��H��H�$H�����8H�4$L��I���)�H�<$�t������ L�%�/@H�
�L��H��1��4�oW�H�<$�6L�� t-H���1��4L��H����u�H���
���fDH���1��8H��H������H���c
�L��L���H)�L��H���@H���d&�Hǃ����t���uH���/���E��tH��xH��t��D������H�T$dH3%(��H��[]A\A]A^A_��H�
��8H��1�H�5��SV��K���fDH��xH���@�H���A3��J���H���Q������@H�<$�0��k���鿱�f�H���8������U�����ff.�AVAUATUSH�� dH�%(H�D$1�������H��I����E1�I���L��H���!���H���5u&H���������#���t�魱��I�NI�H��H9�rtI�v1��f�I��H�vH�N�H9�wH��H)�9�u�L��H������f.�H�|$dH3<%(��H�� []A\A]A^��)�H���?����Ao)$H�D$H9��[��H)�H$H�D$�*�H�T$H9��_��H)�H$I�H�T$H��tG�L��H������H���e���u�H��������x����w��H�T$�H������7�����tI�������L�������i�f�AUATUSH��H��(dH�%(H�D$1����t:�����Ͱ�H�L$dH3%(�DH��([]A\A]�f�L��pM����I�T$�H��t�I���@@����H��H����H��1�L���JL����I�T$�tJH��tEH����I�$L��H�T$H�ߺH�$���u����H��롐��>���fDH��tC�tUH��pH��teL�hH��xH���H��t
�i�H9�wIH���� HD�I9�s���uH���G�I�T$1�H��������D��������E1��H��x�Ei�H������ff.���ATUSH��H��D���dH�%(H�D$1�H���H�$E��������tK����SH��pH��tH�x�<�H�L$dH3%(����H��[]A\���@uՃ�@H�<$����e	�H��xH��t
����E1�f�����������uH��������u=H��H���Ѯ�H��Є�t$H��xH���;H���c��H=��GH�������������t\�����������������������J���>���H��0tH���\��������UH��H�����H��Є�tGH��xH������-�Ņ������K��uF���1��e����H��p���H��tH�xu������2���DH��������������H��pH������H�x��������H���-��pH����H=����������E���H��pH��tH�x�������W��������H��0�����H���
����������*H�$�@�������E��t3L��xM����L������9�L���S,���H������	���H��xA��6=��Q�������������	���H��pH��t*H�xt#駬�D����+H���S�����x7H����Ņ�t����
���H��0������H�������uwH��0tmH�߽��������������H�$�H���H�����������H���k���q��������f���t�@����������1�H�����n���ǃ� ���������������H�$�p��������ի������U����i���fD�������������7��H�$�P��uH���4���H���H�߽�������@u��R���
�����!���E�������g����D�������頪�fDH���H��tDUSH��H��H��HH��t	��H���H�����H��P��H��tH���H����[]Ð�;���ff.������uC�����u9AUATU��SH��H�����t)����ƪ�H��[]A\A]�f���@��tCH��xH��t�r:�����H�߃���	�@���H��1�[]A\A]�6�fD���L��x���A��M��tUL���M6�L���)�yAH�������t����u�����x���H��(H���h���H����^���E��u���f���AWAVAUI��ATA��USH��H��8������/�����8�D$/��������E����A�T$�I�E1�H��I�TfDHH��H9�u�H�L$���L��p��M���MI�oH�����t3H��xL���H��t�|a�I9��I���� LD�L9�rH�t$H������������H��p��I�τ���H���H����H�AH9��qH����H�t$H���m����L��p�o@���������uf�H��xH��t
�����D$/������������������I��UH�D$ E1�E1�L��L�,$M��I��E��D�d$(H���~D9t$(��D��I���H+hH��H$H�ZH�2I9�����M��tL)�L�E�fE1�L�|$L��I��I��L$$M���>DA��D9t$(�qI�\$I�4$I��H�D$H���I+oH���qH9�L��H�L$HF�H��I��]3�H9�H�L$v�M��LT$ L�|$I��I�H�|$H9|$ �b��A����bI��pH���"H�hI��xI���H��t�6_�H9�vI��x�%_�H��f�H���� HD�H9��
A���uL���H�L��� ������I��pH�������H���)� H�8��I��p�b���f�H������������צ�|$/�R�����[H��xH���<H���2�H����$��H�����H������3�H��������H��xH���H��t�^�H9���H���� HD�H9l$��������f.�H��x�T5��D$/����f.�H�������d����|$/�Z�������M���H��xH���=���H��H���,1�H����#��ff�M��E1�I��LT$ ����D���(���H���H��������1���1�����uH��0tH����������H��8H��[]A\A]A^A_�f.�H�D$�#���f�D��L��H�������E�H��H���	���H�D$H�l$ H9�������c��E��t9I�EI�UI��E1�H9�v�0@H��H�B�L9��/A��I)�E9�u�L���H�
�1���H�5�H�=P>����1�����f�1����f�1�H���v�����L��A���tH�|$H9|$ �uH�l$ H���H���|$/��������������L��xM���u���L���L/�L���"��9���H���w����H���fDH��x�l[�H���]���@H��x�T[�I������L��pL�t$ ����L��p���@��H���Y���H�������d����S����|$/L�������H���������H��xH������H���y.�H���1!�����|$/�%����������L��xM������L���<.�L���� ���H���g�������L���H�
�1���H�5*�H�=c<���髢���H���S��H��H�G H���H�G(����H���H�5����	�H�����H�GHH�����H���H���H�GPH���H�GXH�l�H�G`H��H�GhH���H�GpH�������FH���H���q)�H�ߺ����1�H���[����f.���AVAUATUSH��H�����dH�%(H�D$1�H���H�$���A��A���� thL������ud���A�@��toM���ޡ�L������H�L$dH3%(D����H��[]A\A]A^�f�E1��t�H�����A�ą�t������ @��u�����H�<$�f����E���.H�����@����ƒ������������������������H�$�@���VD���E���F������H��pH��tYL�jM��tP����H��xL���H��t��W�I9��nI���� LD�M9������D�DD���DH��pH��tH�x�a���H��xH���Q������H���C������fDH�<$�.�H���w���������L�$$L����*�L�����u��ą�������������H�$�P������H���%�����ƒ�����uO���t6A�����H����������H�<$��-��T���f�1�H�����f����1�H�����@H�<$�-��D��t���9����f�A��1�H������H��x�@V�I���~��������SH��H����D�H��[�SX������u
H���t	����� u
H���t�SI��H��H�
������H�5��1���H���[���������t.H��H��p1�H��tH�QH�H9������H����ff.�@��H�������{���Þ�H��x����H��xH��t���uH��H�����f�H���H��H�t$�{,�H�t$H��H�����f.���SH���s�H�����b�H��x�����[�ff.�f������uC�����u9���u0SH���H������H���@B�H��H���[����ff.�@�����u#f����u�����t����R�f��f.�DAVI��AUI����ATI��US���@�H���$���8"uFH�{�E=�H��H����H��H��H����H��t�M��tI�$[I�m1�]A\A]A^��H�=��1��H�[]I�A\�����A]A^�f�AWAVAUATUSH��H�T$H�L$@�t$;dH�%(H��$�1�H������H�|$���H�|$����?/H����H�T$H�t$XH�|$P�������L�d$PL�����A�<$/I��ʞ��u@���#H�D$`�D$ I��H�D$@��/uH���u@��/t�@����H��fDH�����t</u�H9���I��I)�I���hH�D$PI��@��.u
I��� M9�����M��M)�K�<7H�GH;D$X��M9����A�|$�/t#L��L)�H��H;D$X���A�$/L�l$PI��M9��#��L��L)�L�H;D$X����L��L��H��M��4�|$;���3H��@�������f�L��L�d$PL9��Y��H��L)�H;D$X� ��H��~
�{�/uH���H+\$PH�{�=��H�D$PH�L$H�1�H��$�dH3%(��H��[]A\A]A^A_�DH�D$X����m	�H�D$P�/L�d$PI�\$�.���fDL�l$P@��.������|$;�%���fDA�$H�T$�H�t$P�����D$x%�=����;���=@��������H�t$PH�=���1��E�H�L$H�������	����H����9�L��H��H�D$X�:�I��H�D$PN�$8����fD�}.����I9��_��L��H)�H���A���A�|$�/��I��A�|$�/u��$���H������H�ŋD$ �H�L$<���*��P��I��L�|$PI�D-H�D$(M9��(��M��I�D-M)�M�4H�D$XI���H9���A��M���-I�EL�l$@H�D$ H�\$HL��H�D$ M�,M9�����H�|$PL��H)�H�H;D$X�L��H��L���?��H���H9��*H�(H����
L�|$PM9��P��M��H�L$(M)�M�I�4H;t$XsH9�u�H�~L�T$0�A8�L�T$0L��H��H��H�D$XL)��9�H�D$PN�$0�C���E1�����I���L�L$ �7�L��H��H��H�D$XL)�I����8�L�L$ I��H�D$PN�$M�����L9��U��H�D$XI�|$H��L)�L�H9��a��L��H���1����H�=��1��)C�H�L$H����I�D$�A�|$�/I��������'���M��H�\$HL�l$@M�A�H�T$PI9��nM���L9��p��L��H�t$XH)�H�|=H9��/��L��H)�H�H�H9����L��I�t$H����I��A�(A�?/H�D$P��L9��"��L��L��H)�H�ȋL$<�L$ H�������A�|$�/��I��A�|$�/u�D$<L���D$ �Y���H�=�1��B�H�L$H�����*��H�
��$H�D$H��o������H�
���(H�D$H��P���L�`�D$<L���D$ ���L��H)�H�H�H;D$X����L��H��H����I������I�D$�A�|$�/I���6�����������7��ff.�f���H��H��1�����ff.�@��USH��H������H��H�����H��H������?/H��t-H��H�5KH��1�1���H��H��H��H��[]��B�H��H��H��[]��B�ff.�@��H��H���,���ff.����USH��H���w��H��H������H��H������?/H��t-H��H�5�H��1�1��W�H��H��H��H��[]�S�H��H��H��[]�?�ff.�@��H��H������H��H���e��?/tH��1�H��H��H�531����@H��H������SH��dH�%(H�D$1�H������H���W��H��H��H��1��u�����x1H�<$�X��H�x�?��H�$H�1�H�L$dH3%(u
H��[ø����������@��ATUSH�� dH�%(H�D$1�H���}��H��H���I��I��H�����?/H��tKH�t$H�|$����x@H�|$1�H��1�H�5-���H�E1�H�L$dH3%(u2H�� []A\ÐH�}1���H�t$1�H�=��1���I�$�����������AVAUATUSH������H����I��I����I���fDH�{�2�H��H����I��H��L��H���3��H9�~�H��xA�H�x���M�u1�[]A\A]A^�H�=��1��=�I�$���������AVAUATU�SH��H�dH�%(H�D$1��;/t.I��I��H�߾/�P��H��t;H��L��H���}����H�L$dH3%(���EH��[]A\A]A^�f�H�=<�����H��H������G�H��H�5�sH���E�H�(I��H��u��@I��I�,$H����H������H��H��H����/H�����I�mH�����H��H��H���z�H�����H���E/�tqH�{t�1�H��� ���fDH�$I�u1�1�H�=��<�I����H���1�I������H�y�1�I������H�߽���I�E������DUH��AWAVAUATSH��H�EH�����H�����H����L�����H�����dH�%(H�E�1��E����E��E����D�G�E1�I��H��A�L���A��������D��H��H��H��H���H)�H���H��H9�tH��H��$�H9�u����H��H��H���H��H��H��H���H)�H��H9�tH��H��$�H9�u�%���I��A9���H������Dž����H�� ���H�����D��M��A���������H���L�ቅ���H�����D��N�4�wH�߉�����H������S>�H�E�H�����H��H�����P H�E��H��H������P L��H���z �A�T$L��L���z�Dž���A����L��M��M��I��f.�H�����H�����L��H����=�H�E�A�VL��H��P L��H��� �A�V1��J���u	�@H��A�A0TH�PH9�uꋅ����������D9�r�M��M�����9���v/������������E�D$������������H)�H�L4������UH���H�������1�H�}�dH3<%(u$H�e�[A\A]A^A_]�H)�H�L���������������ff.���UH��AWI��H��AVH��L��M��AUATSH��H�]L�u dH�%(H�E�1���tB���{��AVL��SD�M���ZYH�]�dH3%(�zH�e�[A\A]A^A_]�fDH�e����RD�MA�E���A9��9H��H��H��H��I��I���L)�I��L9�tH��H��$�L9�u��uBA�H��I��H��H��H��I��I���L)�I��L9�t'H��H��$���DH)�H�L<��D��t	H)�H�L<�L�E�H��I��H�M�H�U�H�u�A�WH�U�H�u�H��A�W L�E�H�M�H��H��L��A�W L��H��A�W(��t.f.�L��A�WL��L��A�WA�W L��L��A�W(��u�A�WL��L�����1�H�e��z�������������fD����
D����t��s�P�H������D��f.�H����*tE��0��	w-H�PH���@��0<	wH�H�HH���u�1��@��f.�H��H���AW�+AVAUI��ATI��USH��H��XH�t$(H�l$BdH�%(H�D$H1�H�D$0�D$B#0- f�L$FH�|$0H�$��%H������H����H�PH�T$0�X��%�A��1��D$<E)�f�T$@��t>L�p�)D)�|<���L�t$0I��A�^��D<��t��H���Z��H��u�H�<$������\L�t$0A���.���K���.ws�H��H�@AH��uKH�H���������H�=���ƉD$����H��tQH�D$0H�XH�\$0��I�FH�D$0A�^I�Ƅ�u�L��D��H�=�1�����H�XH�\$0�����m��M9�����I�^�L)�H���������A�~�%�z������I���8�;�H��H�D$ �l��L��I���a��J�;L�H�L$I�zL�T$H�D$��H��L��H��I����L�L$ I�<L��L���l�H�L$L�D$L��I�<I�P�R�H�D$(L�T$L������n�R��t$L��D��1�H�=4�����H�<$I��L�t$0��������L�t$0A��>���I�FH�D$0A�^��ltI�����I�FH�D$0A�^��hu�I�FH�D$0A�^I���u���M9�t"H�T$HdH3%(L��u'H��X[]A\A]A^A_�H��L)��*��H�H�D$(H������錎���ATI��UH��S���H��H9�t
I�<$H������H��[]A\���UH��SH��dH�%(H�D$1�H���[���H��H9�t
H�$H�x���H�T$dH3%(H��uH��[]��'�����H��dH�%(H�D$1�H������H�T$dH3%(uH�������fDAW1�AVAUATI��1�UH��SH���$�Ã��tH����[]A\A]A^A_��S��I�ŋ��
���`��1�A����A�tZA�E
1��BH��L�����t(I��H�
�L��1��BH�5���&��fDL���`���o���1�H���#�D��A���cA�xjA�E
A���t�D���=���f����m����DH�~��L�����t�I��H�
l�L��1��DH�5R��j�����D���6�H�=&�H��1�����ff.��AUI��ATM��UH��H��SH��H��H���|$�;��H��~FH9����DH�|$A�Y1�L���H�
}�H�K��1��1�H��[]A\A]�@H������RH����L���-��u9L�����H�|$A�Y1�L�p�H�
�H����������M��H�
X�L��1��RH�58��P���fD�TH���L�����t{M��H�
)�L��1��TH�5������D������PH����L���g���6���M��H�
\�L��1��PH�5���������f.�L������fDAWAVAUATL�gUH��SH��H��dH�%(H��$1�H�GL��$�H��$�H�GH��$�H�G8H��$�H�G0DŽ$�	DŽ$�H��$�DŽ$�
DŽ$�DŽ$�H��$�DŽ$��G`���S`H�����H�C8��H�C0�S`��uc1�H�t$�\#��NHiD$@BHD$H�HiD$ @BHD$(H�CH�D$PH�CH�D$XH�CH��$�H�C H��$�H�C(1�H��$dH3%(�HH��[]A\A]A^A_�@H�=T��������=���L��$I����L��H�5*���������L��H�5�H��$�I������l6�L�u`H��H�D$�;<�A�Ǹ	��H��M�,$L9�t3�EL�eD9�s�H�L$L��H�<��v,�x�H��L9�u�f���v"�H�C0H�C01�������H�=��H������t+H�
KB��H��1�H�5��,��K`��������H�������K`���������A��AWAVAUATI��UH��SH��H��H��(dH�%(H��$1��+��������L�l$M��H��L����h�������L��H�5��I������5�H��I����:�L�;�D$M��u�Y�M�4$H��L�;M��tH�CL�c9D$v�I�l�L��H�����A�<u�L������L��H�|�+�y�L�c�D1�H��$dH3%(u;H��([]A\A]A^A_ÐH�;H�����tH�CH��H�H�;u��������ATI��USH��H�ĀdH�%(H�D$x1�����D$��H����D$(H�$H�C@H�D$H���H�D$H�CHH�D$ H���H�D$0H�CPH�D$8H���H�D$HH�CX�D$@H�D$P�D$XH�D$`H�D$h�D$p�C`��H��L��H�=J���������C`�t��}H�
2�H�S �D$5H�$H�
�H�T$H�S(H�L$H�T$ �D$(6H�D$0H�D$8�D$@�uH��L��H�=���l�����x1��@�K`@��@���H�L$xdH3%(uH��[]A\�fD��@�ŀK`�<����\��ff.����H��H�H�1�H�GXH��H��H)���h���H�H������f���AT�
E1�USH��H��dH�%(H��$�1�H��H���H��C`H����D$`��������H�D$8H�T$tL��$�H���ID�H�C8H�D$0H���ID�E1�H�C0H�H�D$pH�H�D$xH� (H��$�H�@HH��$�H�PXH��$�1��.DH�DH���t+H��H)�H9�H��IC�H�L9�t�H��H�H�1H���u�H�L9�u�H��$�dH3%(u;H�Ġ[]A\��H�{H�L��H��H�C`H)��Kh���H�����f.��AWAVAUI��ATUSH��H��(H�?H����E1�1��f������D�uK�|�M�dL��H��u�MD�t$H��I�H�L$L����I��H���0��H�L$�T$H�J� H�D$J�9��tJ��E1�H�D$�f�I��K�t�K��H��H�t$�7��H�t$H��H�hH��H��p��I�D$L9d$u�H9\$����K��H��(L��[]A\A]A^A_����N�I��H��tL�;E1����~��f���AWAVI��AUATUSH���f�I�.H�5T�)H��L�(H�����H�57�)L��I����H�L�eM���4��L���d��I�\H�EH��t6A��fDA�GI��H�D�H��tH9�u�H���*��H�\��M�}M����H��L��1��f��BH��I�D�H��t*H9�u�H��T$����T$H�l�BH��I�D�H��u�H��L�%��)L)�H�z�)I9�u6H��1�L��L)����I�EL)�H�O�)�!DL)�L�%N�)H�?�)H�,�)I�H�H�G�)H��[]A\A]A^A_���AUATUSH��dH�%(H�D$1�H�=�)���H�5��)H�����)H��tH��)H�8H��P H���)H�����H�=@�H���)�x*�H�=��)H��1ɉD$H�5G�1����H��I�����H�-p�)H��L�e�L9�slL�`H�hH�
]�)H��L��H�����H�8�)�B� H9�rJH��tH�-�)H�|$���d��H�D$dH3%(u3H��[]A\A]ÐH�]��f.�H)�H�<(1����H�-��)����@��H���)�@�����)�D��S�
�H�=��)H���'��H�=p�)���H�5��)H�H��tH���)H�8H��P H�m�)[�f.����H��H��L�A90����H��H�89���A�H��2H�H�0H�1H�H���AW1�AVAUI��ATU��1�SH��H�H�GI�uI��A�����t^�]�I����D9�r+�`��ډ�L���l�����t8�C�����A9��y�É�I�4ĉ�I�<�A�U��x�H����[]A\A]A^A_ÐH��1�[]A\A]A^A_��;�f.�AW1�AVAUATA��1�UH��SH��H�H�GH�uH�����A9��$��D��H�lj�����H�U��H�}H���h�D9�t��uH��[]A\A]A^A_ûE����H�}1�1�H�GH�uI�ljD$�v��I��A9�w;�@H�T$D��H�:D��I�t��Ѕ�y�D���L��A���?����D9D$v��É�G�|$H�EM�t�I�>D9|$v�D��I�T�H�2H�T$�Ѕ�H�Ey�I�>�f.�D��H���%���A�č\�G���f���AUI��ATUS��H��L�%�)I�<$H��P��H�����L�(I�<$H��H�����H�EH�EH��H��[]A\A]�ff.���SH�H�H�{���H��tH���)H��[H�8H�H�@ ��@[�fD��H�G1�H�@H�w�ff.�f���S1�H��H��H�GH�t$H�@H�w�H�WH�t$H����H�D$H�ߋ0���H��[����SH��6��������[�f���L�GH�w1�I�HH��H����tH��H9���|�I�H�H���@1��D��UH��SH���^,�H��H��t1�H�����������H��H��[]�ff.����L�GH�w1�I�HH��H����tH��H9��]|�I�H����1��DH��1�H�=��1���°)����(|���H�����ff.�f���AWAVAUATUSH���8�)���L|�H��������I��H9��^|�I��1�L�%��)H��uL�@H)�H��~2L��L�=��)I�|-H)�H9�K�4'HG�H��I�H�����L�=��)I9���H�v�)I��vH��tcH�l�)H9�w��=�)H�U�)���=ͯ)� L�����H��H���rHcúH��HI�H��)�P���DM��I�L-I)�=��)ut�=z�)L��H���c��H��H����Hc�H��HI�I9��E���H��[]A\A]A^A_�1Ҿ L���� �H��H��xy�="�)�[����@����1�H��L��H�$� �H�$H��H��x�=�)�v����]����蛶�H�$�8&tm�=ˮ)�A���D�8�P����kz�f��k��8&t+�=��)�����8�����Dz��@z��=���H�$�p�)���H�$�H�D$�Y�)�t���H�$H�D$�t�����y����f���H��dH�%(H�D$1����)�D$�P���)��~H�D$dH3%(uMH����H�=,����H��t�8uH�|$����|$�����H�=��1��R������ff.����6�)���-�)��~	��A��L���H�
l�1�H���H�=H�)�g�����H���dH�%(H�D$1�H�|$�9�D$H�T$dH3%(uH������ff.���USH������x�1҉������f����9�w�1�H����[]���f.���H��tgAUA��ATI��������UH��SH��H����H�H)�t(L9�L��H��D��HF��S��H���H��[]A\A]�H���[]A\A]ø�f.���H��tmAVA��AUI��������ATI��UH��SH����H�I�H)�t-L9�L��L��H��HF�D����H���[]A\A]A^��[�]A\A]A^ø�@ATUS��H��@dH�%(H�D$81��Q���H��H��D� ���߅�~;H�$��H�=08H��H��1���D�eH�L$8dH3%(uH��@[]A\Ð�[����D��@ATUS��H��0dH�%(H�D$(1��Ѳ��H��H��D� ���߅�~;H�$��H�=�7H��H��1��~�D�eH�L$(dH3%(uH��0[]A\Ð���������@��f�H�����H�G<GGG,�GDH��G�ff.�@��AT1�I��1�US�l����v�x��Hc�H���3���H��H���F���rv�A�$[H��]A\�f���AWAVAUATUSH��H��D�/�t$ H�T$dH�%(H�D$x1�����A��t
�{@��D�c�kD�%ϩ)�-ũ)A9��0A���������1�p���x��D��D���k���{H�{H����E����H�{8tbH�D$PH�|$P賯�H�{8�ڴ���u�H�=#��&����u�H�{8��H���)H�D$H��tH������du�A���uN�D$ ���{ ����E��tA���u`E��t[H�D$xdH3%(��H�Ĉ[]A\A]A^A_�f�D������A�E����w�1�����u�C ���E����X�r�)�����-����&���H������������=I�)H���	���H��H��H�=��H��1����f����D9��z������D9��l����|����1��Q�������u�@�5�)���H�=N�H�l$H���
��)H�{H�D$H�D$<����D$'H��tH�5/B�L$����L$H��H�|$@�L$���D�D$@H��E���!�L$E1�1�f��‹�;S r�{$9�v��u
D��A������;D$@r�D�d$@E������)L�E9�%H�FA�|$�H�<��f�H��9P���H9�u�M���������A��D�t$'�fD������z��A�ĉ��)�l���t����������)����A�����H�k0���A9��"D���:��������X�D��H���
���H�5��H��H��1��y�H��tH��H�5!~H��1��`���������D��I������I��������I���r������H����������M��H��H��AQH��H�5��M��AV1���AZH��A[��H�=�mH��1����fDE������H�=�H�l$H�~�H�{H�D$H�D$<H��tH�5�?���H���D$@��'��H�}�D$@H�Ƌ)�)����D$'A�H��H�t$(�A"�B�< H�����D�D$@H�t$(H��I��J��D�D$L�D$���L�}L�D$�L$M����H�D$DH�D$H�D$PH�D$�-��T$D9��)t�D$@�HA���L$@H��L�}M����H�t$L���w��t�H�t$L���6���7q����T$`���5:�)���R����
(�)���D����/���������.���A����	E����p�1��I"���p�A�����fD���ͣ)�=���D�D$@L���|$'t�����)�L$@C��A��L��L�������p�H�|$<�P����o�H�{8�����d����M�����D$'A���;���f����A9��������DI��A��D���������1������������������A����M��tA���D$'����E��I���(��������D��H������H�5��H��H��1����H�S(H��tH�5�zH��1�����]�������H�5��H��H��1������8���/������D��H�����H��H�5#�H��H��1��v��H���~��H�=�iH��1��}�����������L�����I������D��H�����D��H�����M��H��H��H��H�=1�1��2��=ġ)���H�sH�=Y�H��1����H�5��H�������c����*n��zn�ff.�@��SH�wH��H��t	�>��H�s8H��t	�>���;���t�X�H�=��H���y��{���t�<�H�=��H���]��{���t� �H�=��H���A��H�sH��t�>u�{ ��u�{$��u3[�H�=�����{ ��t����H�=��H�����{$��t���H�=��[H������DH�=-������3����H�=�����	���ff.�@��USH��H����H�=��b��H��tH��H��H������im�H�=��;��H��H��tH�sH�������m�H�=����H��H��tH�sH�������Lm�H�=����H��H��tH�s H������m�H�=���à�H��H��tH�s$H�������l�H�=a�蛠�H��t�8�HD�H�CH�=��z��H��t�8�HD�H�CH�=��Y��H��t�8�HD�H�C8H��[]�ff.�f���ATI��U��SH��PdH�%(H�D$H1�H��H����L���H���7��H�=|��k�=��)�tbH�=���V�H�=���J��U��u1H�=(��5�H�=*��)�H�D$HdH3%(u3H��P[]A\�H�=J����f�H�=����H�=������A����H���)�@��H��@��E1�1�1�1�������k�H���@��H��E1�1�1�dH�%(H�D$1�H�t$��D$�����kk�H�T$dH3%(�D$uH���覽�fD��S��H�="�譞�H��t��[����[�fD���=�)S�k�=L�)1ۃ��t�,��%k����)��[�f����=��)u�f�H���=�)����k����)H���ff.�f����=ٜ)���Ð��H�5}�)H��t(H��H��)H�8H��P H�Y�)H���@H�E�)�f.�f���USH��H��(dH�%(H�D$1�H��H�<$H�|$H������hj�H��	����Bj�H�D$dH3%(uH��([]��!����SH��H�� dH�%(H�D$1�H��H�<$H�|$��N���
j�H�D$dH3%(uH�� [��˻�ff.���SH��H�� dH�%(H�D$1�H��H�|$H�<$�������i�H�D$dH3%(uH�� [��k��ff.���SH���	H�� dH�%(H�D$1�H����
���i�H�$H�1�H�T$dH3%(uH�� [����ff.���SH���H�� dH�%(H�D$1�H���g
��8i�H�$H�1�H�T$dH3%(uH�� [�諺�ff.���SH���H�� dH�%(H�D$1�H���
���h�H�$H�1�H�T$dH3%(uH�� [��K��ff.���SH���H�� dH�%(H�D$1�H���	���h�H�$H�1�H�T$dH3%(uH�� [����f.����USH���D$H��t'H����H�ՐH��H������H���D$H��9�u�H��[]�f.����AWAVA��AUA��H��ATI���U��SH��dH�%(H��$�1�L�|$L��訸������8H���Th�D��L������D$�D$���|1�L��1����Ã���	h�L���ƿ�f����g�D$(�����@��g���D$�L$9l$,������D��������g�t$�D$(�t$%�D9���D��������Yg��� ���9g�L��L��訷���f�T$(��%�=@�`g��%�D9���f�9l$,t�|$��D9t$0t
A�����H��$�dH3%(�D$��H�ĸ[]A\A]A^A_�D9t$0�6���A�������%�D9��,���D�D$�D$�,����;��f��D$�D$�f���D���z��I���p�|$0H���d�|$,H���X�M��I��H��H��L��H�=�1�苸��&��fDAWA��AVA���AUATUSH��H���L�g�T$H��$�L�l$0�L$L�D$dH�%(H��$�1��|��D�|$I���Df��H�����H��I�����L��H��H������H�����L��H�����u&�H����L;cs�L��H���`���fDA�>���|$����H��A��芩���H��1����D���D$,���D�|$,A���uJA���t���t��
uiL;crVA�����H��$�dH3%(D���1H���[]A\A]A^A_Ët$�T$��!Ѓ��t�D����x8D�|$,�L��H�����H���ܨ�H�=1�H��1�����y���fDA�>��D�l$�l$H�����H��A���LD��HD�菨�L��H�=�;H��H��1���1�H�D�H�|$,A�BL�
�H�
����H���I��CH�5�H����L;c���L��H���п�����H�����H�=LH��1���L;c�������衴�H�����H�L$�T$H�=`9H���A��H�=R\H��1�����C���ff.���E1��4���@��I�ȉѺ��������ff.�f���AVAUA��ATA��U��H�5n8SH��H��H��{)L�wH�H�Y~)H�1��/��D��D���H�������tH��[]A\A]A^�DL;ss�L��H�߉D$賾�D$H��[]A\A]A^�f���AVAUI��ATA��U��H�5�7SH��H��H�?{)L�wH�H��})H�1����L��D���H������tH��[]A\A]A^�DL;ss�L��H�߉D$�#��D$H��[]A\A]A^�f���SH��dH�%(H�D$1�H���Fb�H��������H��H�H9�w=H��������H�$H)�H��H9�HF��I��H�$H�H�\$dH3%(uH��[��G���H�������胲�H��H�I��1�H�AL�H�w=�����a��1Ʌ�u�*@9rs+�H9�s�9���I��92v��9�r�9ȃ�A�1�H���A��H���AVI��AUATA��U��SH��H�� dH�%(H�D$1�H�T$�_���H�T$��H���P���H�;1�1�H�GH�sI�����M���0D�L$�L$E9��ND��D��A�ȋ4к)�D9�F�D9�t��A��H�4�9.w	VD�A)�E9��D��E���J�<�D�E1�L�L�T���wH����+w�A�I9�u�D)�T*D)�A�E��t!A�Q�H�֋T���D9�u�t$A���D9���E9���`�D��H��D9!vD�!�T$I��H��9is?�T$D9����֍}H�4�9>wu9nCnA�qD)ʉiH�CH�;H��H�����H�1�H�AH�s����H�D$dH3%(��H�� []A\A]A^Ð1�D9�����E1�����D�r�H��t$H�4��x���DE9�t����#���D�ʍM9�����E��tA�Q�A�L$�9L������H�KD��H�;H�T$D�d$H��l$�Z���=���DH�����A����x��7���L���H�
[�1���H�5ӷH�=�衒�D�L$�L$�T����m��ff.�f���AW1�AVAUATA��USH��H��(H�?dH�%(H�D$1��t$H�G�t$1�H�sH������tM�U�H�ЋQD9�r&�D9�����D9����1��4f�A�D$�9�uD�a1���H�SH�;H�t$1�����H�1�H�AH�s��t+H�t$dH34%(����H��([]A\A]A^A_�fDH����ũx�u�L�b�H�
��1��xH�5��H�=���a��H�KH�;H�T$1�1�軹��q���fDH�;1�L�sD�d$D�d$L�o����H�T$D��H��I���q����ń��2���L��1�I���T$9���]��I���9A9���]���E�D$D9�tBA�|$���tD�J�M��O��A9y��9ytgH�KH�;H�T$H���
�����DD�!�D$��������P�A��I��D9b�����A�L��JH�SH�;H��H������w���@�r9��]�I��D�aD;�W�����H�S�t$H�;H������:���D�T$L����D;a�����!]��Ѭ���U��SH��H��H�?tH����H��[]�K��H��w)��H�����H��H�8���H�C��H��H�H��[]���ff.���1��E���D��H��dH�%(H�D$1�H�L$�����D$H�L$dH3%(uH��������AT1�UH��SH�?H�ML�H�GH��t6I�M�`I�L9�t��S�3H��H�����I9�u�[]A\�DH;N�!\�[H�����]1�L��A\���f���AVAUATUSH���1�H�AL�)H�v��tX��tTI��A��1�f���I�D��P�0�B��)�9�v�T�L��[]A\A]A^��D����)��L���o���tD9�r�[]A\A]A^�ff.�f���AUATI��USH��H�?dH�%(H�D$1�H����H�G1҉�1�I�t$I�ʼn����E��tuA�u�H��Q9�rf�89�w`9���9���1�A������[�T
��A�щ�J�<�D�A9�w �R��4��A��J�<�D�A9�v4��9�r�fD1�H�\$dH3%(�H��[]A\A]���ՋW9�sk�N9�r���fD9t%����Q��9xt%���8��I�T$I�<$H���U���I�T$I�<$1��>���f���A9�t�C�9�u#�G��M���A9�t@A���D��7����T$����H��GI�L$I�<$�$H���������I�T$L��I�<$H���������"��f���AWAVA��AUA��ATUH��SH��(dH�%(H�D$1������E9�tD��H��E�f�A����<��E9�v+��H�\$dH3%(�	H��([]A\A]A^A_�fDH�u1�H��H�FL�>D��H�uH�T$A��H�D$���D�D$H�L$A9�t�D��I���D9��Y�A9���D9����@���9���X��u������)�9���A�PI�<�D�ƒ��D9�t6�D9�w/�GA��A��9���X��u��t>��H��)�A9�s���X�f�D)�H�EH�}H��H���H�����1���觧�L��H�
ɲ1��H�5�H�=�蟊��jX�f.���AUATU1�SH��H�H�L�hI�L9�t:�S�3I��1�近��D�S�3L��諑���9��7X�H���I9�u�H����[]A\A]����AU1�ATUSH��H�H�AH�H�v������H��1�E1�L�l����sH��I9�t0���9�s��H��� ��D���9���W�sH��A�I9�uЃ��uH��D��[]A\A]Ð�������H�����D���A�9���W�H��D��[]A\A]�H��������[]A\A]驐�f���H��dH�%(H�D$1�H�T$�~�H�L$dH3%(uH������@��AT1�USH�H�AH�)H�H�w1�1�H��H�AH�vH�1�I��fD9���D9��� �t8A��N�T�A��N��E�
E�E;HwE9ZsE9�s��9���D9��� �u�[]A\�@�����H�H�L�@I�L9�tcH����Q9���V��u��tL��H��)�1��I9�t2�1�Q���9���V��u��t ��)�9��wV�H���I9�u�H���1��L�E�H�
��1��H�58�H�=9��̇�ff.����AWAVA��AUI��ATU��SH��H�?dH�%(H�D$1�H����H�G1�1�I�uH��A���3������9��vV�S�D9t��V�D�`9��1�1��+����*���JE9�sPA�l$D9�����H�<�D�gH��9�u�I�UI�}H���m��I�}1�1�H�GI�uI�����E9�r���U�D9�t"�mU�I�}H��t7I�UH��,$D�t$����H�D$dH3%(��H��[]A\A]A^A_�H��n)� H�����H�8����I�E�H��I�E�@A9�r�I�UI�}H��,$D�t$�K���f�E9����I�}1����d������f���H�GH�7���SI��9w�D�WH�1�H�H�AH�	H�s��D9���D��D�GH���PD�D‰�D)�9�vPE�BL��J����AD�	H��D�D)�9�s,��D�@A��D�G9�uډ_1�[�H�GE1��u���A9���T�A�E)�E�D�W[�D����ff.���AUATUSH��8dH�%(H�D$(1���uH�D$(dH3%(uyH��8[]A\A]�L�l$��I��H��L����y��H�T$��L������t���S���9�r�D$����������t$L������H�T$�t�L�����tЋT$���`����H��l)SH��� H�8H��PH��@H�SH�@H�P[����U��SH��H���G��t��9�t3H�;H�GH����H�53�H�C1��$��kH��[]�f.�H�wH;w�GS�H�?H��H�GH9�rBH��t%H�P�H;SvH��T���:t���,t	��u+D�SH�5ج1�����o���f��k��H�;H�G밾6H�=��聗���AUATI��U��SH��H��(dH�%(H�D$1�H�L�h�G��9�t1D��H��L9�v5��H���c��H���[��A�DL9�v1��$DA�EH9�w����H�����H�L$dH3%(uH��([]A\A]�詟�f���SH�7H���F��t
H�>H�GH���rH��j)H�8H��P H�[�H���`��H�3H��t���fDAWL�W AVAUATUSH���oO A�JdH�%(H�D$x1��AoRA�R )L$0D�D$4A�B0��AoZ �Aob0)T$@�AȉO0�L$D�D�G$D�D$8�w ɉO4AȋL$HD�G(D�D$<)\$P��)d$`�w A�D�G,�O8�L$L�/�_�W@�T$TD�_�GPɋD$dD�w�O<A��ʉWD�T$XE��ȉGT�D$h���D�g�WHȋT$\�GX�D$lD�t$�D�d$ȉWL�G\1���E��E��A��D��A��D��E��H��D1�A��!��D1�B���y�ZD��H��tUI��A��N�$�A�t$ H��v�M�x
A��B3t� M�xI��A��A��B3t� B3t� ��A�t$ �|���@A�͉�D��I��H��A��N�$�I�p
M�xI����A��A���t� B3t� A3t$ B3t� E��A����A1�A�t$ A��E1�A��G�� ���nE��A��D�D�E��H��(u��DD��D��E��I��H��A��N�4�M�A
M�yI��A��A��A��F�D� F3D� E3F F3D� E��A�A	�E�F E��A!��A!�E	�A��A��G��1ܼ�A�։�E�E�A��H��<�z���E���DE��A��E��I��H��A��N�,�I�P
M�xI����A��A���T� B3T� A3U B3T� A�����E1�A�U E��E1�A��G��(�b�D�A��D���D��H��Pu��D�E�Dt$Dd$�f�_D�_D�wD�gG ABAB AB0H�D$xdH3%(uH�Ĉ[]A\A]A^A_��ћ���H�GH��H�H�GD��H��)��Hh1����H��B����H�#Eg����H�H��ܺ�vT2H�B�ff.�@��������S�G`H��H�ƒ���?��?�D ��G`������@H)�H�L ��H����H��1�H���$����H��t������S`�K�D���?H�ƒ���?��?�L �ˆC`��uH���r����C`�ƒ�?�K����?��?�L �ˆC`����K����?��?�L �ˆC`�����K����?��?�L �ˆC`�����K����?��?�L �ˆC`���a�K����?��?�L �ˆC`���#�K����?��?�L �ˆC`�����K����?��?�L �C`��tM[�H�qH�H�D�H��H)�H�H��H������H��1�H�<H��H9�r����@H��[�G������E1����"������t
�@����C`H�߃�?�C`�����C`�@��?H)�H�L ��� ���@����C`��?����H�������C`�ƒ�?����f.�H������C`�ƒ�?����f.�H������C`�ƒ�?���f.�H���h����C`�ƒ�?�K���f.�H���H����C`�ƒ�?�
���f.�H���(����C`�ƒ�?����f.�H�y��H�H�D1�H��H)��4
���������1҉�փ�L�79�r������D�����D1�f�t�����@��D1��u���1�f�|1��i������H����AWA�@AVI��AUI��ATE1�UH��SH���	�I�M9�vW�E`L��L��K�4&L)��?H)�H�| H9�HG�H�������E`H��HU؃�?�E`��u�H��I����M9�w�H��[]A\A]A^A_�f��ff.�@��駲����UH��SH��H���۸��CH��1��h�E�C�E�C�E��E�C�E�C�E�C�E�C�E�C�E�C
�E	�C	�E
�C�E�C�E�C�E
�C
�E�C�E�C�E�C�E�C�E�C�EH��[]��ff.����G�����AUI��ATI��UH��SH��xdH�%(H�D$h1�H��H��讛�L��L��H��萱�H��H�����H�D$hdH3%(uH��x[]A\A]��Օ�DAWAVAUATUSH��H�|$0H�t$8dH�%(H��$x1��T$���:H�\$PH�D$p�D$H�\$H���L��$pH�\$@H���H�\$HH��$�H�\$ H��$0H�D$H�\$(�T$H�L$H�|$ ��I��Hc�HT$8@�B�rH��H������	��r�	��r���	�A�H9�u�H�T$H�|$(��B8�rH����A����
A��
��D1�A��1��B�B A��������D1�1�ȉB<H9�u�H�L$0H�t$1����H���T0�H�� u�D$l�L$`H�-УA��/�BD�\$d�\$h�t$PD�T$TA��D�L$XD�l$\�#DD�eA��E��D��E��A��A��H�����щȉʉ�I������D!�1Љ��1‰��!�1����A@���D�D�A��A��
A�TE��D1�A��E!�A��
A1�D��D1�!�D1�D��M9��u����T$`H�D$@�L$dH�T$�\$lH�L$HD�\$h�|$P�t$TD�T$XD�L$\���:8H��H��H9�u�D$�D$;D$����H��$xdH3%(uH�Ĉ[]A\A]A^A_��2��f�AWAVAUATUSH��(H�|$0H�t$8dH�%(H��$1��T$����H�\$PH��$��D$H�\$H��L��$H�\$@H��PH�\$HH��$H�\$ H��$�H�D$H�\$(D�T$H�L$H�|$ ��I��Hc�HT$8@�B�rH��H��H��H��H	��r�H	��r�H��H	��r�H�� H	��r�H��(H	��r�H��0H	��r�H��8H	�H�A�H9�u�H�T$H�|$(@H�BpH�rH��H��I��H��I��H��L1�I��H1�H�B�HB@I��H�H��H��H��L1�H1�H�H�BxH9�u�H�L$0H�t$1�f.�H��H��H�T0�H��@u�H��$�H�L$pH�-]�I�"�(ט/�BL�\$xH��$�H�t$PL�T$XI��L�L$`L�l$h�%DL�eI��M��L��M��I��I��H��H��H��H��H��H��I��H��H��L!�H1�H��H��H1�H��H��H!�H1�H��H�I@�H��L�L�I��I��I�TM��L1�I��M!�I��I1�L��L1�H!�L1�L�H�M9��a���H�T$pH�D$@H�L$xH�T$H��$�H�L$HL��$�H�|$PH�t$XL�T$`L�L$h�f�H�:H8H��H��H9�u�D$�D$;D$�����H��$dH3%(uH��([]A\A]A^A_����AWAVAUATUSH��(H�|$0H�t$8dH�%(H��$1��T$����H�\$PH��$��D$H�\$H��L��$H�\$@H��PH�\$HH��$H�\$ H��$�H�D$H�\$(D�T$H�L$H�|$ ��I��Hc�HT$8@�B�rH��H��H��H��H	��r�H	��r�H��H	��r�H�� H	��r�H��(H	��r�H��0H	��r�H��8H	�H�A�H9�u�H�T$H�|$(@H�BpH�rH��H��I��H��I��H��L1�I��H1�H�B�HB@I��H�H��H��H��L1�H1�H�H�BxH9�u�H�L$0H�t$1�f.�H��H��H�T0�H��@u�H��$�H�L$pH�-=�I�"�(ט/�BL�\$xH��$�H�t$PL�T$XI��L�L$`L�l$h�%DL�eI��M��L��M��I��I��H��H��H��H��H��H��I��H��H��L!�H1�H��H��H1�H��H��H!�H1�H��H�I@�H��L�L�I��I��I�TM��L1�I��M!�I��I1�L��L1�H!�L1�L�H�M9��a���H�T$pH�D$@H�L$xH�T$H��$�H�L$HL��$�H�|$PH�t$XL�T$`L�L$h�f�H�:H8H��H��H9�u�D$�D$;D$�����H��$dH3%(uH��([]A\A]A^A_������H�g�	j��g�H�GH���H�r�n<:�O�H���H�RQ�h�H���H��ك��[H���H����������AVAUI��ATI�Ժ@UH��SH�GH)�H�|L9�H��IG�H����H�EL�H��?w[H�E]A\A]A^�fDI)�L�L�m�M��L��H���;���I��H��H��L���)���L��I���?I܃�s'������uzI��H�UI��Lu[]A\A]A^ÐI�$H�uH��H�E��I�L�I�L�I)�M)�A�A��A��r�A��1�����I�<H�<D9�r�I��H�UI��Lu��A�$�E���u�����A�L�fA�L��b���@A�$�E��A�L�A�L��F�����鷣����AWAVAUATUSH��H��HH�H�+H�t$H����?H��8H�H��H��H��8M�I��I��xH��8M�I��I��yH��8M�I��I��zH��8M�I��I��{H��8H�H��H��|H��8M�H�L$8I��I��}H��8M�L�D$0I��I��~H��8M�L�L$(I��I��H��8H�CM�H�H)�1�H��I��H�L�T$ L�\$H�D$�q��H�CL�T$ H��L�L$(H��L�D$0H�L$8L�\$�D�B�lH�t$B�|H��L��H��B�|H��H��@�|H��H�� B�|;H��H��(B�|3H��H��8H��0B�|+H��B�l#���H�T$H���H�ðfD�H��H���J��H��j��H����J��H����J�H9�u�H��H[]A\A]A^A_�����m����AUI��ATI��UH��SH���dH�%(H��$�1�H��H���h��L��L��H��芡�H��H���l�H��$�dH3%(uH���[]A\A]�蹈�f���H�؞�]���H�GH��H��|6*)�bH��H��p0ZY�H�� H�9Y���/H��(H�1��g&3gH��0H�Xh�J��H��8H����d
.�H��@H��O��H�GH��HH��@��������AVI��AUATI�Ժ�USH�GH��H)�H�|L9�IG�H���{��H�CL�H��wH�C[]A\A]A^ÐI)�L�L�s�M��L��H���c�I��H��H��L���Q�L��I�䀃�I�s'�����ucI��H�CI��L+[]A\A]A^�I�$H�{L��I��H��I��H�S��I�L�I�L�I)�L)�A�A��D���H�H�CL+�DA�$�S�t���A�L�fA�L��~����A�$�S��A�L�A�L��e�������������AWAVAUATUSH��H��HH�H�+H�t$H����H��pM�I��H��pM�L�\$8I��I��H��pM�I��I��H��pM�I��I��H��pM�I��I��H��pH�H��H���H��pM�H�L$0I��I���H��pM�L�D$(I��I���H��pM�L�L$ I��I��H��pH�CH�H�1�L�T$H��H��H�D$H��H)�H���H�CL�T$H��L�L$ H��L�D$(H�L$0L�\$8�D�B�lH�t$B�|H��L��H��B�|H��H��@�|H��H�� B�|;H��H��(B�|3H��H��8H��0B�|+H��B�l#���H�T$H��H��@H�H��H���J�H�H�H���J�H�H�H���J�H�H�H���J�H�H�H�� �J�H�H�H��(�J�H�H�H��0�J�H�H�H��8�J�H9�u�H��H[]A\A]A^A_�f����Dz����AUI��ATI��UH��SH��hdH�%(H��$X1�H��H�����L��L��H���J��H��H���o��H��$XdH3%(uH��h[]A\A]��	��f���H�ɼ�g�	jH�GH��H�;�ʄ��g�H��H�+���r�n<H�� H��6_:�O�H��(H�т�RQH��0H�l>+�h�H��8H�k�A��كH��@H�y!~��[H��HH��@�������AVI��AUATI�Ժ�USH�GH��H)�H�|L9�IG�H���ˢ�H�CL�H��wH�C[]A\A]A^ÐI)�L�L�s�M��L��H�����I��H��H��L����L��I�䀃�I�s'�����ucI��H�CI��L+[]A\A]A^�I�$H�{L��I��H��I��H�S��I�L�I�L�I)�L)�A�A��D���H�H�CL+�DA�$�S�t���A�L�fA�L��~����A�$�S��A�L�A�L��e�������g�����AWAVAUATUSH��H��HH�H�+H�t$H����H��pM�I��H��pM�L�\$8I��I��H��pM�I��I��H��pM�I��I��H��pM�I��I��H��pH�H��H���H��pM�H�L$0I��I���H��pM�L�D$(I��I���H��pM�L�L$ I��I��H��pH�CH�H�1�L�T$H��H��H�D$H��H)�H��F��H�CL�T$H��L�L$ H��L�D$(H�L$0L�\$8�D�B�lH�t$B�|H��L��H��B�|H��H��@�|H��H�� B�|;H��H��(B�|3H��H��8H��0B�|+H��B�l#�^�H�T$H��H��PH�H��H���J�H�H�H���J�H�H�H���J�H�H�H���J�H�H�H�� �J�H�H�H��(�J�H�H�H��0�J�H�H�H��8�J�H9�u�H��H[]A\A]A^A_�f����׶����AUI��ATI��UH��SH��hdH�%(H��$X1�H��H���8��L��L��H�����H��H�����H��$XdH3%(uH��h[]A\A]��Y�f�AWA�����AVL�w(AUL���ATUH�-��SH��H��XH�dH�%(H�D$H1�H�1�L�d$ H�D$H�D$H�GM�\$(H�D$�H�t$I��M��H��H�F H3FHI��H3FpH3��H1�I�@�I9�tH�H����fDL��E1�E�GA��D��A�����A)�D��A��Mc�����D��)�Hc�H�T� H��8���H��J3T� H1�H�H��(H9�tH�H��(H1�H�H�H9�u�H��A��tH��8����H�W1���
�fDHct�L��H�4�H��H��L�H�H��`u�L�D$ L��L��H�
H��H��H�H�I9�u�M��1�D�y��D��D��A�����)�Hc�H�t� ��A��H�����)�Hc�H#t� D��I10I��A��u�I��(M9�u�H�D$H�L$H�@�H3H�H9�tH�H��H�D$H�T$�_���H�D$HdH3%(uH��X[]A\A]A^A_��}�ff.����H�4Nj��H�VH3���H��H1�H�F����H)�H�|�?H���u���D��H�H��H�1�HLJ�H��H��H)�������H�ǂ�����'�����H�H��H�1�HLJ�H��H��H)�������H�ǂ�����Gb����AWAVAUATUSH��H��D���dH�%(H�D$1�D��߃�A����.�D���A���F/�H��I��H9�vtH��tJH�B��N�.H��DH���p���H��)�D�H	��H�I9�u�E�A����.�H�D$dH3%(��H��[]A\A]A^A_�f�����I)�L��G�B��L�\H���H���P���H��)�D�I	щ��L�L9�u�D��A�L1L�A����-���H��A�Rǃ�H)�H����H9�u%H�{�c���D���ǃ�f�E����-�M��I����N�t�A��DH��I9�tO���H�MH��H1L����H�$L����H)щ��H9�u�H�{H�����ǃ�I9�u����A��E)���,�A����,�E�������A�E�H�31�M�DL���H���P���H��D)���H	։��H�3I9�u��B���I����y�ff.�f����z����UH��SH��H���k����oCE�oKMH��[]�f����'�����UH��SH��H���+����oE�oMK�oU(S �o]8[0H��[]Ð���z����AUI��ATI��UH��SH��dH�%(H��$�1�H��H���x��L��L��H���y�H��H�����H��$�dH3%(uH��[]A\A]��x�f���AUI��ATI��UH��SH��dH�%(H��$�1�H��H���h^�L��L��H���*y�H��H���/y�H��$�dH3%(uH��[]A\A]��	x�f�U��SH��(fodH�%(H�D$1�H��)$��_�8�g+�@��u5H��H���:~�x޸H�T$dH3%(uH��([]�f.�1����w����H��4�ׂ�CH��(1�dH�%(H�D$1�H��H��H��H�$Hi�@BH)�Hi��H�|$H���0���H�D$dH3%(uH��(��w�fD��H��(��Mb1�dH�%(H�D$1��������i��H�$)�Hi�@BH�|$H������H�D$dH3%(uH��(��v�ff.���H��(1�dH�%(H�D$1�H�<$H��H�D$�q���H�D$dH3%(uH��(��Wv����H��(�H��4�ׂ�CdH�%(H�D$1�H��H��H��H�$Hi�@BH)�Hi��H�|$H�����H�L$dH3%(uH��(���u���H��(��Mb�dH�%(H�D$1��������i��H�$)�Hi�@BH�|$H�����H�L$dH3%(uH��(��{u�ff.���H��(�dH�%(H�D$1�H�<$H��H�D$�>���H�T$dH3%(uH��(��$u�@��H�6���@��H�6�Z�@�������H�H9r��������S���~(���H�<�(���[�ff.�����钋�f���SH�7H��H��tH��?)H�8H��P H�[����f��G$GG����UH��SH��H���;;s)��H�t�(��u1Hs H�sH�s�C�CH��[]��[��9v��H�l�(�{H�S��H�C�{Hk H9�vH�kH9�s�H�k�CH��[]�ff.����G����H�G ����H�G����H�G�����W��tUH�G H��xf�f���H*��H*��^��DH��f�f�Ƀ�H���H*�H	��H*��X��^��f�f��ff.����w��tMS97H��F7�t�V�����H�D�(HD�([H��É�H�(�H�
����	b�s93�CF3��1��D���Gf�҅�u	f(��@SH��H���T$�Y�S9f��F�T$�Ѕ��H*�tX1�1��,f�f���H*��\ȍBH���Y��X�f���H*�f/�v&H�D�(H��y�H����f��H��H	��H*��X�뺐�^�H��[f(��f����w����SH��H��97F7�t^f/��F�sBf��1�f/�s6��f��f���H*��Y��Y
��H,����H*�1��\�f/���)�H�D�(H��[�@��H�(��D$H�
h����`�s93�CF3�D$f/y��F��o����fD1��D���G9F�H�G(�f.�USH��H��H�o�o�H9�t	H��<(t0H��H�߹H����|�H��H��H��[]��{��H��[]�f���H���HD��K��ff.���ATUS�<�Q$�H�H��I��H�PH�SL��H��H���S�H;]r
H��[]A\�DH��H���={�H��[]A\�D��SH����t�H��[H���ǖ����UH��SH��H���t�H��H��H��H��[]�ǹ����H��tH�?t	�|S�@����SH��H�?���H��[�W~����SH�����H�[�ff.���SH���c���H��1�[�H�����H�WH;Vu"H��H�6H�?�s����H���f�1��ff.�f���ATI��UH��1�SH��H��蕂�H��L��H��H)�H��HE�H��[]A\���fD��AWAVAUATI��H��USH��H��8M�l$dH�%(H�D$(1�H�t$�oD$H�BH�D$ �D��L��I��H�D$H���N�|-H�l$����I9�v	I9���H��L��L��臠�H�t$I��M��H������H���h��Å��)"�H;D$s5Hc�L��L��y�H�D$(dH3%(ugH��8[]A\A]A^A_���kL��L��Hc�H�����L�L$M��H��H������H�����9�t���!�@L)�H��H�D$�;����m�ff.���H���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�H���$H�D$H�D$ H�D$�D$0��i�H�D$dH3%(uH������l�ff.���H�GH9�r�f�SH��H�?H��H��莋�H9Cw[�fDH��H��[�w�@��AVAUI��ATUH��H��S��j�H���� �I��H=����� �L�4�H�EH��I��0�PH��L��H��H�(H�E�PD�cL��H��H�CH�E�PL��L��A�H�CH��赋�{H��H����}�SA��J�����I��Hc�y.��A�T=��D)�)΋�9�}��H��A����xvA��A��9�|�D9�AO˅�xJE��H�sHc�E)�E��A�F�4D84u,�Q�E�T$�Hc��fDE�
D�H��F:u�х�y�D��E��A��)ʉ�H����y��SH��0D�R���~!�z�H��I��H���4D�H��H9�u�D�]�1�A��Mc�A���}
�V�I��A���|KA�����A�pB94�u�E��E)�D9�}�Hc�H���0@;uD���H��A9��I��A���}�)�D�ރ�~�D��+8H�����0��9�u�H�C0D�H��H9�u�E��t$H�C��H�|A�4���)�H���L�0H9�u�H��[]A\A]A^�E��D9��]����f���SH�H�H�sH�;H��t	H��P H�;H�sH�CH��t	H��P H�;H�CH�H��[H�@ ��ff.�f���AVAUATUSD�_�G L�ۅ��}1�E1�E�c�f�L�wD��A��H�I��L9���H��t4L�o�A8Lu21��fDE��C8L
u�HH��H9�r�u��AЃ�E��A��D9W w�������H�L9����o 1�E1�D��H9�vcH��H9�s1L�WA�8uB��@A�����C8u'A�H9�r�H9�u�G H�OD�@D�G A��E)�D��A�AI��H9�r�[1�]A\A]A^�f�9��
L�OA�8�G���A�HE��1�E)�I��I��A�H��:����A�LI9�u�9�����D)�H�G(�[]A\A]A^�1�E1�L9���L�g�C��E1�I��D�s�)�E�,C�
D�E8���E��ttK�4D���f.�H����tY��F�F�D8t�L���0BL�09�L�A�F�I9�v�D��H9��M��G �v�����9��D����3���L�_(�[]A\A]A^�D��1��fD��H�G(�����G �@��AWAVAUATI��USH��(dH�%(H�D$1�H�GH�D$�H���v���6H�D$I��H��I��1�H�$�.��?L���3��L�M�|A�H9�sb����H��H�$L��H)��HL��xA�?Lc�v�L��L��L��觓��DH���?L���ϊ�M�|A�H9�r������I�T$H��v]�\$H��H��H+D$H9�v\H9��
�t�I�<$H)�H��H�R�H����I�T$H�4H9�s�L����p�I�T$�f.�H9T$s
H�t$L����p�H�5a�L�����H�D$dH3%(u.H��([]A\A]A^A_�f�A�D���:����Ȅ�u����ue�D��AWAVAUATUSH��8H�T$dH�%(H�L$(1�H���S�>I����H�D$$I��I��1�H�D$1�H�D$�8D�H�5KHL���,��L�H��M�tA�H9l$vu����H�t$L���P����I�L$H�L$xA�>Lc�v�L��L��L���Ց��H���H�5�GL��踑�M�tA�H9l$w����t H�D$I;D$rH�H�5XxL���|��H�D$(dH3%(u1H��8[]A\A]A^A_�DA�D��u���@H��L���
o���d�fD��AVAUATUH��SH��dH�%(H�D$1�H����I���H��tW����I��1�L�l$� DA�>v*H�H�I9�v L�tA�>tL��L��L��H)��4I��I9�����D��t1I���IF��Y��H��L��H��H���x��H���V�H��H�L$dH3%(H��u
H��[]A\A]A^��c����AWAVAUATUSH��H��dH�%(H�D$1�H����I���H��tZ����H��E1�L�l$E1��%��}v'H�I��I�M9�t"J�,3�}tL��H������M9����B�3��t1I���IF��d��H��L��H��H���D�H���U�H��H�L$dH3%(H��uH��[]A\A]A^A_��!b���U�SH��H�-J-)H�}H��PH�uL��*)1�H�
-)H��H���L�H��H��[]����AUATUSH��(L�/dH�%(H�D$1�H�H�l$H�\$I�}�N�L�%�,)H��H�$�&DH�t$H��t
I�<$H��P H�D$H�<$H��H���ԩ�u�H���m�L���Ф�I�<$L��H��P H�D$dH3%(uH��([]A\A]��a���H��H�?�`v���H���fD��UH��SH��H��(H�?dH�%(H�D$1�H�L$H�T$莒�t:H�D$���8�H�t$�PH�;�m��H�D$H�\$dH3%(uH��([]ÐH���ȧ�H��H�D$���d`�@��UH��SH��H��(H�6H�?dH�%(H�D$1�H�L$H�T$�����H�T$�����H�t$H�;��uI�t����H�t$H��tH�++)H�8H��P H�EH�D$dH3%(uH��([]���艡����_�f�AVH��AUI��ATUH��S�ZD<r��<tt|<n���L�bfDL�u�L���b�H��H����H��L��L��L)�H��觛�I��E<1t���tU<0u�L�b���L�b���L�b�	��L�b�
�|���@L�b�
�l���@�L��[]A\A]A^ÐL���(]�L��L��H�P���[L��]A\A]A^�ff.�f�AWAVAUATUSH���>H�<$��H��))I��H�$H9�>H�<$�H��PI��M�}1�A� �H�5sL���y��I��H����A�8��D�sE9�s*M�xA�H��t�C�H��I�|��M���M�|�1�D��멐A�|$L�D$I���͠�H��������I��H��H�A�H9����H�$L�D$H�M����L�D$L��L��H�<$�P(E��L�D$I���l���fDH��M�xID��(���H��t�C�H��I�|����D9��L�I�D�H��L��[]A\A]A^A_����6��I������fDH��H�<$E���PL�D$I�����fDH��H�@H��[]A\A]A^A_��ff.����AUATI��UH�,SH��H9����H���"<:��H�!�H��H9������"<:w�H��s�H��H)�I�!L��苉����"<:wI��s
�\L��諀�H�޺L��H���W��H9�w�H��[]A\A]��H�!H���[���1��1�H��L��[]A\A]���@��ATI��H�<6UH��S�ɴ�H��L��H��H�����H��[]A\�N�ff.����AUI��ATI��UH��1�SH��L9�sPH����|\t)H��I9�u�H��L��L��[H)�H�]A\A]�}��DH��L��H)�H��g��I9�wX[]A\A]�f.�H�CI9�t��tL���z�H�s�z�������H����\t}��tmH������t\H���
��\u�H��A�\�$DI��D�H��L��H��D�F�D�AE��t)H�JA��\u�D�BE��tH���������H���ff.�@��AVAUATUSL�/A�E��tKH��I��L��<"��E1��f�H�Ӊ�H�S��t&<"t7�J<\u��t�BH�ZA�H�S��u�[�����]A\A]A^��H��$)L��H��H�8�R��I�E��tH���"h�H�E1�[]A\A]A^�H��$)L��I��H�8���M�.�����AWAVAUI��ATUH��SH��H��dH�%(H�D$1��f�D$H��tj1�L�=]nL�d$1�fDA�|
L�rw:A�DIc�L�>��@�D$rH)�H��L��=��L��H���-��L��L��L9�u�I�H)�H��L��H�����H�D$dH3%(uHH��[]A\A]A^A_���D$1떐�D$n�f��D$t�{���fD�D$0�k����X���AWAVAUI��ATL�%�mUH��S1�H��(dH�%(H�D$1��f�D$H�D$H�D$L�tH�50mL���j�L��L��L�<H���E��B�|=
I�_�:�B�D=Ic�L�>��D�D$rH�t$�L���	�����D$n��f��D$t��f��D$1�f�H�D$dH3%(uH��([]A\A]A^A_��|W�ff.����ATH�5dlUSH��虇�H��uH��[]A\�@H�ſ��;��H��H��I��H)�H���W��L��H���l��[L��]A\�`J���H���AUI��ATI��UH��1�SH��fDH��D�|t)H��I9�w�H��H��L��[H)�H�]A\A]���DH��L��H)�H��σ�I9�v	H�CI9�wX[]A\A]�f��D<nt>w%<0ta<1um�L����z�H�sI9��k����<rt,<tuH�	L���z��پ
L���z���f.��
L���z�뱐1�L���vz��@��L���ez���f���S�H���Y�H��tH��H��[����DH��[���U�H��SH����X�H��t$H��H���	9�H)�H��H�4H��[]����@H��H��[]�fD��H�u )H��H�8���f.���SH��賊�H��[H��������H���8�H��H���wy��AWA��AVM��AUI��ATI��USH��H��I�H��@S�H�,H9�tmA��t/H9�r�of.�H��H9�tM�3L����W�H��u�H9�t8A��t+H9�r�DH��H9�t�u�L���W�H��u�H9�tI�]I�.H��[]A\A]A^A_�A��u�����UH��SH��H���H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H������D
�H��$�H���$H�D$H�D$ �D$0H�D$���I��H��I��H�����H��軆���	�H9�������H�L$dH3%(u
H���[]��WS����H��tOATUH��SH��H���Q�H������L�`H9���	�H�L��H��PL��H��H���r�[]A\��1�H���f�AWAVAUATUSH��(D�"�L$E����	�zH��I��I���6�#����@����H��A��A� ��D$��L��H�D$I��PH�T$H��H���I�WA�H�T�D��t$H���|U�I��H���PD�cE9�r�A�}I�����H��������I��H��H�A�H9��	�I�L�T$H���)L��H��L���P(L�T$H��E���u���DL���U�H����H���3@��u�I�L���H�@H��([]A\A]A^A_��@��u�@��t�H��L�����L��I��I��PL�8A�7H��@����� A��@A�D$�D$9���|$A���I�WL��J�T��pI��D�d$@��t#L���;T�H��u�L��I���p@��u�fDD9����I��J�D%H��(H��[]A\A]A^A_���{H��褓�H��������I��H��H�A�H9����I�L�L$H��tgH��H��L���P(L�L$�|$A�H��D���1���A�w@��u�b���f��rI��@���P���L���hS�I�WH��u�L������H��L���PL�L$H��D��������3�d����D9��,�H�|��������fDH��L���PL�T$H��E���O����A�����D��H������USH��H��H��H9����H�H��H��PH��H��H���o�H��[]�ff.�AWAVAUATA��UH��SH��8H�|$(H��H�L$�M�@I��H�D$ ��`�H��E����I�FE1�E1�H�$@H�D$A�D$�H�D$�Mf�J�<+M��tL�t$ H�t$L��M��rn�O�4,J�<+J�t�L��M���Zn�I�GL9|$t?I��J�|���L�N�4(I��H�D$I�<H;<$v��g��H��H��H�$�8��H���J�3I�~�H�D$(�@t�U�H��8H��[]A\A]A^A_�H��8H��H��H��[]A\A]A^A_�4q�@��f���H��t�>t
�]��D1��D��USH��H9��K�H������H��H��H)�H�sH9��S�H��PH��H��H���Im�H��[]�f���ATUSH���3�H��H����\�H��I��1�H����`�H��H)�H��H������HE�H�sH9���I�$L��PH��H��H����l�[]A\Ð��AVAUI��ATUSH��H��0dH�%(H�D$(1��oD$H�FH�t$H�D$ �b�H��H�D$H��H�|$�^�H�t$M��I��H������H��I��������x���;H;D$s%H�L$(dH3%(L��uIH��0[]A\A]A^�D�3^�L�d$�3I��M��H��I��H������o���9�t��k��,L�ff.����USH��H��H��H��dH�%(H�D$1�H�T$��.�H��Ct*�|$�1S�H�L$dH3%(H��uLH��[]��H�������t$H�V�H9���H�H��PH��H���D$H�ύP��7k�H����}K�ff.�f���H���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�H���$H�D$H�D$ �D$0H�D$�*�H�L$dH3%(uH�����J�ff.���AWAVAUATUSH��H�T$H����I���H��1��N\�A�I����ƒ�HUL��EL�:M��t?L���H�L�4H��M9�s]I�<L����i�E��/v�H�UL��H�BH�EL�:M��u�M9����H�D$I�NC�4H�H��L��[]A\A]A^A_�fDI�~H�$�ˌ�L��H��I��蝍�H�$I���|������USH��H��H���H�T$@H�L$HL�D$PL�L$X��t:)D$`)L$p)�$�)�$�)�$�)�$�)�$�)�$�dH�%(H�D$(1�H����H��$�D$H�T$H�D$H�D$0H�t$�D$0H�D$ �Cuc�~�H�t$H��H������H�V�H9����H�H��PH�T$H��H��H���{h�H�L$(dH3%(H��u$H���[]�fD�~�H�|$H����O����H�ff.�@��H��t7USH��H����F�H�hH���m�H��H��H���g�H��[]��1�H���f.����+����H��t�?t
�O�D1��D��USH��H9����H��H��H)�H�{��~�H��H��H���}g��H��[]�f���H��H�����H��)H��H��H�8H���v�fD��H���H�t$(H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�H��H��H�D$H�D$ H�D$H�
)�$H�8�D$0�&�H�L$dH3%(uH������F�f���H��)H��H��H�8�w&����SH���H�t$8H�T$@H�L$HL�D$PL�L$X��t:)D$`)L$p)�$�)�$�)�$�)�$�)�$�)�$�dH�%(H�D$(1�H���l��H��$�H�T$�D$H�D$H�t$H�D$0�D$0H�D$ ��{�H�|$H���1M�H��H�L$(dH3%(u	H���[��E������t"@8�H��u�!f�8�tH�����u�H���D�����AUA��@��ATA��UH��SH���H�H��H��H��tDH���C�H��H�x�Q|�H��t<1�f.��t
D8�AD�@�4H��H9�u�H��H��[]A\A]�fDH����ff.���AVH�5�YAUATUSH���u�H����H���$C�I��H�x踝�I�I��L9��	H��A��fDH9�rcH��H��I9�t�H�k��
t4��
t�E1�H��I9�u�E��ugL9���[L��]A\A]A^�7�fDH9�r3E��tH��A��H��L��H)��Rq�덾 L���h��ӐH��L��H)��2q��I�D$H��t�L��H�p���N�[L��]A\A]A^�*7�f.�H��[]A\A]A^�@L��L��H)���p�[L��]A\A]A^��6�f�H�@H���5���뛐��H��tC�H��v,��t(H��@��tH��H��H���G�H)��H��w��1��>����ø�����ff.���UH��SH�����t �"�H��@H�H�����J����u�H��H��[]�f���UH��SH�����t ���H��@H�H�����J����u�H��H��[]�f���H��H������
&�H��H���>d�ff.���H��H�������%�H��H���N�ff.���H�H��t7UH��SH��H���fDH��H�H��tH��H�����H��t�H��[]��ff.����H��(�dH�%(H�D$1�H�L$L�D$���H�|$H��VH��t
H�t$�)��H�T$dH3%(uH��(��A�ff.�@��SH��H��H�ֺH�� dH�%(H�D$1�H�L$L�D$�J�H�t$H�.VH��t
H�T$H��輘�H�\$dH3%(uH�� [��!A���H��(�dH�%(H�D$1�H�L$L�D$���H�D$H��UH��HD�H�T$dH3%(uH��(���@����H���P�H��H���7H����SH��H��H���]P�H��[H����u���H��(�dH�%(H�D$1�H�L$L�D$�D�H�|$H�(UH��t
H�t$詁�H�T$dH3%(uH��(��@�ff.�@��SH��H��H�ֺH�� dH�%(H�D$1�H�L$L�D$���H�t$H��TH��t
H�T$H���<��H�\$dH3%(uH�� [��?���H��tH��t�X�D1�H�������D��f���H��tH��t��$�D1�H�������D��f���H��tFATI��UH��SH����1�L��fDH��H9�t�D
E�A��G��D)�t�[]A\�1��ff.���H�6H�?��W���H�6H�?�Q$���H��t7E1�1�f��2H����A	�H9�u�H��)E����D��f�H��)E1��D��ff.�f�������tH��tBE1�1�����t,1�H�����A	����u���H�J)D	��������E1���D�����t.:�t�f.�:uH�����u��fD�1��@��AVI��AUI��ATI��UH��SH��uH��upM��uH��u>1�H��t+M��u�$fDH��I9�tA�4H��L���P�H��u�H��[]A\A]A^�L��SH�
�T1���H�5�RH�=�x�N �L�+�H�
pT1���H�5�RH�=�x�& �fD��AWAVI��AUI��ATI��UH��SH��H��u	H����M��uM��ulM��tUM��tPN�|%1�f�A�4L��H���0P�H��tI9�LG�H��I9�w�H��L��[H)�]A\A]A^A_�fDH��L��[]A\A]A^A_�L��RH�
�S1���H�5�QH�=�w�V�L�3�H�
hS1���H�5�QH�=�w�.�ff.���H�)H��H��1�H�8��D��H��)H��H���H�8���f���1����D�����f���UH��SH��H��H�6H��tH��P H�EH�H��H��H�@ H��[]��D��1�H��t%H�?t'�H����H�?u��f.�������UH��SH��H���;��H��H�މ�H�)H�8H��[]��ff.���USH��H��H�?H��tkH���fDH��H��tXH���S�H�SH�{H�х�u�H��u� f.�H��H��H�;H��H�9H��u�H�H���[]��H��1�[]����USH��H��H�?H��t3H���fDH��H�;H��tH���S�u�H���[]�@H��1�[]�ff.�@��USH��H��H�?H��t3H���fDH��H�;H��tH���L�u�H���[]�@H��1�[]�ff.�@��AWAVI��AUI��ATUSH��H�>H����A�1��f����7�SI�|�M�d	H��H��u�H������I�T$�H9�����kH��I�L��L���PM�}H�D$H�M��tN1�E1�L���L$�T7�L��H��H�XH���X�H�D$�L$J�,0�AH�M�|�H��L�4�M��u�Ld$L9��}��H�D$H��[]A\A]A^A_���A��[�����H��H���G�I��������̐H��I���I��I��H��H��H�I)�L�؃�0H��	H�ֈ��A��H�����A��u������L��H�����SH����o�H��[H���R"�f���L�L�FH��1�I�qH��I��uH��L�f.�H��I9�����I�1��H���U�D�����B�<	��@8����t�#��t��0��	wH���8�u��1��ff.�f����A��@8��������u7H��1�1���.t2��0��	w$��H����tD8�uމ��f.�1��D��@�u���f�����HЀ�	wEI��������1�I����������0H��H��H�H�H�D�@�A��	wL9�v�L9�u<5~Ը�����fDH��tH�:H�1��f���SH��H��dH�%(H�D$1�H���(�x(H�$�����H9�w�1�H�L$dH3%(u
H��[ø�������6�@���f.���SH��H��dH�%(H�D$1�H���'�xH�$H�1�H�L$dH3%(u
H��[ø�������5�ff.�f����f.���SH��H��dH�%(H�D$1�H���<'�xH�$H�1�H�L$dH3%(u
H��[ø�������=5�ff.�f���SH��H�� dH�%(H�D$1�H�T$H�t$��&�u1H�T$�:u'H�T$H�H�L$dH3%(uH�� [�f����������4�@��SH��H��dH�%(H�D$1�H���LN�x(H�$�����H9�w�1�H�L$dH3%(u
H��[ø�������d4�@���f.���SH��H��dH�%(H�D$1�H����M�xH�$H�1�H�T$dH3%(u
H��[ø�������3�ff.�f����f.���SH��H��dH�%(H�D$1�H���lM�xH�$H�1�H�T$dH3%(u
H��[ø�������3�ff.�f���SH��H��dH�%(H�D$1�H���M�1҅�xH9$��H�L$dH3%(��uH��[��23�f��������0��6��A�I��L��A���tv��0SE1�A�H�~I����������~uiH��ttA�@�M9�w0H��D�I��I�D����0��6wQL��H��t�A�@�M9�vи����[�@A��~u7I�~L��t0��W�m���A�@��f.�H��tH�:1�L�[Ð��7�E���������f���SH��H��dH�%(H�D$1�H����W�x(H�$�����H9�w�1�H�L$dH3%(u
H��[ø��������1�@���f.���SH��H��dH�%(H�D$1�H���\W�xH�$H�1�H�L$dH3%(u
H��[ø�������}1�ff.�f����f.���SH��H��dH�%(H�D$1�H����V�xH�$H�1�H�L$dH3%(u
H��[ø�������
1�ff.�f���SH��H�� dH�%(H�D$1�H�T$H�t$�V�u1H�T$�:u'H�T$H�H�L$dH3%(uH�� [�f���������0�@��SH��H��dH�%(H�D$1�H���q�x(H�$�����H9�w�1�H�L$dH3%(u
H��[ø�������40�@���f.���SH��H��dH�%(H�D$1�H���Lq�xH�$H�1�H�T$dH3%(u
H��[ø��������/�ff.�f����f.���SH��H��dH�%(H�D$1�H����p�xH�$H�1�H�T$dH3%(u
H��[ø�������]/�ff.�f�����HЀ�wAI��������1��L9�w+��0H��H�H���D�@�A��v�H��tH�:H�1��������f.���SH��H��dH�%(H�D$1�H���8�x(H�$�����H9�w�1�H�L$dH3%(u
H��[ø�������.�@���f.���SH��H��dH�%(H�D$1�H���8�xH�$H�1�H�L$dH3%(u
H��[ø�������-.�ff.�f����f.���SH��H��dH�%(H�D$1�H���7�xH�$H�1�H�L$dH3%(u
H��[ø�������-�ff.�f���SH��H�� dH�%(H�D$1�H�T$H�t$�E7�u1H�T$�:u'H�T$H�H�L$dH3%(uH�� [�f���������D-�@��SH��H��dH�%(H�D$1�H���C�x(H�$�����H9�w�1�H�L$dH3%(u
H��[ø��������,�@���f.���SH��H��dH�%(H�D$1�H���B�xH�$H�1�H�T$dH3%(u
H��[ø�������},�ff.�f����f.���SH��H��dH�%(H�D$1�H���<B�xH�$H�1�H�T$dH3%(u
H��[ø�������
,�ff.�f���SH��H��dH�%(H�D$1��?-H��t4��xSH�$H��xJH�1�H�L$dH3%(u<H��[��H���o�xH��H�$H9�wH����������t+�@��SH��H��dH�%(H�D$1�H���?�x8H�$�������H�H9�w"�1�H�\$dH3%(uH��[����������+�@���f.���SH��H��dH�%(H�D$1�H���>�xH�$H�1�H�L$dH3%(u
H��[ø�������*�ff.�f����f.���SH��H��dH�%(H�D$1�H���,>�xH�$H�1�H�L$dH3%(u
H��[ø�������-*�ff.�f���SH��H�� dH�%(H�D$1�H�T$H�t$��=�u1H�T$�:u'H�T$H�H�L$dH3%(uH�� [�f���������)�@��SH��H��dH�%(H�D$1�H���\��x8H�$�������H�H9�w"�1�H�\$dH3%(uH��[����������D)�@���f.���SH��H��dH�%(H�D$1�H���܁�xH�$H�1�H�T$dH3%(u
H��[ø��������(�ff.�f����f.���SH��H��dH�%(H�D$1�H���l��xH�$H�1�H�T$dH3%(u
H��[ø�������m(�ff.�f���SH��H��dH�%(H�D$1�H����A�x(H�$H��H��u�1�H�L$dH3%(uH��[Ð��������(�@���f.���SH��H��dH�%(H�D$1�H���|A�x(H�$H��H��u�1�H�L$dH3%(uH��[Ð��������'�@��SH��H��dH�%(H�D$1�H���A�x(H�$H��xH�1�H�T$dH3%(uH��[�@��������4'�@�������������������H���?-t#1��l�H�%?��H��>HE�H���H��1��ul�H��>��H��>HE�H���f.�f�AUI��ATI��USH����$�H�X H���O8�H���%f.�H�H������H���(8�H��L��L��H��H���$b�H��t�H�x�-�H��H��[]A\A]����H��1���-��z��H���@��H��(1�dH�%(H�D$1�H������U��Hi$ʚ;HD$H�T$dH3%(uH��(��%�ff.�@�������H�H9|������H�NH9O|�����f���H�H�A��H9�}nH)Ⱥ��CH��D����D������)ƒ�Hc�H9���H�FH+GH��Hi�@BH������H��H��H��?�������I9ȺC�H���D~>H)����CD����D������)BH�H9�|\Hi�@BH�GH+FH���H�OH�FH9�|#H)��I9ȺC���������f�H)�H�����������f.���H�H�WH++Vy
H����@BHi�@BHc�H��D��H���SD�H��H��S㥛� H��H��H��?H��H��H)����H��XH�|$H�|$dH�%(H�D$H1��)
�f�H�|$H�D$@)D$ )D$)D$0�P�T$$�P�T$ �@�D$0�����D$�S�H����A��H�L$HdH3%(uH��X��r#�f����������SH��H��H�|$H�t$�	�H��H�����H��[�@��SH��H��H�|$H�t$��g�H��H���j���H��[�@��AVAUATI��UH��SH�� dH�%(H�D$1�H�F�.�%�H����H��H�=�;�v�L��H��L�d$�D$L�k�d�H��H���
[�L��A���B
��W��E�����{��L��� �wz�00L�D$L��f�T$L�lj��D$0000�D$�>�L��H���1�x=�D$H�E1�H�L$dH3%(u*H�� []A\A]A^�fDH��L���eZ������������!�@��AV���E��AUATA��U��SH����H��dH�%(H�D$1��8?�D��H��A���J�D��D$�?�D$���]���D!��u H�L$dH3%(u'H��[]A\A]A^�D���H���V�x�D$���,!�D���4u��I���*u�L��H��H�=T:H��1��cq�H�|$1�A�L�S:H�
h:H����2���l���@ATUH��SH��H���H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�H��H��H�D$H�D$ �$�D$0H�D$�\�H�;I���+��H��t
����EL�#H�D$dH3%(uH���[]A\����@AWAVI��AUA���ATUSH���H�|$dH�%(H��$�1��`�ÉD$(����/���AR���H�=5Z�}�I��H���%�D$,�$�H��H�D$0H�$H�D$,H�D$D����D$@�EL���E�H���H�x.u�xt�f�x.t�A��u�H�XH���3�y�D�}A��t�H�$H�޿�T�x`�D$H%�=@�A��u�H��H�=�8�����t\L�D$H�t$I��L��H�
�8H��81������B���f��}�6���L�D$H�t$,L��1�H�
_8H� 8���@H�|$(1�A��L��7H�
e9H��7�I0�L����.��1�I�>�CH��$�dH3%(����H���[]A\A]A^A_�f��u��t�L�D$H�t$,L��H�
�7H��7����d���@�L$���d���L��D��H�������y�T$,�E��u�D$,���*����|$(�!P�x|H���������E��������u�E'L�D$H�t$,L��1�H�
47H��6�c�������fDL�D$H�t$,L��1�H�
.7H��6�6�������L�D$H�t$,L��1�H�
�6H��6�����z����D$,������E���H�|$(A�{1������L�C6H�
�7H�H6�.�L�D$1�L��H�
<6H�<61�����\���H�L$H��61�1�L������?���H�|$(A��1������L��5H�
\7H��5�@.�H�L$1�L��H��51��H��������ff.���AWAVAUI��ATA��UH��SH��(dH�%(H�D$1�H�t$H�|$�F���1�H�=XV1��\�ÉD$�����H�EL��H��D�����A���1�|$H��D�8�N�����1�H�|$A�	L��4H�
�6H�m��S-�E����A�����H�L$dH3%(����H��([]A\A]A^A_�fDH�t$1�H�=J5�]�H��UH�D$����@H�t$H�=d51��Ui�H�E��D�;1�A������z���DL������`����;�W���L��H�=k�1��i�H�E���t
1ۃ����3����'�#����N�f.�@��AWAVI��AUI��H�=z5ATUSH���H�T$dH�%(H��$�1��n�L��D$,���H����1�L��I�����������r�L��H�5H��H��1��S�L��L�}�
�H�D$H�D$0H�D$L���`?�H�����x.�MH�XH�T$L��H�����u�L;}�H����H��H��H���uF�H����H�T$�H����>����D$H%�=@�w���H�D$H;�$��d���H���D�8H�5O4H���pF�L���>�H���H����L���`)�����1�H�|$,�l�����H��$�dH3%(����H���[]A\A]A^A_�f���8����H����H�=��H��1��h����@L��H���5#������x�����f�x.������~���fD��8�+����S��D��8�V������*������f.��H�GH��v6H�H�5<�(H�D��f9t���D�D�N8Hu��fDH�5	�(��D�ff.�@E1��D�@A9�sA�0��A��B9�r�v��A9�r�1��@���������t1�@�PH�Ћ���u��f���H��H����������������L��2��A�I��A��<�1L��2Mc�M�>A��@��I9���A��1�H����E1��wA��A��A�����A��DB�4I��A��A��A���������?	�E9�wى΁������@�ǁ���@��@��tD9�s[�����H��Ð�
�H���@���S�������C�������3�������#�����
H���f�1�@����H����ÐA��H�5�1F���������i����g��ff.�@��H��H��������ff.�f�AVAUATUSH��dH�%(H�D$1�H��tMI��I��I��1�H�l$�DH��L9�s-I�<�?y�D��H��)�����I�Hc�~*H�L9�r�1�H�L$dH3%(uH��[]A\A]A^�I�$�����������ATUSH��dH�%(H�D$1��?tGH��I��H�l$�f�H�I�T$I�<$H��H��A�;tH��H����r�ָ�����	�1�H�L$dH3%(u	H��[]A\��8����AUATUSH��dH�%(H�D$1�H��tMH��H��L�d$I���"DH�I�UI�}L��H)�H��A�H��tL��H��H���}���Ѹ�����f�1�H�L$dH3%(uH��[]A\A]���ff.���ATI��US��������%��=�t����v,L��.H�
F/1���H�5�.H�=�N�\��@�����w>��������	�L��@���7����L������?@�΀�k7���[]A\�f�����w(�������f�[��]L��A\�27�f������됐��H��t5ATI��UH��SH����L��H����H��t�}��u�[]A\�Ð��E1�1�H��t:L��-�f���I��H9�sF��A���vC�
L�H9�v�L��@��H��dH�%(H�D$1�H���,�H�L$dH3%(uH������fD��SH���3�H��[H�������H��A��dH�%(H�D$1�A�����A����wOE�й.1�H�=^%�@�P9�v�
���fD;ww�sa��9�w�D��H�t$dH34%(uUH���H�L$D�Ҿ�H�=������tȋT$H�X���H�I-B�P�f�H�y�p����ff.���AWAVAUATUSH��(dH�%(H�D$1�H����H��H��L�l$I���D$�f.���A�%I�$A��L����L$��A���k�A)кM\���E�����	���T$�N�T$�L$L��i�L)����A�捺a�(�A���tL��D����H��tjL��H��H������9�|$H�H�H)����T���D$���+�B���=�wS��H�
�<Q9����|$L���
�H��u�H�\$dH3%(�D$�zH��([]A\A]A^A_�fDL�T$=����=�v>A����1��D�J9�s!�1L�
����fE;yw�����9�r�L�T$H�=�L�щ¾�����|$���O����D$H�5���FH�5�+�<�L�<�������@L��I�����A�?��u����L��H��H������D$�������L�щ¾�H�=��������t�D$H�5[��<�����|$��������������������*���DH�!��<��|$���D=��s�������D$�n�����ff.���AVAUATI��UH��SH��H�� dH�%(H�D$1�H�T$�m������u$H�L$dH3%(����H�� []A\A]A^ÐH�T$H��L��L�l$H�BH�D$�:�L�����H�D$DH9�vEH�|�7@��yF��L��)�����~NH�t$Lc�L��L��H��h:�H�D$L�H�D$H9�w�1��[����H��L��H�D$�w1�H�D$�L��H�D$�"���H�D$�x��������SH��H��dH�%(H�D$1���H��H��H���Q�������H�L$dH3%(uH��[�����H��dH�%(H�D$1�H����������H�L$dH3%(uH����Q���H��H9�sK1�H��tD�<H��y;�L�H������t���L�H�p�����uH��H��u��H��H�Ѐ��HD���AWAVAUATUSH��H�H9vmH�L$I��I��E1�H�4$1��h�I���8@�L��lNЁ��wPM��tL���0�I�A��H�XH�$I�H;sD�3I�M@���Dyu�E��u-H��1�[]A\A]A^A_�@H�������[]A\A]A^A_�@H�D$@�(H���[]A\A]A^A_�@L�1�A�8%u}I9�rH��usI�@H�A�@��tkA�xtdH��t	I��L9�vVI�ȍH�S��H����6���H��~uIH�~H���������B��)fD��H��(H�G��������BɅ�����A�H�H�BH��z����0��6���H��~uH�~H��uM��tn�G����GɅ�xa��A�H��C0uA�8uH��(H�C�����[�@�B��k����G��H�;H�56(1��7��H�C�����[�@���H�;H�5A(1����H�C�����[����H�W H��H�w�\���ff.��AUATUSH��dH�%(H�D$1�H�GH9G ��H��I��H�l$L�-6+H��H���{_���uIH�S�
��x��L$A�t5@��u#��uNH�|$dH3<%(ueH��[]A\A]�H��H�SM��t
�t$L���6-�H�SH9S w�1���M��t�2L���-�H�SH��H�S��f���������@AWAVAUATUSH��8dH�%(H�D$(1�H�G�(H�D$@�l$'H;G ��H�D$H�D$'I��I��H�D$f�H�t$L���s^���i��d�I��H������T$'H��P�DM��tL���W,�M�wL��I9_ �M���AI9��GH��L��L��L)���4�I�GH�\$H�D$I�G H;D$vI�|$'.uBM�����.L����+�I�OI�G H�L$H9���H�L$�)@�l$'H9��!���H�L$H9L$��M��t%L����I�T$H���&��|�.H�r�����bD�D$'H��Bu<-u{@��M��tL9���L���L+��l$'M�wL��I9G vKH��H�t$L���
]��I�Uu�I�G�8H��@�|$'�zu@��-uH��@��I�GI9G w�I�U�j��I�GH�D$M�������I9������H�\$H�����f�H��L��L��L)��_3��t$'�A���DI�_��P��H��L�t$I�_����DH;\$tH�D$�(@�l$'����H�D$H�L$I�O�]���H��$I�Gf������H�|$(dH3<%(u5H��8[]A\A]A^A_�H9\$�j���1���H�\$�"���L���k��O����a���H�OH;O �~�1���xmATLc�L�%9'UH��SH��C�u/[]A\�D��H���)�H�KH9K v$���xHc�A�tH��H�KH��u���@[�]A\�fD��1��ff.�f���AVAUATUSH��dH�%(H�D$1�H�G H9G��H��I��L�d$1�L�5~&L��H���D$�Z�xzuLH�S���x
��A�u+1�����H�L$dH3%(u`H��[]A\A]A^��H���D$H�SM��t
�t$L���z(��H�C H9C�{�����f�������f�1��������AVE1�AUATUSL�oL�g M9�v|H��H���y`�A�MH��DJtbI�UI�u@H�U�>@D�
L�L��C�HuA�y�@��@��A��+A��D��unH�JH�MH9�t)H��I9�u�H��#A�����H�E[D��]A\A]A^�@I9�v��J��:u�H��tL)�L���R�H�A�H�E[D��]A\A]A^�H����ff.���AVL�5�$AUI��ATI��USH��H�oH�w dH�%(H�D$1�H�\$H������xL��A���H��I�UH9�s6�<%u�H��L���D$�X���I�UuT�I�u ��y��H9�rfH9�tv�M��tI�}H���Y�I�$H�|$dH3<%(��uNH��[]A\A]A^�DI�u �y����H9�s������/t�<#t�H�!I�E������1��������AWI��AVAUATI��USH��HH�t$dH�%(H�D$81�H�GH�D$H�$H���H�?��H�������$�H�D$(H�D$ I�GA�I9G v	�8/��H�l$L��1�H��L�-�#�y\�)f�H�D$�8.tVM��tH�T$(H�|$ H���.��I�GI;G sZ�8/uUH��H��L��I�G�:#�����u�L�l$���P��.����u�H�D$I�GI;G r�@H�D$H��tD�0M���bI�$H�$I;G�ZH�|$H�\$ L�l$(�KL��H���2�L��1�H���~�H�I�$I�W�I9W v-�<#��<?��H�.I�Gf.������H�L$8dH3%(�H��H[]A\A]A^A_���x�����H�D$��tyM����H�|$ L�D$(1�H�GI��9�����s�L��H��I���;�H�|$�{����a���f�f�H�$)D$ ���fDH��E1�I�G����A��A���7�����+���fDI�WH9$����1�����H��L��H��H��H�D$�,������������ff.�@��AVAUE1�ATUSH��H�oH�O dH�%(H�D$1�H9����}?��H��H��L�l$I��H�oH��L�5e ���xL��A�6k��H��H�SH9��}�<%u�L��H���D$�vT�x"H�SuL�H�K �H9�sKH��H�CA�����f.�H�|$dH3<%(D��uHH��[]A\A]A^�H�K H9�r��A�M��t�H�;H���*U�I�$�@H9�s�<#t������AVAUATE1�USH��H�_H�O dH�%(H�D$1�H9����;#��H��I��L�d$H��H�_H��L�56�@��xDA�kt=H��I�UH9�vx�<%u�L��L���D$�QS�x%I�UuG�I�M �fDH9�sCH��I�EA�����f�H�t$dH34%(D��u:H��[]A\A]A^�I�M H9�w��A�H��t�I�}H���	T�H�E��~��ff.���f�H�WGH�WH�G(H�7H�W �ff.�f���ATI��UH��H��SH����H��L��[H��H��]A\�rN�f���ATI��1�UH��SH��@H�dH�%(H�D$81�H��H����L��H���3U�~$H�D$H�E1�H�L$8dH3%(uH��@[]A\ø��������ff.�@��SH�G(H��H��tH�xu[�fDH��1��f�H�C([�H�?�"�H�C([�f���AWI��AVAUATUSH��H��(dH�%(H�D$1�H��H�����H�t$HD�H9�v�>u;M����H��I��H�T$dH3%(��H��([]A\A]A^A_þH�����I��H�D$H9�vn�8tiL�t$L�l$�#Dx~�t$L����H�D$H9�v?�8t:1�L��L��H���R���u�H�D$L���0���H�D$H��H�D$H9�w�M��tL�����H�}H���/�I���/���f�1��&������@��ATUSH��H��t8H����#�H��H��I���u��~L���)��H�E�[]A\�1��Q�[]��A\O��f���ATUSH��H��t8H������H��H��I�����~L������H�E�[]A\�1����[]��A\O��f�AWAVI��AUATUH��SH��X�T$dH�%(H�D$H1�H��tf�F�L���;�M�nH��I�F I9�sA�}[�(I�F L�|$/H��I�~L��H��H�D$H�<$��������D$D�d$/I�FI;F sV�8.�cH��t�.H����I�FH��H�t$H�<$L��I�FH�������)�D$/A��Aăl$u�H����H��A����I�>H���-�D�eH�E�f�E��@H��tL��H��L��L)�H���.%�I�FH�xL��I���Z9�M�fI������XL��H�5�<v�eH�T$0L��
���AfoD$0H��t1H��)$����I�>H���,�
fo$H�Ef�UE@�H�L$HdH3%(�	H��X[]A\A]A^A_��M�nH�{u]�|$H��L��t0����x7H��tH���b��I�>H���w,�H�E1�������y��������s���fD1�H������@I�}H9�v#A�}]I��u���A�<$]�����I��L9�u�H�uI�F����������H�I�F���������L��H�5�I�>1�����I�F�f����I��f�������f�AUD��ATI��UH��SH��dH�%(H�D$1�H����f�FF H�wH�O H9�v>���x.H��H�=��@���x<%t
���H��H9�r�M����I�t$D��H���I�������H�EL�m L9�t)���?�QH���H���=��:���H�|$dH3<%(�XH��[]A\A]��H�wH�O H9��8����1��m����H9��U����;@�L���M��tH�}H���mL�I�$H��H�]�*���@H�XH�]I9�v.�Q�H����H��H�UI9�tV�2H��Dqu�H9�uAH�]I9��9����<?wH���H������H�BH�E���������@I��L��H����5�H�t$H����x/M��t?�D$fA�D$(L�m H�]�H��H�E��������H��H�E��������L�m �S���������������D��1����DH�OH�G H)�H��~�9/t
1����y/u�H����H�O�j���f.���1�������D����2���f���U��SH��H��dH�%(H�D$1���u1��L���1�H���������}H�CH;C rK1�H����=�x|1�H����3�xt��tn1�H�K H9K�P��H�T$dH3%(uwH��[]�8/u�1�H�t$H������~�D$��t����H�t$1�H��������v���������H�~H�C������u�H�AH�C������y����L��ff.����UH��SH��H��H�2H��t(�oH���oJK�'�H�H��[]�fDf�zt�H�zH�T$�;O�8H�����H�T$����AVf�I��AUA��ATUH��SH��H��@dH�%(H�D$81�I��)$)D$)D$ H�D$0�!��H�\$D��L��H�\$L�H�$H�\$ ���H�T$H�UH�L$8dH3%(u
H��@[]A\A]A^��5��D��ATI��U��SH���{��L���H��H��[]A\�g�����AWM��AVI��AUA��ATL�%UH��SH��(H�L$�x@x>��E�,t5H�|$I�WH��tX��H�T$L�D$����L�D$H�T$H��t7fDL��L)�H��~L��H����A���L��H��1��*�I�WI��I��A���u�L��L)�H��H��([]A\A]A^A_�f.�H��(H��H��L��[]A\A]A^A_�D�@��UH��SH��H��H���X��H��H��H����H��H�߾:[]�G����H��I��H�5�����D��SH��H��1��>�H�߾@[����I��1ɺH�5{��fD��ATUH��SH��H���L�I���Ef���:��f��tDf��
���[H����L�����L��H��H���G�H�߾][]A\�v�fDL���X��L��H��[H��]A\��fD��USH��H�H��t>�;[tH��H��[]��H��H���
��H��H��H��[H��]���f�H��H��[]�a���f��u�fD��1�H�5�*�(�ff.�@��H��I��H�5?��E�D��H��I��H�5�+�%�D��UH���/SH��H���f�}uH��[]�f�H��H��H��1�[]�M��ff.�f����f.���H��I��H�5��k�
�D��UH���?SH��H�����}uH��[]�f�H��H��H��1�[]�
�ff.�f����f.���UH���#SH��H����}uH��[]�f�H��H��H��1�[]�]��ff.�f���I��1ɺH�5����fD��I��1ɺ!H�5���fD��H���������H�O(H��H��H�
H��?H��H)�����AWAVAUATUSH��H�/D�gdH�%(H�D$81�D�oD�w��<D��_L�OL�GH�wH�OH�W(H�G0�;L�L$D�H��L�D$H�t$�,$H�L$H�T$(H�D$0�M%�+\$D+|$D	�D+t$D+l$D	�D+d$D	�D	�u79,$H�����HE�H�L$8dH3%(u"H��H[]A\A]A^A_�f.�H����������f��E1ɍHЀ�	wf�A�AI����HЀ�	v�<-t�<.tUE��F�DA��Ltb�UH��`(�
@A8�tK�HH����u�A��{tGD�1�B�<���1���E�QF�M��A�@�<	v�A��-t�A��Lu�E�QM��F��A�AI�É���tlD��E1�A��%<\tJ<{t@<}uA��tD�FH�����t��E��tٍFE1�H�����u�D)Ή2��DA����A��D)���1��ܐ��UH��SH�����H��H��t&�G�H��@H��H��t�D�H�S��DA u�H��H��H��[]�9�ff.�@��UH��SH��(dH�%(H�D$1�H���+��H��H��H���=��H����H�L$dH3%(uH��([]����@��AUI���ATI��USH��(dH�%(H�D$1�H���_B�L��H�����H��L��H������H��H�s1�D�H��H��H	�H9�u�A�D$��tA�D$Hc�H��1�H��1�H�5�H���7#�EA9D$~)H�8fD�H��1�H���^��EA9D$�A�D$H�����H�\$dH3%(uH��([]A\A]������ATUH��S�@0�A���sA�MH�Å�tD��1��E��A��1�D��H�5LH���"�C9E~&L�%�D�L��1�H�����C9E��EH��[]A\�S����USH��H���N��H�xH������(�H�L(���tf�H��H���Q���u�H��[]����H��dH�%(H�D$1�H���P��H�4$��y
H�$1�1�H�=x
�6�H�T$dH3%(uH����V��fD��SH�����H��[H���W"��������������USH���H��dH�%(H�D$1���?��3H�$@��tAH��H�-�	���;�H���3@��t#H�<$@��.u�H��H������3@��u�H���$��H�L$dH3%(uH��[]��x�����AWAVAUI��ATI��UH��SH��HH�H�L$L�D$dH�%(H�D$81�H�D$(H��u0�H�M��t;H��L��L���m���uA�<.�nH���;L�st�M��t���f.�H��L���u5�H��H����H��tBH�T$(�H��tkH�L$H�H�L$8dH3%(�H��H[]A\A]A^A_��H�ƹ	H�=r�����u�H���(H��H�T$(H��u�D�:H���k��H�
�H�L$H��tH�HH��H��H�L$�&�H�þ;H���6��H����H���(L�:L�bM�M9�t0H)�H�ŐM�7H��H��L����uA�<.�hI��M9�u׹H��I�mM�eH�D$0H�=��������M��u��H���x����XI��I�<$H��u�H�D$H�8��H��H�=s1���2�H�D$(H��H�=E1��2�H�L$H�1�H�T$(H�
��H��HD��X���H�ƹH�=ͥ������~�H�=�?H����������H�=t�H�����������i���7�H��H�D$(����DH�CH�e�H�L$H��HD�H�����H�-�(H�H�T$(���H�T$H�L$(H��L��L�D$A�WH�T$(�������
���DH�����H�����H�T$0H�L$H��H�|$A�T$H�T$0H�
�H��HD�H�T$(��u����������6�H��H�D$(�
���H�|$����H��H��H���HDи���H��H�=�1��!1�H�L$H��0������ff.�@��AWf�AVAUI��ATUSH���L�L$dH�%(H��$�1�I��6D$HH�T$0H�L$8L�D$@@���uI���D$H��W(� �L���h�L��M��I��A�w@����M�}@��%u��|$PA�EH�D$HA����@�|$P<-uA�EM�}A�����<0u��A�GI����@�|$P�PЀ�	w1ҍ�I���TP�A��p�@��	v�T$L<.�A�/L�L$`E1�L��H�@��L�@�UH���fD@8����BH��H�V��u�@���H�D$(@��{���}L��L�$���L�$H���@H�D$0�{H��u��f�H�x��H���0@��t�@8�u�L�pH�y�M��LD�L�t$(E��t6A�E�M�iI�D�H�l$0H�$�I��L��H��A�M��I��H�D$(L9,$u�l$H����L�������Hc�H9�vH)�I�L�t$(�t$LM�o�����D$P�����9Hc�L��L����A�w@���	���H��$�dH3%(�D$�<H���[]A\A]A^A_�D��t���I���l$HL�t$(A�>u�t$LM�o���u���L������H��L��L�������H�VI�GH�H��tHA��H��A��
t:�(I��H�@��L����H����A��H��H�G�I�GA��
u�fDA�oI�����H�D$0@��H���H���@��%�H�D$H�8�
1���H�=.�`-�L$I��H�D$(���E��D$L��M�o�	��L��L��H��������L��1���f.�<\t7<{t.<}����)�L���BL�R������� @��t�1��܃��׿��D�D$LA�o���D$L@�|$PD�D$H@��0trI���@��-uA�o�����I���U�1���	w���I���DU�A�/�UЀ�	v��ƉD$L�u���L���4$�"��4$L��Ɖt$LHc�L���k������A�oI��@�|$P�|�����LD�L��I�wL�D$L�$H�l$0H)�H�L$(L�L$H�����L�t$(L�$L�L$M����M��;D$���D$�~���I���L���4$���Hc4$H��H9�������0L���s�D$L���D$LH�H9��L�t$(�Y���H��H�D$(I���F�����H�=1��$�P+�H�L$�$H���������������D$������顙�f���AWAVI��AUATUSH��H��H�|$ H��H�t$�;H�L$0L�D$dH�%(H��$�1��a��I��H��t%�;H���l��I�H�5H�D$�W3�I��H�t$�H�=}��������H�=����H�ÿ@��4�@I��H�D$8�4�{H�D$(�4�L��H�����L�D$H�|$ L��H�L$HH��������L�d$HL������L��L��H����H�t$��D$@�D$DH�=�������M����M�7M�����D$I��L�%��@�=L���K��=L��I�����H�����L��L�pL����€������	L��H�=K��������L��H�=6���������L��H�=h�����ue�H�=ygL����������H�=�L���������H�=AgL����������D$M��tM�7I��M�����H�}��H�t$�H�=a���������{���H��I��H�D$8H�PH�0���D$@����L�l$(�L��SI�UH��t
I�uL��S H�UH�uL��S 1�H���?��L��H��S(�sH9utH���E��l$@u��D$D���^��H���x��D$���TH�uH�}�[��H�\$0H��H��$�dH3%(��H�Ĩ[]A\A]A^A_�DH�t$@L���S�����T$@�������H�=�1��1'�H�\$H�������f�H�t$DL���������C�T$D��9�G‰D$D�[����D$�K���H�|$��H��H���e���1��5����D$����H�T$(H�t$8H���L�JH�NUhP�D$XPL�H�H���,��H�� ���|�D$D��������D$���������������@�0�H�UH�u1�H��H�l$PH��(f�I��H��D$\D$lD$|DŽ$�H�D$P�D$XH�D$`������H��H�����H�����H�\$0H���9����L���D$@���H�|$(L��H���@�����1�H���������H�D$(H�xu5H�D$ L�L$L��H�|$(H�HL�@H��+������������1�H������L��H�=��1��+%�H�\$H���������L��H�=����D$�}���L��H�=����H�D$H�0�H�������M����F��fD��I��E1�1����ff.�@��SH��dH�%(H�D$1�H�T$H���z��{��u�$�H�L$dH3%(��uH��[�����ff.�f����7����AWAVAUI��ATUSH�����tdH��A���
@��H���tO�CH�k��%u�t>H������D8�A��E����A �u'<{A��M����A �u+�SH�k�f�E1�H��D��[]A\A]A^A_��{H���;��H���B��L�x�}L���!��H��H��t�H��L��L��L)�H���5���uA�|t��UH���6���ff.����H�=e�(�P����H�՟(AT�H��USH�8���H�ӛ(�H�+�(H��(H��H�;��L�%�(H�-�������H���(1�H��H���v��H��H�C�H�H�iH�H�;I�<$H�5��(u���H���(1�H���>��H��H�n�H�H�=��(H�iH�5��(�J�H���(1�H���	��H��H�h�H�H���(H�A[]A\�@H�-����ff.�@��H�H��tUUSH���8�͐�H��H�-�(�f��8����H�
�(H�}H��1�H�����H�H��u�H��[]��ff.���H�?��AWAVAUATI��USH��H�����H�-��(L�-��(M�}1�1�E1�I�GH����u$�XM�}1�A��I�GH��A9�sBD��H9��.��H��I�I�4$H��H�<����u�H��H��L����H�-6�(�@I��I�<$tI�|$�y������@H��[]A\A]A^A_�����AWAVAUATI��UH��SH��H��(dH�%(H�D$1�H����H��E1��@I��H���8u�H�xu�A�UH���nH��E1���I��H���8u�H�xu�B�:L��H���H�4@H�����H�D$H��H�$M���
K�Dm�L�4�����H�T$1�H��H��I������C�L��A�EH�s���L��I�EH�s���H�<$H�t$I�EL9�u�M��tbK�H��L�l�fD�s�H�T$1�H��H��H���-���C�L��EH�s��:�L��H�EH�s��*�H�<$H�t$H�EI9�u��#�H�T$1�H������1�H��蚰�H�L$dH3%(ufH��([]A\A]A^A_þ�R���H�4RL��E1�H���H�����H�D$H��H�$M��������y����E1��<������f.�D��AWAVAUATUSH��H��H�5�TH��H�L$1�L�$dH�%(H��$�1��K��;H������H���TH���=��0L�}H�����H������@H�D$�s(��uI��@����H�D$0E1�1�E1�H�D$�,�@��;�n@��:tpL�����I��A�7@��t[@��\t=@���|@��%��@��{��D����E��t�1�@��}��A)���I��A�7�@��u�fDI�}��H�|$H�GH��H�D$H����t$���H�s�H�t$0�H�D$0��L�|$�L�����H�I�����H�D$L�l$0H�(����0H�����H�����H�}I��u4��L��H���d��L��L��H�D$0�/��H�}���@��&�H�KL�$L�CH�H��I��H�u�,����H��$�dH3%(��H��[]A\A]A^A_��L��1�����Y���f�A��=���DA��E1��,���@I�D$H��H�����?H���t��H�0}M�$$H�5'�H�D$pH��$�H�k<A�M�|$I�l$H�t$xH��$�H���M�,$H��$�H�1<H��$�H��H��$�H��H��$�H�U�H��$�H�8�H��$�H�U�H��$�H�?�H��$�H���H��$�H���H��$�H���H��$�H���H��$�H��H��$�H��D���(�����I����I��J�t�pH��u��;��L���H��H�|$H�t$0�H�D$0�������f.�L�����H�t$H�|$�H�D$0���@�$�I���m�����v�����%H�E�Hc�H�>��H�t$(L���>$�L��H�=����xmH�t$0L���#$�L��H�=����xRH�5"�H�T$(H�D$0Hc�H�>��1�1�H�މ��|��H��I���!�H��D��L��H��H���]��H��H�=��1��|�H�$H����������L��L���`�����@���2I�D$H�L$H�����L��L���0�����L��L������@���L��L���~��Љ���L��L���j���@���L��L���W���@���L��L���D������o���1�H�\$0�L��H������A�ƅ����E1�1�1�L��H���F����������H�����������H9�@���
���H9�@�����H9�@����H9�@�����H9�@������H9�@������f�I�D$ ����H�='�1���H�$H���������L��L���\���@�����H�$H�A�H�������q������<���H��H�=��1���H�$H����I�������g���D��E����AWH��AVAUA��ATUSH��(�f.��AL��L�I��u�H�Y�H����D�@H��H�HE��u�H�h�H9���E1�1�E1�H9�vPM��u3H��(1�[]A\A]A^A_�f.�H���<*t��������@H�j�L��E1�H��H9�vE1�D�;A��*t'A��?u@H��H��H9�v�I���_fD�;*��H��H9�v�H��(A�[]A\A]A^A_�D�EE��uNE8�������M���D���H��H9���E1�I9�s��I��L9�w�A�>*t�����@H�t$H�|$�L$D�D$H�$�L��D�D$�L$H�H�|$H�t$B��B8���H�$�p���D�H��I��E1������H��H��A�����L��H��E1����I��E1��J���f���H��1��������H������H����������H���@��H���~AUA��ATI��������UH��SH��H��L9�L��H��D��HF����H��xt*H�H)�u�H��1�[]A\A]�DH�������[]A\A]�����H�������[]A\A]�1��f���H���|AVA��AUI��������ATI��UH��SH��L9�L��H��L��HF�D��譴�H��xt&I�H�H)�u�[1�]A\A]A^�[�����]A\A]A^�f��[��������[]A\A]A^�1��@��H��
(1���
���H��H���/.../.shared/priv/%s/%sdict-fs.cfs_write(%s) failed: %sfs_delete(%s) failed: %siterate value poolret != -2../../src/lib/istream.hread(%s) failed: %sfile dict transaction(flags & DICT_ITERATE_FLAG_RECURSE) == 0file %s: line %d (%s): assertion failed: (%s)(flags & DICT_ITERATE_FLAG_EXACT_KEY) == 0(flags & (DICT_ITERATE_FLAG_SORT_BY_KEY | DICT_ITERATE_FLAG_SORT_BY_VALUE)) == 0i_stream_read_morefs_dict_lookupfs_dict_iterate_initret == 0oauth2.cret != 0oauth2_json_tree_buildoauth2-request.cInvalid response datareq->req_callback != NULLNo token providedexpires_intoken_typebeareroauth2 requestX-Dovecot-Auth-ServiceX-Dovecot-Auth-LocalX-Dovecot-Auth-RemotePOSTContent-TypeBearer %sGET&client_id=&client_secret=token=grant_type=password&username=&password=&scope=status_hi == 2 || status_hi == 4Malformed number '%s' in expires_inExpected Bearer token, got '%s'application/x-www-form-urlencodedgrant_type=refresh_token&refresh_token=oauth2_request_callbackoauth2_request_continueoauth2_request_parse_json/%%2f%25HS256sha256HS384sha384HS512sha512unsupported algorithm '%s'%s key '%s' not foundInvalid base64 encoded keyIncorrect JWT signaturedefaultMissingMalformedset->key_dict != NULLoauth2-jwt.cNot a JWT tokenalgkidCannot find 'alg' field'kid' field is emptyMissing 'sub' fieldexp%s 'exp' fieldnbfMalformed 'nbf' fieldiatMalformed 'iat' fieldToken is not valid yetToken is issued in futureToken has expiredissToken is missing 'iss' fieldIssuer '%s' is not allowedaudscopeazp ,HSNo crypto library loadedUnsupported algorithm '%s'Cannot load key: %sBad signature../../src/lib/array.hclient_id set but aud is missingclient_id not found in aud fieldscope set but not found in tokenidx < array->buffer->used / array->element_sizeconfigured scope '%s' missing from token scope '%s'array_idx_ioauth2_try_parse_jwtGROWING-oauth2 key cachekey not found from hashEmpty sub-domainInvalid character in domainInvalid IPv4 address literalInvalid address literalIPv6Empty address literalInvalid IPv6 address literalUnsupported %s address literalMissing ']' at end of address literalInvalid character in address literalInvalid character after '\' in quoted stringInvalid character in quoted stringPremature end of quoted stringInvalid hexchar after '+' in xtext B�1!1���A.Invalid character in stringquotedsmtp-syntax.csmtp_char_is_qpair(*p)Invalid character in xtext+%02XParameter is emptyEncountered NUL character in xtextMissing EHLO parameter after ' 'Unexpected character in EHLO keywordUnexpected character in EHLO parameterarray_idx_ismtp_string_writeInvalid charactersmtp-address.cMissing domain after '@'Invalid domain@!smtp_address_isnull(address)Trying to allocate %zu bytesMailbox is empty stringInvalid character in mailboxUnmatched '>' at end of pathMissing '>' at end of pathNull path not allowedPath is empty stringInvalid character in pathaparser->parseUsername is empty stringaparser->address_end > parser->beginInvalid character in localpartfile %s: line %d: memory allocation overflow: %zu + %zuPath only consists of source routeMissing '<' at beginning of pathMissing domain after '@' in source routeMissing '@' after ',' in source routeMissing ':' at end of source routeInvalid character in user namesmtp_address_add_detail_tempsmtp_address_add_detailsmtp_address_writesmtp_address_detail_parsesmtp_address_parse_path_brokensmtp_address_parser_find_endAUTHSTARTTLSPIPELININGSIZEENHANCEDSTATUSCODES8BITMIMECHUNKINGBINARYMIMEBURLDSNVRFYETRNXCLIENTsmtp-params.cUnsupported mail BODY typeDuplicate ENVID= parameterDuplicate RET= parameterMissing RET= parameter valueDuplicate SIZE= parameterMissing SIZE= parameter valueDuplicate AUTH= parameterMissing AUTH= parameter valueDuplicate BODY= parameterMissing BODY= parameter valueInvalid MAIL parameter: %s<>BODY7BITENVIDRETFULLHDRSUnsupported parametersBODY=7BIT BODY=8BITMIME BODY=BINARYMIME BODY=ENVID=RET=HDRS RET=FULL SIZE=%lu mail_param_authmail_param_bodymail_param_envidmail_param_retmail_param_sizeDuplicate ORCPT= parameterDuplicate NOTIFY= parameterInvalid RCPT parameter: %sNOTIFYNEVERSUCCESSFAILUREDELAYORCPTInvalid ORCPT= parameter: %sNOTIFY=ORCPT=%s;rcpt_param_notifyrcpt_param_orcpt_typercpt_param_orcptUnexpected character in parameter keywordUnexpected character in parameter valuesmtp_param_value_valid(param->value)Missing ENVID= parameter valueInvalid ENVID= parameter value: Contains non-printable charactersUnsupported RET= parameter keywordUnsupported SIZE parameter valueInvalid AUTH= parameter value: %sInvalid AUTH= address value: %sInvalid ENVID= parameter value: %s(caps & SMTP_CAPABILITY_8BITMIME) != 0(caps & SMTP_CAPABILITY_BINARYMIME) != 0 && (caps & SMTP_CAPABILITY_CHUNKING) != 0Missing ORCPT= parameter valueInvalid addr-type for ORCPT= parameterInvalid ORCPT= parameter: Invalid character in xtextInvalid ORCPT= address value: Contains non-printable charactersInvalid ORCPT= address value: Invalid RFC822 addressInvalid ORCPT= parameter: Empty address valueMissing NOTIFY= parameter valueInvalid NOTIFY= parameter valueparams->notify == SMTP_PARAM_RCPT_NOTIFY_NEVERparams->orcpt.addr_raw != NULL���������@����<��\��l����smtp_params_rcpt_add_orcpt_to_eventsmtp_params_rcpt_add_notify_to_eventsmtp_params_rcpt_write_orcptsmtp_params_rcpt_write_notifysmtp_params_mail_write_bodysmtp_param_write%u.%u.%ureply->status < 560smtp-reply.creply->enhanced_code.x < 6%03u 
status_codeenhanced_codesmtp_reply_write_one_linesmtp_reply_writeInconsistent status codes in replyEncountered unexpected %s after reply status codeEncountered stray CR in reply textEncountered stray %s in reply textparser->state.state == SMTP_REPLY_PARSE_STATE_INIT || (parser->enhanced_codes == enhanced_codes && !parser->ehlo)array_count(&parser->state.reply_lines) > 0parser->state.state == SMTP_REPLY_PARSE_STATE_INIT || (!parser->enhanced_codes && parser->ehlo)smtp_replyReply exceeds size limitsmtp-reply-parser.cparser->input->eofPremature end of inputStream error: %sInvalid status code in reply�����K���������=��=��smtp_reply_parse_ehloarray_idx_ii_stream_read_moresmtp_reply_parsesmtp_reply_parse_nextCommand data too largeAUTH responseCommandcommand parameters<CR>p <= parser->endsmtp-command-parser.cCommand name is too long`%c'<0x%02x>%s line is too longUnexpected character %s in %sparser->data == NULLUnexpected character %s in command namemax_size == 0 || buf_size <= max_sizeInvalid UTF-8 character in command parametersDuplicate space after command nameExpected LF after CR at end of %s, but found %s!parser->auth_response || parser->state.state == SMTP_COMMAND_PARSE_STATE_INIT || parser->state.state == SMTP_COMMAND_PARSE_STATE_ERRORparser->state.state == SMTP_COMMAND_PARSE_STATE_INITCommand data size exceeds maximum (%lu > %lu)Command data size exceeds maximum (> %lu)parser->auth_response || parser->state.state == SMTP_COMMAND_PARSE_STATE_INIT || parser->state.state == SMTP_COMMAND_PARSE_STATE_ERROR��z
��F������c���smtp_command_parse_auth_responsesmtp_command_parse_data_with_dotsmtp_command_parse_data_with_sizesmtp_command_parse_parameterssmtp_command_parse_identifiersmtp_command_parsesmtp_command_parse_nextDisconnected[plug][data][empty]cmd_namecommand %s: cmd->stream_dotsmtp-client-command.cconn->dot_output != NULLsmtp client commandcmd->refcount > 0cmd != conn->cmd_streaming (already sent)Abortedsmtp_client_command_finishedAborted%sRemoved from send queueRemoved from wait listconn->cmd_wait_list_count > 0cmd->delayed_failure == NULLFail (delay)Failed: %sFail delayed!cmd->delay_failurecmds_list_count > 0replies > 0cmd->replies_seen <= 1cmd->stream != NULLPipeline is pluggedPipeline occupiedPipeline blockedBlocked while sendingFinished sending payloadPartially sent payloadBroken payload streamBlocked while sending payloadconn->cmd_streaming == NULLsmtp_client_command_sentSentstr_len(cmd->data) > 2Sent: %sQUITsmtp_client_command_startedEHLOSubmitted, but disconnectedSubmitted with prioritySubmittedBDAT %luBDAT %zu LASTarray_count(&ctx->cmds) > 0NOOPVRFY RSETMAIL FROM:<%s>RCPT TO:<%s>Destroy (%u commands pending, %u commands queued)cmd->state >= SMTP_CLIENT_COMMAND_STATE_FINISHED!cmd->plug || state <= SMTP_CLIENT_COMMAND_STATE_SUBMITTEDconn->cmd_send_queue_count > 0conn->cmd_send_queue_count > 1 || (cmd->prev == NULL && cmd->next == NULL)state < SMTP_CLIENT_COMMAND_STATE_SUBMITTEDcmd->state < SMTP_CLIENT_COMMAND_STATE_FINISHEDcmd->replies_expected == 1 || cmd->replies_expected == repliesConnection not ready [state=%s]cmd->send_pos == cmd->data->usedcmd->stream_size == 0 || stream->v_offset == cmd->stream_sizeFinished reading payload streamcmd->stream_size == 0 || stream->v_offset < cmd->stream_sizeafter == NULL || cmd->conn == after->conncmd->state < SMTP_CLIENT_COMMAND_STATE_SUBMITTEDi_stream_get_size(%s) failed: %scmd->replies_seen < cmd->replies_expectedGot reply (%u/%u): %s (%u commands pending, %u commands queued)Failed to read DATA stream: %sctx->data_left >= data->v_offset���� �`�_cmd_bdat_cb_cmd_bdat_send_chunks_cmd_data_cbsmtp_client_command_data_submit_afterarray_idx_ismtp_client_command_input_replysmtp_client_command_set_streamsmtp_client_command_writesmtp_client_command_submit_aftersmtp_client_command_sentsmtp_client_command_finish_dot_streamsmtp_client_command_send_streamsmtp_cient_command_waitsmtp_client_command_send_linesmtp_client_command_do_send_moresmtp_client_command_set_repliessmtp_client_command_fail_delayedsmtp_client_commands_list_fail_replysmtp_client_commands_list_abortsmtp_client_command_fail_replysmtp_client_command_abortsmtp_client_command_unrefsmtp_client_command_newsmtp-client-transaction.crecipients_abortedrecipients_deniedrecipients_failedrecipients_succeededyesis_resetrcpt->pool != NULLsmtp transaction mailrcpt <%s>: rcpt_to!rcpt->finishedsmtp transactiontransaction: Createdtrans->refcount > 0DestroyAbort (already failing)Aborttrans->callback != NULLtrans->conn != NULLGot RCPT reply: %sprcpt->queuedDeniedFinishedtrans->to_send == NULL!trans->resetdata_sentreply != NULLAlready failing: %sReturning failure: %sGot MAIL reply: %smail != NULLmail_frommail_from_rawStartmail->mail_callback == NULLSending MAIL commandSending recipientsSending resetfailure.status != 0Sending dataNo valid recipientsAdd MAIL command!trans->data_providedtrans->mail_head == NULLAdd recipientsmtp transaction rcptAdd recipient (external pool)Got all RCPT repliesSendtrans->data_input == NULLtrans->to_finish == NULLResetFailed to connect: %sConnection lost: %strans->failure != NULLwaiting for connectionwaiting for reply to RCPT TOwaiting for reply to DATAwaiting for reply to RESETnewsmtp_client_transaction_finishedsmtp_client_transaction_rcpt_finishedtrans->state <= SMTP_CLIENT_TRANSACTION_STATE_MAIL_FROM || trans->state == SMTP_CLIENT_TRANSACTION_STATE_ABORTEDrcpt->queued || rcpt->external_pooltrans->state <= SMTP_CLIENT_TRANSACTION_STATE_RCPT_TO || trans->state == SMTP_CLIENT_TRANSACTION_STATE_ABORTEDtrans->state >= SMTP_CLIENT_TRANSACTION_STATE_FINISHEDRCPT replies are still pending (%u/%u)Transaction is not yet completeGot all RCPT replies and transaction is completeServer accepted more than a single MAIL command.trans->state < SMTP_CLIENT_TRANSACTION_STATE_FINISHEDtrans->state == SMTP_CLIENT_TRANSACTION_STATE_NEWsmtp_client_transaction_startedtrans->state == SMTP_CLIENT_TRANSACTION_STATE_MAIL_FROMtrans->state < SMTP_CLIENT_TRANSACTION_STATE_RCPT_TOConnecton is ready for transactiontrans->state >= SMTP_CLIENT_TRANSACTION_STATE_NEW && trans->state <= SMTP_CLIENT_TRANSACTION_STATE_ABORTEDwaiting for reply to MAIL FROMRemote server not answering (transaction timed out while %s)aU�U�0U�@U�T��T��T��T�smtp_client_transaction_get_state_destriptionsmtp_client_transaction_get_state_namesmtp_client_transaction_connection_destroyedsmtp_client_transaction_resetsmtp_client_transaction_sendsmtp_client_transaction_add_pool_rcptsmtp_client_transaction_add_rcptsmtp_client_transaction_start_emptysmtp_client_transaction_startsmtp_client_transaction_rcpt_finishedsmtp_client_transaction_data_cbsmtp_client_transaction_send_datasmtp_client_transaction_finishsmtp_client_transaction_send_resetsmtp_client_transaction_mail_cbsmtp_client_transaction_try_completesmtp_client_transaction_rcpt_approvedsmtp_client_transaction_rcpt_cbsmtp_client_transaction_do_submit_moresmtp_client_transaction_add_mailsmtp_client_transaction_set_timeoutsmtp_client_transaction_set_eventsmtp_client_transaction_fail_replysmtp_client_transaction_unrefsmtp_client_transaction_abortsmtp_client_transaction_rcpt_set_data_callbacksmtp_client_transaction_rcpt_freesmtp_client_transaction_rcpt_abortsmtp_client_transaction_mail_abortLHLOHELOsmtp-client-connection.cSending %s handshakeSending XCLIENT handshakeprev_offset >= offsetConnect failed: %mconn->to_connect == NULLConnecting to %s:%u (from %s)Connecting to %s:%uConnecting to socket %s!conn->connect_succeededFailed to initialize SSL: %sStarting SSL handshakeSSL handshake successfularray_count(arr) > 0*end == NULLSubmitting RSET commandStart next transactionConnection readycb->callback != NULLAlready connecteddns_lookup(%s) failed: %sresult->ips_count > 0smtplmtpsmtp client connectionsmtp client connection statesmtp-common.h%s-client: Start timeoutReset timeoutPROTOESMTPLMTPLOGINSESSIONTTLTIMEOUTPORTADDRIPV6:conn->to_connect != NULLLooking up IP addressQUIT
Disconnected from serverConnection createdunix:conn->refcount >= 0conn->refcount > 0Connection destroyConnection failed: %suser_error != NULLConnect timed outHandshake timed outAuthentication timed out%s (last SSL error: %s)Write failureDelayed host lookup failureReceived handshake replyInvalid handshake replyReceived server capabilitiesSTARTTLS not supportedStarting TLSAuthentication not supportedAuthenticatingAuthenticating as %s, Authentication failed: %sconn->sasl_ir == NULLAUTH %sAUTH %s %sReceived STARTTLS reply: %scmd_auth != NULLAuthentication protocol errorAuthentication failedAuthenticated successfullyCommand timed outsmtp-client-connection.c:1367Leaked t_pop() callUnexpected reply: %sGot unexpected replyEarly reply: %sGot early success reply: %sGot early success replyCommand reply line too longRead failureRemote closed connectionInvalid command reply: %sconnect(%s) failed: %mDelayed connect errorConnection deinitRemote disconnectedAdd transactionAbort transactionInitiate next transactionconnectinghandshakingauthenticatingRequested SSL connection, but no SSL settings givenCouldn't initialize SSL context: %sCouldn't initialize SSL client for %s: %sSSL handshake to %s failed: %sSSL handshake successful, ignoring invalid certificate: %sdest->element_size == src->element_sizeconn->state_data.login_reply != NULLDNS lookup successful; got %d IPssmtp client connection capabilitiesconn->set.my_hostname != NULL && *conn->set.my_hostname != '\0'smtp_client_connection_find_extra_capability(conn, cap->name) == NULLNo commands pending; stop timeoutconn->xclient_replies_expected == 0Performing asynchronous DNS lookupnet_gethostbyname(%s) failed: %sconn->prev_connect_idx < conn->ips_countConnection timed out after %u secondsSMTP handshake timed out after %u secondsAuthentication timed out after %u secondsLost connection to remote server: %sConnection lost (last SSL error: %s)Remote closed connection unexpectedlyRemote disconnected while writing outputFailed to lookup remote serverReceived invalid EHLO response line: %sReceived invalid SIZE capability in EHLO response lineRequested STARTTLS, but server doesn't support itAuthenticating as %s for user %sServer doesn't support `%s' SASL mechanismServer doesn't support any of the requested SASL mechanisms: %sSupport for SASL mechanism `%s' is missingServer authentication mechanisms incompatibleFailed to create initial %s SASL reply: %sInternal authentication failureFailed to connect to remote serverAuthentication failed: Server returned multi-line reply: %sAuthentication failed: Server sent unexpected server-first challenge: %sAuthentication failed: Server sent non-base64 input for AUTH: %sReceived XCLIENT handshake reply: %sconn->xclient_replies_expected > 0Command timed out, disconnectingSSL handshaking with %s failed: read(%s) failed: %sReceived greeting from server: %sReceived inappropriate greetingConnected to server (from %s:%u)net_set_send_buffer_size(%zu) failed: %mnet_set_recv_buffer_size(%zu) failed: %mconnect(%s) failed: Connection timed outconn->state != SMTP_CLIENT_CONNECTION_STATE_READYtrans == conn->transactions_headsmtp_client_connection_next_transactionsmtp_client_connection_abort_transactionsmtp_client_connection_unrefsmtp_client_connection_refsmtp_client_connection_do_createsmtp_client_connection_dns_callbacksmtp_client_connection_delayed_host_lookup_failuresmtp_client_connection_already_connectedsmtp_client_connection_connect_moresmtp_client_connection_xclient_cbsmtp_client_connection_xclient_addsmtp_client_connection_send_xclientsmtp_client_connection_last_ipsmtp_client_connection_lostarray_copysmtp_client_connection_login_callbacksmtp_client_connection_auth_cbsmtp_client_connection_authenticatearray_idx_ismtp_client_connection_record_param_extensionssmtp_client_connection_inputsmtp_client_connection_establishedsmtp_client_connection_connectedsmtp_client_connection_do_connectsmtp_client_connection_failsmtp_client_connection_accept_extra_capability����������������smtp clientsmtp-client.csmtp-clientsmtp_server_command_is_replied(command)cmd->cmd->reg->func == smtp_server_cmd_helocmd->cmd->reg->func == smtp_server_cmd_ehloret == 0 || smtp_server_command_is_replied(command)smtp-server-cmd-helo.cMissing hostnamesmtp_server_cmd_ehlo_reply_createcmd_helo_completedsmtp_server_cmd_helo_runconn->command_queue_count == 1 && conn->command_queue_tail == commandconn->command_queue_count == 0 && conn->command_queue_head == NULLsmtp_server_command_reply_status_equals(command, 220)(capabilities & SMTP_CAPABILITY_STARTTLS) == 0smtp-server-cmd-starttls.cBegin TLS negotiation now.2.0.0SSL Initialization failed!conn->conn.output->closedTLS is already active.5.5.1TLS support is not enabled.Invalid parameters5.5.4cmd_starttls_startcmd_starttls_destroycmd_starttls_nextsmtp_server_cmd_starttlssmtp-server-cmd-auth.cInvalid AUTH response syntax5.5.2Line too longReceived AUTH response: %s2.7.0Already authenticated5.5.0Unsupported commandClient sent invalid AUTH response: %scallbacks != NULL && callbacks->conn_cmd_auth_continue != NULLAuthentication not permitted during a mail transactioncallbacks != NULL && callbacks->conn_cmd_auth != NULLsmtp_server_command_reply_status_equals(command, 235)Missing SASL mechanism parametercommand->prev == NULL && command->reg->func == smtp_server_cmd_authcmd_auth_startcmd_auth_completedcmd_auth_inputsmtp_server_cmd_auth_send_challengeconn->state.pending_mail_cmds > 0conn->state.state == SMTP_SERVER_STATE_MAIL_FROM || !smtp_server_command_replied_success(command)cmd->cmd->reg->func == smtp_server_cmd_mailInvalid FROM: Unexpected whitespace before pathInvalid FROM: Invalid character in pathInvalid FROM: %s (proceeding with <> as sender)Message size exceeds administrative limitsmtp-server-cmd-mail.cMAIL already givenOK2.1.0FROM:set->mail_path_allow_broken5.2.3cmd_mailInvalid FROM: %ssmtp_server_cmd_mail_reply_successarray_idx_icmd_mail_completedsmtp_server_cmd_mailconn->state.pending_rcpt_cmds > 0conn->state.state == SMTP_SERVER_STATE_RCPT_TO || !smtp_server_command_replied_success(command)smtp_server_command_is_rcpt(cmd)Invalid TO: Unexpected whitespace before pathInvalid TO: Invalid character in pathcallbacks != NULL && callbacks->conn_cmd_rcpt != NULLsmtp-server-cmd-rcpt.cMAIL needed firstToo many recipients4.5.32.1.5TO:Invalid TO: %spostmasterInvalid TO: Missing domaincmd_rcptsmtp_server_cmd_rcpt_reply_successarray_idx_icmd_rcpt_completedsmtp_server_cmd_rcptdata_cmd != NULLsmtp-server-cmd-data.cconn->state.trans != NULLcmd_dataEnd of dataEnd of chunkAdded %lu octetsNot all client data readFailed to add data4.0.0Command is next to be replieddata_cmd->chunk_input != NULLSeen the last chunkFirst chunkBad sequence of commandsdata_cmd->chunk_firstInvalid chunk size parameterInvalid end marker parameterconn->state.pending_data_cmds > 0conn->state.state == SMTP_SERVER_STATE_DATAPrevious data chunk failed, issue RSET firstDATA cannot be used with BINARYMIMEcallbacks != NULL && callbacks->conn_cmd_data_continue != NULLConnection lost during data transfer: %sconn->state.pending_mail_cmds == 0 && conn->state.pending_rcpt_cmds == 0callbacks != NULL && callbacks->conn_cmd_data_begin != NULLconn->state.data_input != NULLsmtp_server_command_is_replied(cmd_temp)conn->state.data_input == NULLconn->state.data_chain_input == NULLsmtp_server_connection_data_chunk_addcmd_data_chunk_repliedsmtp_server_connection_data_chunk_initcmd_data_do_handle_inputcmd_data_nextcmd_data_completedcmd_data_start_inputcmd_data_startcmd_data_repliedcmd_data_destroysmtp_server_cmd_data_check_sizecmd->cmd->reg->func == smtp_server_cmd_rsetsmtp-server-cmd-rset.csmtp_server_cmd_rset_reply_successcmd_rset_completedsmtp_server_cmd_rsetcmd->cmd->reg->func == smtp_server_cmd_noopsmtp-server-cmd-noop.cInvalid string parameter: %ssmtp_server_cmd_noop_reply_successsmtp_server_cmd_noopsmtp-server-cmd-quit.csmtp_server_cmd_quitcmd->cmd->reg->func == smtp_server_cmd_vrfysmtp-server-cmd-vrfy.cTry RCPT instead2.3.3smtp_server_cmd_vrfy_reply_defaultsmtp_server_cmd_vrfyXCLIENT not permitted during a mail transactionsmtp-server-cmd-xclient.cYou are not from trusted IP5.7.14Invalid parameter: %sInvalid %s parameter: %s[UNAVAILABLE]Invalid ADDR parameterInvalid PORT parameterInvalid PROTO parameterInvalid TIMEOUT parameterInvalid TTL parametercmd_xclient_completedsmtp-server-reply.c!reply->sentstr_len(textbuf) > 0text_len > prefix_lentext_len >= line_lenprefix_len <= text_lenline_end + 1 < text_end*(line_end + 1) == '\n'path_end < line_endindex%u reply [%u/%u]: %u reply: status >= 200 && status < 560%03u-%03u-%s cmd->replies_expected > 0index < cmd->replies_expected!reply->submittedoffset < tlenreply->content->text != NULL<%s> from_reply->content != NULLfrom_reply->submittedi < cmd->replies_expectedcmd->replies_expected <= 1Byesmtp-server-reply.c:648text[0] == '-'Send failed: %sreply->command->replies_submitted > 0p != NULL && p > text && *(p-1) == '\r'prefix_len + path_len <= text_lenenh_code == NULL || *enh_code == '\0' || ((unsigned int)(enh_code[0] - '0') == (status / 100) && enh_code[1] == '.')text[reply->content->last_line + 3] == ' 'str_len(reply->content->text) >= 5from_index < cmd->replies_expectedADDR PORT PROTO HELO LOGIN SESSION TTL TIMEOUTsmtp_server_reply_ehlo_add_paramssmtp_server_reply_ehlo_add_paramsmtp_server_reply_ehlo_addsmtp_server_reply_add_to_eventsmtp_server_reply_is_successsmtp_server_reply_send_realsmtp_server_reply_write_one_linesmtp_server_reply_allvsmtp_server_reply_forwardsmtp_server_replysmtp_server_reply_submit_duplicatesmtp_server_reply_submitsmtp_server_reply_replace_pathsmtp_server_reply_get_path_lensmtp_server_reply_prepend_textsmtp_server_reply_add_textsmtp_server_reply_create_forwardsmtp_server_reply_clearsmtp_server_reply_allocsmtp_server_reply_create_indexsmtp_server_reply_update_prefixsmtp_server_reply_set_status[unknown]unknowncmd_input_namesmtp_server_commandsmtp-server-command.cMAILBDATInvalid commandNew commandReady to replyidx < cmd->replies_expectedcmd->replies_expected == 1status / 100 > 2Pipeline unblockedsmtp_server_command_finished9.0.0cmd_argscmd_human_argssmtp_server_command_startedExecute commandUnknown commandTLS required.5.7.0Authentication required.cmd->reg->func != NULLNext to replyReplied (one)RepliedNot ready to replyToo many invalid commands.4.7.0CompletedLogged outAborted login by logging outsmtp-server: Trying to unregister unknown command '%s'hook->type != type || hook->func != func!array_is_created(&cmd->replies)conn != NULL && array_is_created(&cmd->replies)submitted == cmd->replies_submittedcmd->state < SMTP_SERVER_COMMAND_STATE_FINISHEDServer closed the connection: %scmd->state == SMTP_SERVER_COMMAND_STATE_READY_TO_REPLY && array_is_created(&cmd->replies)smtp_server_command_failsmtp_server_command_finishedsmtp_server_command_send_more_repliessmtp_server_command_send_repliessmtp_server_command_reply_status_equalssmtp_server_command_get_replyarray_idx_ismtp_server_command_submit_replysmtp_server_command_get_reply_countsmtp_server_command_set_reply_countsmtp_server_command_remove_hooksmtp_server_command_add_hooksmtp_server_command_unrefsmtp_server_command_executesmtp-server-recipient.ctrans: rcpt %s: smtp server recipientprcpt->refcount > 0rcpt->event != NULLrcpt->cmd != NULL<%s> %sApprovedsmtp_server_transaction_rcpt_finishedsmtp_server_recipient_remove_hooksmtp_server_recipient_add_hooksmtp_server_recipient_finishedsmtp_server_recipient_resetsmtp_server_recipient_replyvsmtp_server_recipient_is_repliedsmtp_server_recipient_deniedsmtp_server_recipient_approvedsmtp_server_recipient_unrefsmtp_server_recipient_refsmtp server transaction%s:T%usmtp-server-transaction.ctransaction_idtrans <%s>: !trans->finishedReceived: from  ([
	(using 
	by  with 
	id 
	(envelope-from <
	for <; smtp_server_transaction_startedsmtp_server_transaction_finishedarray_is_created(&trans->rcpt_to)conn->state.pending_rcpt_cmds == 0array_idx_ismtp_server_transaction_finishedsmtp_server_transaction_resetsmtp_server_transaction_find_rcpt_duplicatesmtp-server-connection.c%s-server: pipeline > 0connection_idsmtp serverconn->created_from_streamsTimeout stopTimeout startTrigger outputsmtp-server-connection.c:1138235 2.7.0 Logged in.220 %s %sCouldn't initialize SSL: %ssmtp-server-connection.c:1167smtp-server-connection.c:1185%03u !conn->startedConnection state resetTLS handshaking failed: %s%s (unfinished %s command)%s (state=%s)Disconnected: %sSending repliesNo more commands pending!conn->input_broken!conn->haltedReceived new command: %s %sRemote closed connection: %sInvalid command syntaxsmtp-server-connection.c:1319Disconnected for inactivity4.4.24.3.2Connection clearcmp != 0GREETINGREADYMAIL FROMCommand pipeline is full (pipelined commands %u > limit %u)str_c(session_id)[str_len(session_id)-2] == '='!conn->input_broken && !conn->disconnectedCouldn't initialize SSL server for %s: %sCouldn't add client input to streamClient sent invalid command: %sCommand data size exceeds absolute limitenh_code[0] == '4' && enh_code[1] == '.'Shutting down due to fatal errorsmtp_ehlo_keyword_is_valid(cap->name)smtp_ehlo_params_are_valid(cap->params)smtp_capability_find_by_name(cap->name) == SMTP_CAPABILITY_NONEUpdated session ID from %s to %s8� �)�)�����e��($�@$�$�#�#�smtp_server_connection_register_rcpt_paramsmtp_server_connection_register_mail_paramsmtp_server_connection_add_extra_capabilitysmtp_server_connection_terminatesmtp_server_connection_abortsmtp_server_connection_start_pendingsmtp_server_connection_loginsmtp_server_connection_unrefsmtp_server_connection_create_from_streamssmtp_server_connection_init_sessionsmtp_server_connection_inputsmtp_server_connection_set_streamssmtp_server_connection_input_capturesmtp_server_connection_check_pipelineDovecot ready.smtp-server.csmtp-serversmtp-submit/usr/sbin/sendmailno:smtps:submissions:starttlsmail_debugsubmission_hostsendmail_pathsubmission_timeoutsubmission_sslsmtp-submit.csmtp_submit_finishedSent message successfullyFailed to send message: %sInvalid submission_host: %ssmtpssubmissionsFailed to execute sendmailstatus <= 0smtp(%s): %sDATA failed: %sRCPT TO failed: %ssmtp submit sessionsmtp submitsubm->output == NULL!smtp_address_isnull(rcpt_to)/tmp/dovecot.smtp_submit_startedStarted sending messagesendmail_args[0] != NULL-i-fsubm->status > 0 || subm->error != NULLSendmail program returned errorarray_count(&subm->rcpt_to) > 0array_idx_ismtp_submit_send_sendmailsmtp_submit_send_host_finishedsmtp_submit_errorsmtp_submit_sendsmtp_submit_add_rcptprogram-client.c(&pclient->fd_in)(&pclient->fd_out)(&efds[i].parent_fd)efd->callback != NULLprogram Failed to run programFinished input to programpclient->io == NULLFinished output from programConnected to programpclient->output_seekablefd > 1%s=%sPass environment: %sprogram stdinprogram stdoutefds[i].parent_fd >= 0program output fd=%dpclient->callback == NULLexec:tcp:Establishing connectionFinished streaming payload to programFinished streaming payload from programExecution timed out (> %u msecs)Connection timed out (> %u msecs)(program client seekable output)Invalid tcp syntax, must be host:port in '%s'Unsupported program client scheme '%s'program_client_run_asyncprogram_client_destroyprogram_client_extra_fd_inputprogram_client_init_streamsprogram_client_set_extra_fdprogram_client_get_output_seekablei_stream_read_moreprogram_client_input_pump_finishedprogram_client_output_pump_finishedprogram_client_connectedprogram_client_disconnect_extra_fdsprogram_client_do_disconnectprogram-client-local.cStopped with signal %dplclient->pid == status->pidChild process endedwaitpid(%d) failed: %mplclient->pid != (pid_t)-1plclient->child_wait != NULLChild process never startedclose(fd_out) failed: %mpipe(in) failed: %mpipe(out) failed: %mxfd_count < INT_MAXpipe(extra=%d) failed: %mfork() failed: %mclose(pipe:in:rd) failed: %mclose(pipe:in:wr) failed: %mclose(pipe:out:rd) failed: %mclose(pipe:out:wr) failed: %mefd[1] != STDIN_FILENOefd[1] != STDOUT_FILENOefd[1] != STDERR_FILENOForked child processexec:%s (%d)program client localTerminated with non-zero exit code %dForcibly terminated with signal %dTerminated abnormally with signal %dTerminated abnormally with status %dSending SIGKILL signal to programFailed to send SIGKILL signal to programProgram did not die after %d millisecondsExecution timed out after %u milliseconds: Sending TERM signalFailed to send SIGTERM signal to programTerminating program immediatelyWaiting for program to finish after %lu msecs (timeout = %lu msecs)close(pipe:extra=%d:wr) failed: %mclose(pipe:extra=%d:rd) failed: %mprogram %s: dup2(stdin) failed: %mprogram %s: dup2(stdout) failed: %mprogram %s: close(in_fd) failed: %mprogram %s: close(out_fd) failed: %mprogram %s: dup2(stderr) failed: %mprogram %sdup2(extra_fd=%d) failed: %mprogram %sclose(extra_fd=%d) failed: %marray_idx_iexec_childprogram_client_local_waitchildprogram_client_local_connectprogram_client_local_killprogram-client-remote.cTrying to connectnet_connect_unixCannot resolve `%s': %sprclient->ips_count > 0(&fd_out)Missing LF in result codeUnexpected result code '%c'Unexpected result code 0x%02xscstream->parsed_resultNo IP addresses left to tryVERSION	script	4	0
env_noreply
-
program client unixtcp:%s:%uprogram client netips != NULL && ips_count > 0net_connect_unix(%s) failed: %mprogram_client_istream sync() not implementedTrying to connect (timeout %u msecs)shutdown(fd_out, SHUT_WR) failed: %mNo result code received from remoteReceived too short result code from remoteReceived '+' result code from remoteReceived '-' result code from remoteret != -1 || stream->istream.eof || stream->istream.stream_errno != 0connect(%s) failed: Timeout in %u millisecondsprogram_client_net_create_ipsprogram_client_net_connectedprogram_client_net_connect_timeoutprogram_client_net_connect_realprogram_client_istream_readprogram_client_remote_close_outputclient->to_reconnect == NULLanvil-client.cclient->fd == -1VERSION	anvil	1	0
anvil: Unexpected input: %sanvil-client.c:109read(%s) failed: EOFaqueue_count(client->queries) > 0%s: Anvil queries timed out after %u secs - aborting queriesanvil query to be aborted doesn't existarray_idx_ianvil_client_timeoutanvil_client_connectanvil_client_deinitipc connect failedInvalid inputipc-client.c:92ipc-client.cIPC proxy sent unexpected input: %sIPC proxy sent invalid input: %sserver->fd == -1ipc-server.cipc-proxyipc-server.c:65%u	%s
server->ipc_cmd_refcount == 0%u	:%s
errormsg != NULLVERSION	ipc-server	1	0
HANDSHAKE	%s	%s
IPC proxy not compatible with this server (mixed old and new binaries?)cmd->server->ipc_cmd_refcount > 0ipc_cmd_failipc_cmd_finishipc_server_deinitipc_server_connectAuth request timed outmaster authmaster-auth.cparams->request.auth_pid != 0fd_send(fd=%d) failed: %mmaster(%s): %s (client-pid=%u, client-id=%u, rip=%s, created %u msecs ago, received %u/%zu bytes)read() failed: Remote closed connection (destination service { process_limit } reached?)Received reply with unknown tag %u - http://wiki2.dovecot.org/SocketUnavailableparams->request.client_pid != 0fstat(auth dest fd) failed: %mnet_connect_unix(%s) succeeded only after retrying - took %lld usnet_connect_unix(%s) failed: %m%sfd_send() sent only %d of %d byteshash_table_lookup(auth->connections, POINTER_CAST(req.tag)) == NULLmaster_auth_request_abort(): tag %u not foundmaster_auth_request_fullt_readlink(%s) failed: %smaster-instance.cmaster-instance.c:194%ld	fdatasync(%s) failed: %mmaster-instance.c:119Invalid line in %s: %s!list->lockedGROWING-master instances*name != '\0'file_dotlock_open(%s) failed: %marray_idx_imaster_instance_list_find_by_namemaster_instance_list_set_namemaster_instance_write_finishmaster_instance_write_init
<connection created %d msecs agosession=%s, rip=%s, auth_pid=%ld, client-pid=%u, client-id=%u, post-login script %s started %d msecs agoclose(master login) failed: %mclose(fd_read client) failed: %mpl->client->postlogin_client == plTimeout waiting for post-login script to finish, abortingLogin client disconnected too earlyfd_read() partial input (%d/%d)Login client disconnected too early (while reading data)Auth request missing a file descriptorfstat(fd_read client) failed: %mAuth request inode mismatch: %s != %sset->postlogin_socket_path == NULL || set->postlogin_timeout_secs > 0login->service->login == loginmaster_login_auth_request_count(login->auth) == 0Internal error occurred. Refer to server log for more information.errormsg != NULL || auth_args != NULLlogin client: Username missing from auth replyVERSION	script-login	1	0
%s	%swrite(%s) failed: partial writeclient->postlogin_client == NULLfd_read(%s) failed: disconnectedPost-login script denied access to user %s%u clients, first client created %d msecs ago: %s (%s)[idling][waiting on client][auth lookup][post-login script]master-login.cconn->clients == NULLclient->conn->refcount > 1close(postlogin) failed: %mfd_read() failed: %mToo large auth data_size sentData read partially %d/%uread(data) failed: %m(&client_fd)service->login == NULLconn->clients != NULL%s(%s): postlogin=write(%s) failed: %m(&fd)close(client) failed: %mfd_read(%s) failed: %mmaster_login_client_freemaster_login_postlogin_freemaster_login_postloginmaster_login_auth_finishmaster_login_auth_callbackmaster_login_conn_inputmaster_login_conn_unrefmaster_login_deinitmaster_login_initauth connected %u msecs ago, handshake %u msecs agomaster-login-auth.cauth-masterSPIDauth->to == NULLauth->refcount > 0CUIDBUG: Unexpected input: %sLogin auth request successfulNOTFOUNDFAILreason=Internal auth failureInternal auth failure: %s!auth->connectedVERSION	%u	%u
master login authauth-master: login: request [%u]: Started login auth requestREQUEST	%u	%u	%u		session_pid=%s	request_auth_token, request took %u msecs, client-pid=%u client-id=%uauth_master_client_login_finishedLogin auth request failed: %s (%s)Disconnected from auth server, abortingAuth server restarted (pid %u -> %u), aborting authAuth server sent invalid version line: %sAuth server did not send valid SPID: %sAuth server request timed out after %u.%03u secsAuth server sent reply with unknown ID %u%s is an auth client socket. It should be a master socket.Authenticated user not found from userdb, auth lookup id=%uHandshake with auth service failedAuth server sent us too long linehash_table_lookup(auth->requests, POINTER_CAST(id)) == NULLauth_master_client_login_startedmaster_login_auth_requestmaster_login_auth_connectmaster_login_auth_unrefmaster_login_auth_update_timeoutsignal: dup2(/dev/null, listener) failed: lseek(login notify fd) failed: %mwrite(master_status_fd) returned %dwrite(master_status_fd) failed: %mKilled with signal %d (by pid=%s uid=%s code=%s)master_getopt_str_is_valid(service->getopt_str)NOTIFY_SOCKET LISTEN_FDS LISTEN_PIDservice->master_status.available_count == service->total_available_countInvalid SOCKET_COUNT environmentInvalid LOG_DEBUG - ignoring: %sDovecot version mismatch: Master is v%s, %s is v2.3.21.1 (if you don't care, set version_ignore=yes)listen_fd >= MASTER_LISTEN_FD_FIRSTservice->master_status.available_count > 0Must be started by dovecot master processInvalid master login state: %dservice->total_available_count > 0service->service_count_left > 0service->master_status.available_count < service->total_available_countservice->service_count_left == 0!io_loop_is_running(service->ioloop)close(service connection) failed: %mservice->to_overflow_call == NULLmaster-service.cmaster-service.c:1472[%u connections]service->initial_status_sentclose(listener %d) failed: %mc:i:ko:OLLOG_STDERR_TIMESTAMP/dev/stderrLOG_SERVICEsyslogmaster-service.c:545/var/lib/dovecot/instances%s/dovecot.confUnknown instance name: %smaster-service.c:756master-service.c:767 DOVECOT_PRESERVE_ENVScount >= usedSERVICE_NAME%s(init): master_service_initGENERATIONVERBOSE_PROCTITLE[initializing]CONFIG_FILE/etc/dovecot/dovecot.confDOVECOT_VERSION2.3.21.1SOCKET_COUNTSOCKET%u_SETTINGShaproxyCannot load SSL module: %sservice:%sLOG_DEBUGGENERATION missingCLIENT_LIMITCLIENT_LIMIT missingPROCESS_LIMITPROCESS_MIN_AVAILSERVICE_COUNTIDLE_KILLSTATS_WRITER_SOCKET_PATHmaster-service.c:313i < service->socket_countwrite(anvil) failed: %mwrite(anvil) failed: EOF(size_t)ret == strlen(cmd)(&service->config_fd)!service->init_finishedservice->listeners != NULLnet_accept() failed: %mVERSION	master-service.c:1531��������������������������������������������������������@�����������master_status_update_is_importantmaster_service_overflowmaster_service_fullmaster_service_listenmaster_service_close_config_fdmaster_service_client_connection_destroyedmaster_service_client_connection_handledmaster_service_client_connection_createdmaster_service_anvil_sendmaster_service_get_socket_namemaster_service_set_service_countmaster_service_set_client_limitarray_idx_imaster_service_init_finishmaster_getoptmaster_service_inithaproxy: Client timed out (rip=%s)haproxy: Client disconnected (rip=%s): %mhaproxy: Client disconnected: Too long header (rip=%s)haproxy: Client disconnected: Failed to read full header (rip=%s)haproxy: Client disconnected: Failed to read valid HAproxy data (rip=%s)ret >= (ssize_t)sizeof(buf.v2.hdr)haproxy: Client disconnected: Unsupported protocol version (version=%02x, rip=%s)haproxy(v2): Client disconnected: Protocol payload length does not match header (got=%zu, expect=%zu, rip=%s)haproxy(v2): Client disconnected: Not using TCP (type=%02x, rip=%s)haproxy(v2): Client disconnected: IPv4 data is incomplete (rip=%s)haproxy(v2): Client disconnected: IPv6 data is incomplete (rip=%s)haproxy(v2): Unsupported address family (family=%02x, rip=%s)haproxy(v2): Client disconnected: Unknown address family (family=%02x, rip=%s)haproxy(v2): Client disconnected: Invalid command (cmd=%02x, rip=%s)haproxy(v2): Client disconnected: Invalid header size (size=%zu, tlv offset=%zu)get_tlv(%zu) failed: Truncated dataget_ssl_tlv(%zu) failed: Truncated datahaproxy(v2): Client disconnected: Invalid TLV: %s (cmd=%02x, rip=%s)haproxy(v1): Client disconnected: Field for proxied protocol is missing (rip=%s)haproxy(v1): Client disconnected: Unknown proxied protocol (protocol=`%s', rip=%s)haproxy(v1): Client disconnected: Field for proxied remote address is missing (rip=%s)haproxy(v1): Client disconnected: Proxied remote address is invalid (address=`%s', rip=%s)haproxy(v1): Client disconnected: Field for proxied local address is missing (rip=%s)haproxy(v1): Client disconnected: Proxied local address is invalid (address=`%s', rip=%s)haproxy(v1): Client disconnected: Field for proxied local port is missing (rip=%s)haproxy(v1): Client disconnected: Proxied remote port is invalid (port=`%s', rip=%s)haproxy(v1): Client disconnected: Proxied local port is invalid (port=`%s', rip=%s)haproxy(v1): Client disconnected: Header line has spurius extra field (field=`%s', rip=%s)haproxy_trusted_networks: Invalid network '%s'haproxy: Client not trusted (rip=%s)PROXYmaster-service-haproxy.cstrcmp(*fields, "PROXY") == 0TCP4TCP6UNKNOWNsize <= sizeof(buf)haproxy connectionmaster_service_haproxy_abortmaster_service_haproxy_read


QUIT
Invalid %s: %sUnknown syslog_facility: %slog_debuglog_core_filterprocess_shutdown_filter%s is a UNIX socket%s is a FIFOHOMEUSE_SYSEXITS/usr/bin/doveconf-c-mssl-server-p-e/var/run/dovecot/configDOVECONF_ENVVERSION	config	2	0
FILTERS
write_full(%s) failed: %mmaster-service-settings.cFILTER	master-service-settings.c:394VERSION	config	2	0
REQ	module=%s	service=%s	user=%s	lip=%s	rip=%s	lname=%smaster service settingsservice-uses-localservice-uses-remoteused-localused-remoteInvalid -o parameter %s: %sInvalid settings: %smaster-service-settings.c:467master-service-settings.c:801/var/run/dovecot/var/lib/dovecot%b %d %H:%M:%S stats-writerbase_dirstate_dirinstance_nameinfo_log_pathdebug_log_pathlog_timestampsyslog_facilityimport_environmentstats_writer_socket_pathconfig_cache_sizeversion_ignoreshutdown_clientsverbose_proctitlehaproxy_trusted_networkshaproxy_timeout%s - doveconf execution fallback is disabledt_binary_abspath(%s) failed: %s%s - Also failed to read config by executing doveconf: %s%s (path is from %s environment)	exclude=ssl_ca	exclude=ssl_verify_client_certTimeout reading config from %sTZ CORE_OUTOFMEM CORE_ERROR LISTEN_PID LISTEN_FDS NOTIFY_SOCKETmaster_service_settings_readmaster_service_settings_get_filtersarray_idx_iGROWING-master service settings cachemaster-service: cannot get filters: %sentry->parser == cache->global_parsermaster-service-settings-cache.centry->parser != cache->global_parsernull_strcmp(input->module, cache->module) == 0null_strcmp(input->service, cache->service_name) == 0BUG: config unexpectedly returned local settingsBUG: config unexpectedly returned remote settingshash_table_lookup(cache->local_name_hash, entry_local_name) == NULLhash_table_lookup(cache->local_ip_hash, &entry->local_ip) == NULLlocal-net=remote-net=local-name=settings global entrysettings entrycache_addmaster_service_settings_cache_readmaster_service_settings_cache_deinitservice->ssl_ctx_initializedmaster-service-ssl.cnoSSL is disabled (ssl=no)Failed to initialize SSL contextservice->listeners != NULL || service->socket_count == 0SSL context initialization failed, disabling SSL: %smaster_service_ssl_ctx_initmaster_service_ssl_initno_compressionno_ticketservice->want_ssl_servermaster-service-ssl-settings.cssl_certssl_keyssl_alt_certssl_alt_keyssl_key_passwordssl_dhyes:no:requiredTLSv1.2commonNamessl_cassl_client_ca_filessl_client_ca_dirssl_client_certssl_client_keyssl_cipher_listssl_cipher_suitesssl_curve_listssl_min_protocolssl_cert_username_fieldssl_crypto_devicessl_verify_client_certssl_client_require_valid_certssl_require_crlverbose_sslssl_prefer_server_ciphersssl_optionsssl_verify_client_cert set, but ssl_ca notssl_options: unknown flag: '%s'ALL:!kRSA:!SRP:!kDHd:!DSS:!aNULL:!eNULL:!EXPORT:!DES:!3DES:!MD5:!PSK:!RC4:!ADH:!LOW@STRENGTHmaster_service_ssl_server_settings_getparent_event->sent_to_stats_id != 0Timeout waiting for handshake responsestats: Received invalid handshake: %s (input: %s)stats-client.cevent == merged_eventUPDATE%s	%lu	EVENT	%lu	BEGINExpected FILTERCATEGORY	recursion > 0write() failed: %sEND	%lu
stats-serverstats-clientstats_client_waitstats_event_writestats_client_send_eventauthprivdaemonftpkernlprnewsuucplocal0local1local2local3local4local5local6local7%iInvalid number: Invalid boolean: Unknown setting: glob() failed: Read errorNo matchesglob() failed: Unknown errorExpecting '='Unexpected '}'!include_try!include$ENV:*section == '/'sect_callback != NULLRecursive include file: %sglob() failed: Not enough memoryCan't open configuration file %s: %mConfiguration file %s line %u: Ambiguous '#' character in line, treating it as comment. Add a space before it to remove this warning.Couldn't open include file %s: %m%s (section changed in %s at line %d)Error in configuration file %s line %d: %ssettings_read_iInvalid time interval: minsminutesmsecondsmillisecsmillisecondshoursdaysweeksTime interval is too large: settings-parser.cdest_count % 2 == 0!array_is_created(dest_arr)old_link->parent != NULLold_link->array != NULLi < countcount == count2ctx->root_count == 1Invalid size: Size is too large: settings-parser.c:1199settings-parser.c:1392src_count == ccountdest_count == ccountsettings-parser.c:1767GROWING-dup settings parser\e\s\\\_\+!array_is_created(carr)settings-parser.c:117carr != NULLGROWING-settings parser already exists,	 link->info == &strlist_infodef != link->info->definesInvalid number %s: %sInvalid port number %slink->info->defaults != NULLInvalid value: link != NULLMissing '='settings-parser.c:943ERROR settings-parser.c:990Line %u: %sLine %u: line too longpipe() failed: %m(&fd[0])(&fd[1])dup2() failed: %mwaitpid() failed: %m%s returned failure: %dsettings-parser.c:1100Invalid setting %s: %sTime interval '%s' is missing units (add e.g. 's' for seconds)Milliseconds not supported for this setting: %s**val == SETTING_STRVAR_EXPANDED[0] || **val == SETTING_STRVAR_UNEXPANDED[0]**val == SETTING_STRVAR_EXPANDED[0]diff + sizeof(*old_link->array) <= old_link->parent->info->struct_sizehash_table_lookup(links, old_link) == NULLdef->type == SET_DEFLIST_UNIQUEdef->list_info->type_offset != SIZE_MAXparsers[i].info->parent == parentold_ctx->roots[i].parent == NULLold_ctx->roots[i].array == NULLsrc->root_count == dest->root_countsrc->roots[i].info == dest->roots[i].infohash_table_lookup(ctx->links, full_key) == NULLhash_table_lookup(ctx->links, key) == NULLinfo->defines != NULL || info == &strlist_infoInvalid boolean value: %s (use yes or no)**val == SETTING_STRVAR_UNEXPANDED[0] || **val == SETTING_STRVAR_EXPANDED[0]Missing key name ('=' at the beginning of line)read(%s) disconnected before receiving any dataread(%s) disconnected before receiving end-of-settings line@����p�����������P�����������������������t����������������������������������2;�>�0>�>�>�<�?�$<�<��<�=�=��=���:�8?�=�H>�h>�J<�?�?�<�<�=�=�=���settings_copy_deflist_uniquesettings_changes_initsettings_applysettings_parser_apply_changessettings_link_get_newsettings_parser_dupinfo_update_realarray_idx_isetting_copysettings_vars_have_keysettings_var_expand_infosettings_parse_set_key_expandedsettings_parse_execsettings_parse_unaliassettings_find_key_nthsetting_link_addget_deflistsettings_parsesettings_parse_keyvaluesettings_parser_get_changessettings_parser_getcopy_unique_defaultssettings_parser_init_list����������������stats_register() called after stats_alloc_size() was already called - this will break existing allocationsExpected name, but NUL is missingstats.cpos <= sizeUnknown stats name: '%s'stats_importstats: open(%s) failed: %mstats-connection.c&conn->fdconn->fd != -1stats update sent more bytes that PIPE_BUF (%zu > %u), this may break statisticswrite(%s) failed: %m (stats process is busy)write(%s) wrote partial updatestats_connection_sendstats_connection_unref%s %u < %u%s %lu < %lustats-parser.c%s %ld.%d < %ld.%d%ld.%uGMTSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%s, %02d %s %04d %02d:%02d:%02d GMThttphttps//Not an HTTP URLRequest target is invalidRelative HTTP URL not allowed*pbegin == '/'http-url.cparser->cur == parser->endInvalid Host header: %sEmpty Host header&;?=+&;/?=+HTTP URL does not allow empty host identifierHTTP URL does not allow `userinfo@' partAbsolute HTTP URL requires `//' after `http:'URL fragment not allowed for HTTP URL in this context(flags & HTTP_URL_PARSE_SCHEME_EXTERNAL) == 0 || base == NULLInvalid Host header: Contains invalid characterhttp_url_parse_pathhttp_url_do_parsehttp_url_parse@@
$22222
			�																																				
	
																										
	@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@�hXGEmpty header field nameExcessive header sizeExcessive header field sizehttp-header-parser.cExcessive number of header fieldsExpected ':' after header field name '%s', but found %sInvalid character %s in content of header field '%s'Expected LF after CR at end of header field '%s', but found %sEncountered stray CR at beginning of header line, followed by %s�w��v�Qw�-v��t�u��u�v�y�i_stream_read_morehttp_header_parse_next_field0

sent == 5http-transfer-chunked.c%llx
ret < 0Unexpected end of payloadsize != 0tcstream->ostream.finished || tcstream->ostream.ostream.stream_errno != 0 || tcstream->ostream.error_handling_disabledstream->parent->real_stream->max_buffer_size >= MIN_CHUNK_SIZE_WITH_EXTRA(size_t)ret == (tcstream->chunk_size + iov_new[0].iov_len + iov_new[iov_count-1].iov_len)tcstream->chunk_pos <= tcstream->chunk_sizeFailed to parse chunked trailer: %sExpected chunk size digit, but found %sChunk size exceeds integer limitInvalid chunked extension nameInvalid character %s in chunked extension value stringEscaped invalid character %s in chunked extension value stringInvalid chunked extension valueExpected new line after chunk size, but found %sExpected new line after chunk data, but found %sTotal chunked payload size exceeds maximum������~��~��@��G���P��Ȁ���Ѐ�Ѐ��http_transfer_chunked_ostream_sendvhttp_transfer_chunked_ostream_send_trailerhttp_transfer_chunked_ostream_closei_stream_read_morehttp_transfer_chunked_istream_read_datahttp_char_is_token68(*p)http-auth.c*p == '='Basicrealmstrchr(username, ':') == NULLusername != NULL && *username != '\0'http_auth_basic_credentials_inithttp_auth_check_token68data->eofhttp-message-parser.cparser->payload == NULLhttp_messageHTTP/Bad HTTP versionPayload is too largeInvalid payload: %sKeep-AliveConnectionInvalid Connection headerContent-LengthInvalid Content-Length headerDateDuplicate Date headerInvalid Date headerLocationBroken streamFailed to parse header: %schunkedUnknown transfer coding `%s'data->v_offset + data->new_bytes < data->wanted_sizeDisconnected while reading message payload at offset %lu (wanted %lu): %sStream error while skipping payload: %sDuplicate Content-Length headerInvalid Transfer-Encoding headerUnexpected parameter `%s' specifiedfor the `%s' transfer codingChunked Transfer-Encoding must be lastFinal Transfer-Encoding in request is not chunkedP��������������������������������������������������������������P����������������������������������http_istream_error_callbackarray_idx_ihttp_message_parse_bodyi_stream_read_morehttp_message_parser_restarthttp-request-parser.chttp request parser<LF>Empty request linewanted > 0HTTP request line is too longHostMissing Host headerDuplicate Host headerBad request target `%s': %sExpectUnknown Expectation `%s'Invalid Expect headerEmpty Expect headerHTTP request method is too longUnexpected character %s in request methodHTTP request target is too longUnexpected character %s in request targetInvalid HTTP version in requestUnexpected character %s at end of request lineExpectation `%s' has unexpected valueExpectation `%s' has unknown parameter `'%s'���`�� ��(�����,����i_stream_read_bytesparser->cur < parser->endhttp-response-parser.cHTTP status line is too longRetry-AfterInvalid HTTP status code in responseInvalid HTTP version in response: %sExpected ' ' after response version, but found %sExpected ' ' after response status code, but found %sExpected line end after response, but found %sUnexpected Content-Length header field for %u response (length=%lu)����A������`��W��i_stream_read_bytes_reply_sanitizereq->state == HTTP_REQUEST_STATE_NEWreq->request_offset < conn->conn.output->offsetconn->in_req_callback || conn->pending_request == reqreq->response_offset < conn->conn.input->v_offsetCannot resend payload; stream is not seekablereq->state == HTTP_REQUEST_STATE_NEW || req->state == HTTP_REQUEST_STATE_GOT_RESPONSE || req->state == HTTP_REQUEST_STATE_ABORTEDstrpbrk(value, "\r\n") == NULLstrcasecmp(key, "Proxy-Authorization") != 0Not quite finished sending payloadFree (client already destroyed)Destroy (client already destroyed)input->v_offset <= req->payload_sizereq->state == HTTP_REQUEST_STATE_NEW || req->state == HTTP_REQUEST_STATE_GOT_RESPONSEioloop_global_wait_usecs >= req->sent_global_ioloop_usecswait_usecs >= req->sent_http_ioloop_usecsstats_r->other_ioloop_msecs >= stats_r->http_ioloop_msecswait_usecs >= req->sent_lock_usecs, %u send attempts in %u.%03u secs%s (%u retries in %u.%03u secs)req->state == HTTP_REQUEST_STATE_ABORTEDreq->state == HTTP_REQUEST_STATE_NEW || req->state == HTTP_REQUEST_STATE_PAYLOAD_OUTreq->delayed_error_status == 0req->state < HTTP_REQUEST_STATE_FINISHEDreq->payload_input->v_offset >= offsetSend more (sent %lu, buffered=%zu)BUG: stream '%s' input size changed: %lu-%lu != %lureq->payload_input != NULL || req->payload_size == 0req->redirects <= req->client->set.max_redirectsRedirecting to %s%s (redirects=%u)http-client-request.c[Req%u: %s %s]dest_ipattemptsredirectsbytes_inbytes_out!req->listed:
strpbrk(key, ":\r\n") == NULLProxy-AuthorizationUser-Agent%s: %s
 abortedFinished sending%s payloadhttp client requestreason_code[Req%u: %s %s%s]methoddest_hostdest_porttargetrequest %s: CONNECTreq->refcount > 0Free (requests left=%d)req->conn == NULLDestroy (requests left=%d)req->payload_input == NULLreq->client != NULLnot yet submittedqueued %u.%03u secs ago, %u times retried, not yet sent, %u.%03u in last attempt, %u.%03u in http ioloop, %u.%03u in other ioloops, %u.%03u in locksHEADSubmitted (requests left=%d)http_request_finishedreq->client->ioloop != NULL!req->payload_waitResubmitting requestResubmission failed: %serror != NULL && status != 0<HTTP request payload>Waiting for request to finishreq != NULLError: %u %sInvalid HTTP URL: %sreq->payload_input != NULLreq->payload_output != NULL!pipelinedhttp-client-request.c:1490!req->conn->output_lockedreq->payload_output == NULL HTTP/1.1
Host: Proxy-Authorization: User-Agent: %s
Expect: 100-continue
Transfer-Encoding: chunked
PUTContent-Length: %lu
Connection: Keep-Alive
Sent headerWaiting for 100-continueInvalid redirect location: %sRedirected more than %d timesRedirect refusedRedirect failed: %shttp_request_redirected[%s %s%s]http_request_retriedRetrying (attempts=%d)payload_outgot_responsepayload_in0��P������@��P��P��h��P��P��P��P��P��P��P���P��P��P���د�P��P��P��P��P��P��P��P��P��P��P��0��P������@��P��P��h��P��P��P��P��P��P��P���P��P��P���د�����<�������http_client_request_start_tunnelhttp_client_request_resubmithttp_client_request_redirecthttp_client_request_finishhttp_client_request_aborthttp_client_request_result_eventhttp_client_request_errorhttp_client_request_send_errorhttp_client_request_error_delayedhttp_client_request_send_realhttp_client_request_send_morehttp_client_request_finish_payloadhttp_client_request_finish_payload_outhttp_client_request_continue_payloadhttp_client_request_send_payloadhttp_client_request_do_submithttp_client_request_submithttp_client_request_get_statshttp_client_request_delay_from_responsehttp_client_request_set_proxy_sockethttp_client_request_set_proxy_urlhttp_client_request_set_max_attemptshttp_client_request_set_attempt_timeout_msecshttp_client_request_set_timeouthttp_client_request_set_timeout_msecshttp_client_request_set_payloadhttp_client_request_set_datehttp_client_request_remove_headerhttp_client_request_add_header_fullhttp_client_request_set_urgenthttp_client_request_set_sslhttp_client_request_set_porthttp_client_request_removehttp_client_request_unrefhttp_client_request_refhttp_client_request_connect_ipconn->pending_request == NULLhttp-client-connection.cwait_count == 1Detached peerConnection disconnect%s; already idleconn->to_idle == NULLcount >= idle_count + 1max > 0%s; going idle[%s]:%uunix:%shttp-client-private.hTunnel connect(%s) failed: %sreq->conn == connreq->submittedAbortingconn->idleconn->to_requests == NULLNo more requests queuedClaimed as idlepeer->ppool == conn->ppoolHTTPTunneled HTTPSRawUnix [broken]conn->io_req_payload == NULLconn->to_input == NULLconn->to_response == NULL!conn->in_req_callbackLost peerconn->tunnelingConnection closeRequest No requests, last input %d secs ago, connected %u.%03u secs agoRetrying pending requestsRequest timed outReady for requestsIdle connection timed outConnectedssl_ctx != NULLAborting connection: %sConnection lostconn->pending_request == reqconn->conn.io == NULLNot ready for next requestClaimed request %s!conn->output_brokenhttp_hdr_%s:%sUnlocked outputExpected 100-continue response timed out; sending payload anyway%s; going idle (timeout = %u msecs)array_is_created(&conn->request_wait_list)array_count(&conn->request_wait_list) > 0%s connection created (%d parallel connections exist)%sconn->incoming_payload == NULLconn->conn.io != NULL || pshared->addr.type == HTTP_CLIENT_PEER_ADDR_RAWAborting connection with temporary error: %sServer explicitly closed connectionNo raw connect requests pending; closing useless connectionTunnel connect(%s) failed: Connection timed out in %u.%03u secsconn->conn.input->stream_errno != 0 || conn->conn.input->eofconn->incoming_payload != NULLResponse payload stream destroyed (%u ms after initial response)Pending request destroyed prematurelyreq->state == HTTP_REQUEST_STATE_QUEUEDreq->payload_chunked || req->payload_size > 0count > 0 || conn->to_requests == NULLRequest aborted before sending payload was complete.Server explicitly closed connection: 408 %sGot unexpected input from server: %u %sreq->response_offset != UOFF_T_MAXGot 100-continue response after timeoutGot expected 100-continue responseGot unexpected %u response; ignoringGot early input from server; request payload not completely sent (will close connection)Got %u response for request %s: %s%s (took %u ms + %u ms in queue)Server responded with success response before all payload was sentconnect(%s) failed: Connection timed out in %u.%03u secsSSL handshaking with %s failed: Connection timed out in %u.%03u secs!array_is_created(&conn->request_wait_list) || array_count(&conn->request_wait_list) == 0������������http_client_connection_abort_any_requestshttp_client_connection_unrefhttp_client_connection_refhttp_client_connection_destroyhttp_client_connection_ssl_inithttp_client_connection_start_tunnelhttp_client_connection_continue_requesthttp_client_connection_outputhttp_client_connection_request_destroyedhttp_client_connection_continue_timeouthttp_client_connection_next_requesthttp_client_connection_start_request_timeouthttp_client_connection_claim_idlehttp_client_connection_check_idlehttp_client_connection_idle_timeouthttp_client_connection_start_idle_timeouthttp_client_connection_lost_peerhttp_client_connection_check_readyhttp_client_connection_detach_peerhttp_client_connection_ref_requesthttp_client_connection_return_responsehttp_client_connection_readyhttp_client_connection_inputhttp_client_payload_destroyedarray_idx_ihttp_client_connection_unref_requesthttp_client_connection_abort_error����������������Starting backoff timer for %d msecsBackoff time already exceeded by %d msecsarray_count(&peer->conns) == 0array_count(&ppool->idle_conns) == 0array_count(&ppool->conns) == 0array_count(&ppool->pending_conns) == 0array_count(&peer->queues) == 0pshared->addr.a.tcp.ip.family != 0!http_client_peer_addr_is_https(&pshared->addr) || ssl_ctx != NULLLinked queue %s (%d queues linked)Successfully connected (%u connections exist, %u pending)A connection succeeded within our peer pool, so this peer can retry connecting as well if needed (%u connections exist, %u pending)Claimed idle connection (%u connections exist, %u pending)Making new connection %u of %u (%u connections exist, %u pending)Connection failed (%u connections exist, %u pending)Failed to make connection (%u connections exist, %u pending)Failed to establish any connection within our peer pool: %s (%u connections exist, %u pending)Lost a connection%s (%u queues linked, %u connections left, %u connections pending, %u requests pending, %u requests urgent)Lost a connection while handling requestsNot dropping peer (%d connections active)Dropping peer (waiting for backof timeout)Unlinked queue %s (%d queues linked)Peer no longer used; will now cancel pending connections (%u connections exist, %u pending)array_count(&peer->pending_conns) == 0No requests to service for this peer (%u connections exist, %u pending)Using %u idle connections to handle %u requests (%u total connections ready)No more requests to service for this peer (%u connections exist, %u pending)Creating %u new connections to handle requests (already %u usable, connecting to %u, closing %u)Will not pipeline until peer has shown supportPipelined %u requests (filled pipelines up to %u requests)No request handled; waiting for pending connections (%u connections exist, %u pending)http-client-peer.cPeer disconnectpshared->refcount > 0Peer destroypshared->pools_list == NULLppool->refcount > 0Peer pool destroy (tunnel)peer->refcount > 0Peer closepeer %s (shared): Peer createdPeer reusedPeer pool createdPeer pool reusedpeer %s: pshared->to_backoff != NULLBackoff timer expiredDropping peer nowhttp-client-peer.c:1166Peer cancelidle == 0�
���
���
���
���
��)��.��.��)��9��http_client_peer_cancelhttp_client_peer_shared_connect_backoffhttp_client_peer_handle_requests_realhttp_client_peer_pool_gethttp_client_peer_shared_createhttp_client_peer_disconnecthttp_client_peer_unrefhttp_client_peer_shared_unrefhttp_client_peer_pool_unrefarray_copyhttp_client_peer_pool_closequeue->addr.type != HTTP_CLIENT_PEER_ADDR_UNIXqueue->ips_connect_idx < ips_countqueue->ips_connect_start_idx < ips_countSet request timeout to %s.%03lu (now: %s.%03lu)Absolute timeout expired for request %s (%s)Absolute request timeout expired (%s)req->state >= HTTP_REQUEST_STATE_QUEUED(retained + array_count(&queue->delayed_requests) + array_count(&queue->queued_requests) + array_count(&queue->queued_urgent_requests)) == array_count(&queue->requests)array_count(&queue->pending_peers) == 0Using existing connection to %s%s (%u requests pending)Setting up connection to %s%s (%u requests pending)http_client_peer_addr_cmp( &pending_peer->shared->addr, addr) != 0Started new connection to %s%sConnection to %s%s is taking a long time; starting parallel connection attempt to next IPActivated delayed request %s%sFailed to set up connection to %s%s: %s (%u peers pending, %u requests pending)queue->cur_peer == NULL || queue->cur_peer == peerWaiting for remaining pending peers.Failed to set up any connection; failing all queued requests%s (%u attempts in %u.%03u secs)reqs[1]->release_time.tv_sec > 0Delayed request %s%s already timed outDelayed request %s%s submitted (time remaining: %d msecs)Connection to peer %s claimed request %s %shttp-client-queue.ctime->tv_sec > 0%Y-%m-%d %H:%M:%STimeout (now: %s.%03lu)New timeoutidx < host->shared->ips_count (SSL=%s)pending_peer == peerraw://%s:%uhttps://%s:%uhttp://%s:%uqueue %s:  (urgent)queue->cur_peer == NULLqueue->cur_peer != NULLDropping request %spA��0A��0A���?���A��http_client_queue_request_timeouthttp_client_queue_set_request_timerhttp_client_queue_drop_requesthttp_client_queue_connection_failurehttp_client_queue_connection_successhttp_client_queue_is_last_connect_iphttp_client_host_get_iphttp_client_queue_recover_from_lookuphttp_client_queue_soft_connect_timeouthttp_client_queue_connection_attempthttp_client_queue_fail_fullarray_copyhttp-client-host.ccctx->dns_ttl_msecs > 0DNS lookup failed: %sFailed to lookup host %s: %sHost session destroyhost %s: Host destroyIdle host timed out[unix]Unix host createdHost createdHost session createdNeed to perform DNS lookup!hshared->explicit_iphshared->dns_lookup == NULLHost is idle (timeout = %u msecs)IPs have expired; need to refresh DNS lookupcctx->dns_lookup_timeout_msecs > 0http_client_host_shared_lookup_successhttp_client_host_shared_lookuparray_copyhttp-client.creq->refcount == 1http client contexthttp-client: http-client[%u]: set != NULLhttp clientcctx->refcount > 0client->requests_count == 0All requests finishedcctx != NULLcctx->clients_list == NULLhttp-clientRequested https connection, but no SSL settings givenio_loop_have_ios(client_ioloop) || io_loop_have_immediate_timeouts(client_ioloop)Waiting for %d requests to finishhttp_client_context_closehttp_client_global_context_ioloop_switchedhttp_client_context_unrefhttp_client_handle_request_errorshttp_client_waithttp_client_deinithttp_client_context_update_settingshttp_client_init_sharedhttp-server-ostream.chsostream->resp != NULLresp->payload_stream == NULLResponse payload finished!hsostream->response_destroyedResponse payload stream destroyedResponse output stream destroyed prematurelyResponse payload stream closedFinished response payload streamhsostream->response_destroyed || resp != NULLhsostream->response_destroyed || resp->request->state >= HTTP_SERVER_REQUEST_STATE_PAYLOAD_OUTResponse payload parent stream losthttp_server_ostream_response_destroyedhttp_server_ostream_output_starthttp_server_ostream_output_readyhttp_server_ostream_output_errorhttp_server_ostream_output_finishhttp_server_ostream_output_halthttp_server_ostream_output_resumehttp_server_ostream_output_update_timeoutshttp_server_ostream_wait_beginhttp_server_ostream_switch_ioloop_tohttp_server_ostream_closehttp_server_ostream_destroyhttp_server_ostream_createhttp_server_ostream_continuehttp_server_ostream_output_available!resp->submittedhttp-server-response.cFreeAbort: %s%u response: resp->payload_input == NULL(size_t)sret == sizeStarted tunnellingFinish sending payload (more)resp->payload_output != NULLresp->payload_input != NULLPayload read failureFinish sending payloadhttp-server-response.c:778!conn->output_lockedWill send payload in chunksResponse has no payloadHTTP/1.1 
Date: WWW-Authenticate: Connection: close
No payload to sendstrchr(key, '\r') == NULL && strchr(key, '\n') == NULLstrchr(value, '\r') == NULL && strchr(value, '\n') == NULLreq->state < HTTP_SERVER_REQUEST_STATE_SENT_RESPONSEinput->v_offset <= resp->payload_size(conn %s: request %s: %u response payload)req->state < HTTP_SERVER_REQUEST_STATE_SUBMITTED_RESPONSE || req->state == HTTP_SERVER_REQUEST_STATE_PAYLOAD_OUTRequest aborted while sending blocking payloadNot quite finished sending responseAborted sending response payloadPayload stream %s size changed unexpectedlyresp->tunnel_callback == NULL && resp->status / 100 != 1 && resp->status != 204 && resp->status != 304A HEAD response has no payloadresp->payload_input != NULL || resp->payload_stream != NULLresp->payload_input != NULL || content_length == 0 || resp->payload_stream != NULLWill send payload with explicit size %luWill close connection after sending payload (HTTP/1.0)0���������p�������http_server_response_get_total_sizehttp_server_response_get_statushttp_server_response_send_realhttp_server_response_send_morehttp_server_response_finish_payloadhttp_server_response_output_payloadhttp_server_response_send_payloadhttp_server_response_do_submithttp_server_response_get_payload_outputhttp_server_response_set_payload_datahttp_server_response_set_payloadhttp_server_response_set_datehttp_server_response_update_statushttp_server_response_add_headerhttp_server_response_request_freehttp_server_response_createstatus / 100 != 1 && status != 204 && status != 304HTTP/1.1 500 Internal Server Error
Content-Length: 0

req->state <= HTTP_SERVER_REQUEST_STATE_QUEUEDReceived new request %s (%u requests pending; %u maximum)req->state < HTTP_SERVER_REQUEST_STATE_FINISHEDServer closed connection: %u %sClient requested connection closeconn != NULL && req->response != NULL && req->response->submittedreq->callback_refcount > 0 || (req->response != NULL && req->response->submitted)iostream_pump: read(%s) failed: %siostream_pump: write(%s) failed: %shttp-server-request.ctext/plain; charset=utf-8conn->payload_handler == NULLioloop == current_ioloop[Req%u: <NEW>][Req%u: %s <INCOMPLETE>]request_idGROWING-http_server_requestserver->ioloop == NULLreq->immune_refcount > 0http_server_request_startedReady to respondhttp_server_request_finishedFinished requestConnection input is brokenNot ImplementedBad RequestNo matching resource foundOPTIONSNot FoundUnauthenticatedMethod Not AllowedAllowNot ready to respondPayload Too LargeInternal Server Errorreq->req.payload != NULLpayload_handler_raw_inputhttp_server_payload_handler_initpayload_handler_pump_callbackhttp_server_request_forward_payloadhttp_server_payload_handler_destroyhttp_server_istream_readhttp_server_istream_switch_ioloop_tohttp_server_request_get_payload_inputhttp_server_request_create_fail_responsehttp_server_request_finishedhttp_server_request_submit_responsehttp_server_request_continue_payloadhttp_server_request_halt_payloadhttp_server_request_immune_unrefhttp_server_request_connection_closehttp_server_request_unrefhttp_server_request_refhttp-server-connection.cConnection closed!server->shutting_downhttp-server-connection.c:1091Server shutting downNo more requests pendingHTTP/1.1 100 Continue

Sent 100 ContinueSending responseFinish receiving requestBad request!conn->close_indicatedSSL handshake failed: %shttp-server-connection.c:597HTTP Version Not Supportedhttp-server-connection.c:304URI Too LongExpectation FailedTunnel initiatedPipeline full (%u requests pending; server shutting down)Pipeline full (%u requests pending; %u maximum)conn->request_queue_tail == req || req->state >= HTTP_SERVER_REQUEST_STATE_FINISHEDRequest payload stream destroyedClient sent excessively large requestClient sent invalid request payloadConnection lost: write(%s) failed: %sConnection lost: Remote disconnectedNot ready to respond: Server is processingNot ready to respond: Waiting for clientreq->state == HTTP_SERVER_REQUEST_STATE_READY_TO_RESPOND && req->response != NULLNot ready to continue response: Server is producing responseNot ready to continue response: Waiting for clientConnection lost: read(%s) failed: %sClient sent invalid request: %s!conn->input_broken && conn->incoming_payload == NULLconn->incoming_payload != NULL || req->callback_refcount > 0 || (req->response != NULL && req->response->submitted)�_�_�U��a�������������y��http_server_connection_unrefhttp_server_connection_refhttp_server_connection_createhttp_server_payload_destroyedhttp_server_connection_handle_requesthttp_server_connection_inputhttp_server_connection_next_responsehttp_server_connection_outputresource: resource %s: http-server-resource.clocs_count > 0*path == '\0' || *path == '/'loc->resource == NULLloc->resource != NULLGot request: %sres->callback != NULLhttp-server-resourcehttp_server_resource_callbackhttp_server_resource_findarray_idx_ihttp_server_resource_add_locationhttp_server_resource_get_pathhttp serverhttp-server.chttp-server: http-serverarray_count(&server->locations) == 0http_server_deinitfs-api.cfs-%s: fs->refcount > 0fs metadatafs-api.c:389:/X-Dovecot-fs-api-key != NULLfs-api.c:448fs-api.c:276lib-fs#fslib-fs#file:/X-Dovecot-fs-api-OrigPathfs-api.c:870success*output == file->outputfile->output != NULLoutput != &file->outputfs->files == NULLfs-api.c:239.temp.dovecotfs-api.c:156fs_%s2.3.ABIv21(2.3.21.1)/usr/lib64/dovecotfs_class_%sUnknown fs driver: %sfs-api.c:55/tmp/ :fs_event != NULLlib-fs#iter!file->last_error_changediter != NULLBUG: Unknown file errorfs-api.c:661!file->writing_streamfs-api.c:855fs_file_close(%s)fs-api.c:361!file->istream_openfs-api.c:309%s (in file %s deinit)file->parent != NULLfs->prev_ioloop == NULLfs-api.c:977fs-api.c:750fs-api.c:990fs-api.c:1003fs-api.c:1017fs-api.c:1179src->fs == dest->fsfs-api.c:1200fs-api.c:1217fs-api.c:1249fs-api.c:1301err != 0fs-api.c:516fs_stat() not supportedfs-api.c:1060fs-api.c:1035fs-api.c:1087fs_copy() not supportedfs-api.c:1161FS iteration not supportedfs-api.c:1283fs-api.c:709(size_t)ret == sizefs-api.c:832dest->copy_input == NULL!array_is_created(&file->metadata)dest_array->element_size == src_array->element_size(mode_flags & FS_OPEN_FLAG_ASYNC_NOQUEUE) == 0 || (mode_flags & FS_OPEN_FLAG_ASYNC) != 0fs-%s: %u files still open (first = %s)%s (overwriting error for file %s)file->fs->files_open_count > 0fs_file_last_error(file->parent) != NULLcurrent_ioloop == fs->prev_ioloop(flags & FS_ITER_FLAG_OBJECTIDS) == 0 || (fs_get_properties(fs) & FS_PROPERTY_OBJECTIDS) != 0Metadata not supported by backendFS_GET_METADATA_FLAG_LOADED_ONLY lookup can't fail*output == file->output || *output == NULLAsynchronous operation in progresssrc == NULL || src == dest->copy_srcfs_set_error_errnofs_set_errorfs_iter_init_with_eventfs_deletefs_renamefs_copyfs_default_copyfs_wait_asyncfs_write_stream_abort_parentfs_write_stream_abortfs_set_verrorfs_write_stream_finish_intfs_write_stream_finishfs_write_streamfs_write_via_streami_stream_read_morefs_file_istream_destroyedfs_read_streamfs_read_via_streamfs_set_metadataarray_append_array_ifs_metadata_initfs_file_closefs_file_deinitfs_file_init_with_eventfs_unreffs_refDict iteration failed: %smode != FS_OPEN_MODE_APPENDfs-dict.cmode != FS_OPEN_MODE_CREATE':' missing in argshexbase64Unknown value encoding '%s'dict_init(%s) failed: %sdict_lookup(%s) failed: %sDict key %s doesn't exist_file->output == NULLfs dict fileDict transaction commit failed: %s:/X-Dovecot-fs-api-WriteFilenamefs_dict_file_initfs_dict_file_deinitfs_dict_write_streamJust-written %s shrank unexpectedly (%lu < %lu)i_stream_get_size(%s) returned size as unknownParent filesystem not given as parameterfile->super_output->offset > 0 || file->super_output->stream_errno != 0errno != EAGAINfs-metawrap.cmetawrap!file->input->blockingfile->metadata_readfile->temp_output == NULLfile->temp_output != NULL(size_t)ret == str_len(str)fs-metawrap.c:238fs_metawrap_get_metadatafs_metawrap_write_metadata_tofs_metawrap_write_streamfs_metawrap_write_stream_finishfs_metawrap_statrandomfailfs-randomfail.cInvalid range valueInvalid range valuesInvalid probability valueRandomfail parameters missingread-rangewrite-rangeiter-rangeUnknown key '%s'Random failure injectionmin_val <= max_val../../src/lib/lib.hprefetchrenamedeleteInvalid randomfail parameters: %sfs_randomfail_write_streami_rand_minmaxclosedir(%s) failed: %mopendir(%s) failed: %mfs-posix.cunlink(%s) failed: %mtemp.dovecot.lock=flocklock=dotlockprefix=mode=autodirsno-fsyncaccurate-mtimemode=Invalid mode value: %sInvalid mode: %sUnknown arg '%s'fstat(%s) failed: %mfs-posix.c:912readdir(%s) failed: %mmkdir_parents(%s) failed: %mlink(%s, %s) failed: %mutimes(%s) failed: %mrename(%s, %s) failed: %mfile->fd == -1fs-posix.c:314file->temp_path == NULLsafe_mkstemp(%s) failed: %mfile->fd != -1write(%s) returned %zu/%zurmdir(%s) failed: %mflock(%s) failed: %sfile->file.output == NULLdup() failed: %mlseek(%s, 0) failed: %mposix_fadvise(%s) failed: %mposixfile_dotlock_create(%s) failed: %mfs_posix_file_deinitfs_posix_open_for_readfs_posix_writefs_posix_createfs_posix_openfs_posix_write_streamfile->input != NULLfs-test.cfile->input == NULLfs->parent != NULLfile != NULLfs_test_stream_destroyedfs_test_read_streamfs_test_write_streamtest_fs_file_gettest_fs_getfs_init() failed: %s%s: async writefoo12345fs-test-async.ctest_file->contents->used > 0%s: async copyfs_write_stream_finish(file, &output) == 0fs_write_stream_finish_async(file) == 0fs_write_stream_finish_async(file) < 0test_file->contents->used == 0fs_write(src, "source", 6) == 0fs_copy(src, dest) == -1 && errno == EAGAINsisfs-sis.c:326fs-sis.c%s%s.tmpfs-sis.c:264APPEND mode not supported%s/hashes/%sfs-sis.c:318Couldn't read hash file %s: %m%s backend can't be used with SISfs_sis_write_streamfs-sis-common.copen(%s) failed: Filenames must begin with '<hash>-'sis-queuefs-sis-queue.c:167fs-sis-queue.cfs-sis-queue.c:128fs-sis-queue.c:159fs_sis_queue_write_streamfs-wrapper.cfs_wrapper_write_stream(uoff_t)stream->statbuf.st_size >= mstream->start_offsetMetadata header line is missing ':' at offset %luMetadata header is missing ending line at offset %lu!mstream->istream.parent->blockingistream-metawrap.cstream->istream.v_offset == 0metadata_header_readi_stream_metawrap_readi_stream_metawrap_statdict->refcount > 0dict_destroyeddict destroyedwrite_uncertainrollbackkey_not_founddict_transaction_finishedDict transaction finishedret >= 0 || error != NULLdict_lookup_finishedLookup finished for '%s': %sidx != UINT_MAXUnknown dict module: %sdriverdict(%s): dict %s: %s*dict_r != NULLdict_createddict->iter_count == 0dict->transaction_count == 0dict->transactions == NULLdict->commits == NULLLooking up '%s'Looking up (async) '%s'values_r[0] != NULL!ctx->changedctx->timestamp.tv_sec == 0ts->tv_sec > 0dict_set_timestampdict_commit_callback_ctxdict_set_keySetting '%s' to '%s'dict.c:649dict_unset_keyUnsetting '%s'dict.c:665dict_increment_keyIncrementing '%s' with %llddict.c:681dict_iteration_startedIterating prefix %stxiddict_transaction_startedStarting transactionCommit failed: %sctx->dict->iter_count > 0rowsdict_iteration_finishedIteration finished: %sret > DICT_COMMIT_RET_FAILED || error != NULLusername != NULL && username[0] != '\0'dict_driver_register(%s): Already registeredDictionary URI is missing ':': %sdict created (uri=%s, base_dir=%s)dict_key_prefix_is_valid(key, set->username)Maximum row count (%lu) reachedSetting timestamp on transaction to (%ld, %ld)ctx->dict->transaction_count > 0dict_key_prefix_is_valid(key, ctx->set.username)dict_key_prefix_is_valid(path, set->username)Waiting for dict to finish pending operationsresult->ret >= 0 || result->error != NULLIteration finished, got %lu rowsdict_atomic_incdict_unsetdict_setdict_transaction_rollbackdict_transaction_commit_asyncdict_commit_callbackdict_transaction_commitdict_transaction_set_timestampdict_iterate_deinitdict_iterate_valuesdict_iterate_initdict_refdict_lookup_asyncdict_lookup_finisheddict_key_prefix_is_validdict_lookupdict_transaction_finisheddict_unrefdict_deinitdict_initdict_driver_unregister%d.%03d in dict wait, %d.%03d in other ioloops, %d.%03d in locks, reconnected %u.%03u secs ago, async-id reply %u.%03u secs ago, started on dict-server %u.%03d secs ago, took %u.%03d secs(size_t)ret == iov[0].iov_len + 1io_loop_is_empty(dict->dict.ioloop)Received invalid async-id line: %sReceived async-id line, but all %u commands already have it: %sReceived reply without pending commands: %sReceived invalid async-reply line: %sReceived reply for nonexistent async-id %u: %sDict server timeout: %s (%u commands pending, oldest sent %u.%03u secs ago: %s, %s)dict-server returned failure: %sdict-client: Invalid lookup '%s' reply: %c%sdict-client: Invalid commit reply: %c%sdict commit took %s: %s (%u commands, first: %s)dict client (%s) sent broken iterate reply: %c%s%d.%03d secs (%s%s (reply took %s)dict-client.cdict iteration took %s: %sidle_msecs=Invalid URI: %sInvalid idle_msecswarn_slow_msecs=Invalid warn_slow_msecs/dict!cmd->unfinishedcmd->trans == NULL!ctx->deinit%c%u	%u	%d	%s	%s
lookup.value == NULL!cmds[i]->no_repliesIdle disconnection%s - reconnect failed: %s%s - reconnecteddict-server returned failuredict lookup took %s: %scmd->trans != NULL!ctx->finishedDeinitarray_count(&dict->cmds) == 0%c%u	%s%c%u	%s	%lld%c%u	%s	%s%c%u%c%u	%s	%u%c%s	%s%c%d	%luclient dict iterationclient_dict_cmd_refdict_conn_input_lineclient_dict_deinitclient_dict_waitclient_dict_lookupclient_dict_iter_async_callbackclient_dict_iterate_unrefclient_dict_iterate_deinitclient_dict_transaction_commit_callbackclient_dict_cmd_unrefdict_cmd_callback_errorclient_dict_cmd_query_sendarray_idx_iarray_append_array_iclient_dict_input_timeoutclient_dict_cmd_send�����������������dict-file.c&dict->fdlock=fcntlfile dictmkdir_parentsfchown(%s, -1, %s) failed: %mfchmod(%s, %o) failed: %mcreatcreat(%s) failed: %mfile_wait_lock(%s) failed: %s(&dict->fd)file dict iteratehome_dir changed from %s to %s (requested dict was: %s)dict-file: creat(%s) failed: %mdict-file: file_dotlock_open(%s) failed: %mfile_dotlock_replace() failed: %mfile_dict_deinitfile_dict_open_latestfile_dict_write_changesdict-memcached.cdict->dict.ioloop == NULLCouldn't connectCommunication failureLookup failed: Internal errorLookup failed: BusyLookup failed: Error code=%uInvalid reply magic: %u != %uInvalid key/extras lengths127.0.0.1host=Invalid IP: %sport=Invalid port: %stimeout_msecs=Invalid timeout_msecs: %sUnknown parameter: %smemcached: memcachedLookup timed out in %u.%03u secsmemcached: Only shared keys supported currentlymemcached: Key is too long (%zu bytes): %sbuf->used == MEMCACHED_REQUEST_HDR_LENGTHLookup failed: Temporary failureUnsupported data type: %u != %umemcached_add_headermemcached_dict_lookup����������������memcached_ascii: Request timed out in %u.%03u secsmemcached_ascii: Communication failurememcached_ascii: Unexpected input (expected nothing): %smemcached_ascii: Unexpected input (state=%d): %sarray_count(&dict->replies) > 0array_count(&dict->input_states) == 0array_count(&dict->replies) == 0memcached_ascii: Couldn't connect to %s:%udict-memcached-ascii.cVALUE NOT_STOREDDELETEDNOT_FOUNDreplies[0].reply_count > 0dict->conn.conn.fd_in != -1%s%c%s\-dict-memcached-ascii.c:621set %s 0 0 %zu
%s
delete %s
incr %s %lld
add %s 0 0 %u
%s
decr %s %lld
get %s
memcached_asciimemcached_ascii_input_replymemcached_ascii_wait_repliesmemcached_ascii_input_waitmemcached_ascii_waitmemcached_ascii_transaction_send����������������*2
$4
AUTH
$%d
%s
dict-redis.cdict->connectedpath=db=Invalid db number: %sexpire_secs=Invalid expire_secs: %sredis: *1
$5
MULTI
*2
$3
DEL
$%u
%s
reply->callback != NULL*1
$7
DISCARD
ctx->cmd_count > 0*1
$4
EXEC
*2
$6
SELECT
$%d
%s
*2
$3
GET
$%d
%s
$-1reply->reply_count > 0!dict->transaction_openredisDisconnected during transaction*3
$6
EXPIRE
$%u
%s
$%u
%s
*3
$6
INCRBY
$%u
%s
$%u
%s
*3
$3
SET
$%u
%s
$%u
%s
redis: Commit timed out in %u.%03u secsredis: Lookup timed out in %u.%03u secsredis: Communication failure (last reply: %s)redis: Unexpected input (expected nothing): %sredis: Unexpected input (wanted $size): %sredis: EXEC expected %u replies, not %uredis: Unexpected input (state=%d): %s��������������redis_conn_input_moreredis_dict_deinitredis_dict_lookupredis_transaction_initredis_waitredis_transaction_commitredis_reply_callbackredis_transaction_rollback����������������Unsupported operation (dict does not support this feature)dns-lookup.cdns_request_finishederror_codeclient->head == NULLDisconnect: %sQUIT
Idle timeoutUnexpected input from %sInvalid input from %sLookup timed outFailed to connect to %s: %mCannot send datadns lookupdns(dns_request_startedLookup starteddnsdns-clientLookup failed after %u msecs: %sLookup successful after %u msecsparam != NULL && *param != '\0'dns_client_lookup_commondns_client_deinitdns_client_idle_timeoutname != NULL && mask != NULLdns-util.cdns_match_wildcard(*list_r)[count].type == IMAP_ARG_EOLimap-arg.cimap_arg_get_list_full(FWD)FWDFW[FWD:{%zu}
imap-bodystructure.cInvalid content-typeInvalid content param keyInvalid content param value NILlist/NIL expectednstring expectedatom expected for sizeText lines expectedEnvelope list expected) () params[i].name != NULLparams[i].value != NULLcharset"charset" "us-ascii"*lang != NULLInvalid content-dispositionInvalid content-languageInvalid content-locationpart->data != NULL"message" "rfc822""application" "octet-stream""text" "plain"text flag mismatch"7bit"part->children->next == NULLplain7bitInvalid content paramsInvalid content-idInvalid content-descriptionInvalid size fieldInvalid lines fieldpart->children == NULLInvalid envelope list: %sInvalid content-md5IMAP parser failed: %sEmpty bodystructureimap-bodystructure.c:716parts != NULLInvalid multipart content-typeChild bodystructure list expectedInvalid content-disposition listInvalid content-disposition params("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL)(part->flags & MESSAGE_PART_FLAG_MESSAGE_RFC822) == 0(part->flags & MESSAGE_PART_FLAG_MULTIPART) == 0message_part hierarchy doesn't match BODYSTRUCTUREmessage_part message/rfc822 flag doesn't match BODYSTRUCTUREInvalid content-transfer-encodingmessage_part virtual_size doesn't match size in BODYSTRUCTUREpart->children != NULL && part->children->next == NULLmessage_part lines doesn't match lines in BODYSTRUCTUREmessage_part multipart flag doesn't match BODYSTRUCTURE*parts == NULL || (*parts)->next == NULLimap_bodystructure_parseimap_bodystructure_parse_fullimap_bodystructure_parse_argspart_is_truncatedpart_write_bodypart_write_bodystructure_commonparams_writepart_write_body_multipartInvalid date fieldInvalid subject fieldInvalid from fieldInvalid sender fieldInvalid reply_to fieldInvalid to fieldInvalid cc fieldInvalid bcc fieldInvalid in_reply_to fieldInvalid message_id fieldEmpty envelopeNIL NIL NIL NIL NIL NIL NIL NIL NIL NILDovecotd492236fa0http://www.dovecot.org/dovecot@dovecot.orgrevisionsupport-urlsupport-emailuname() failed: %mos-versionimap-match.cimap-match.c:166imap-match.c:208pos + len <= patterns_data_lenarray_idx_iimap_match_init_multiple_realINBOXInvalid characters in atom8bit data in atomimap-parser.cMissing ')'GROWING-IMAP parserparser->refcount > 0CR sent without LFliteral8 not allowed hereUnexpected ')'data_size > 0BADBYENULs not allowed in stringsMissing '"'Expected '{'Expecting '}' after '+'Literal size too large+ OK
Invalid literal sizeMissing LF after literal sizeparser->cur_pos == 0IMAP command line too largeparser->literal_size_returnparser->args_added_extra_eollast_arg != NULLcount > 1 && args[count-1].type == IMAP_ARG_EOLlist_arg->type == IMAP_ARG_LISTNon-synchronizing literal size too largeparser->cur_type == ARG_PARSE_NONEparser->literal_size == last_arg->_data.literal_size�8�I���H���8�8�`H��H��I��9�wV��V��oV���V��!V��!V���V��imap_parser_read_last_literalimap_parser_get_last_literal_sizelist_add_ghost_eolimap_parser_read_literal_dataimap_parser_save_argarray_idx_iimap_parser_read_argimap_parser_unrefimap_parser_refsrc != NULLimap-quote.cimap-quote.c:120""str_len(dest) - pos == size - remove_countimap_append_string_for_humansimap_append_astringimap_append_stringIMAP number is too highInvalid URLAUTH tokenToo short URLAUTH tokenMissing URLAUTH mechanismMissing URLAUTH tokenMissing URLAUTH verifierEmpty PARTIAL offsetPARTIAL size cannot be zeroEmpty PARTIAL sizeEmpty PARTIAL valueEmpty SECTION valueUID cannot be zeroEmpty UID valueUIDVALIDITY cannot be zeroEmpty UIDVALIDITY valueRelative URL not allowedRelative URL requiredNot an IMAP URLimap-url.cimapStray ':' in userinfo `%s'Stray ';' in userinfo `%s'Stray '%c' in userinfo `%s';UID=;EXPIRE=;URLAUTH=imap:;UIDVALIDITY=;AUTH=;:;UIDVALIDITY=%u/;UID=%u/;SECTION=/;PARTIAL=%lu.%luValue '%s' is not a valid IMAP numberEmpty URLAUTH access applicationEmpty URLAUTH access specifierMissing URLAUTH access specifierIMAP URLAUTH requires absolute URL`;URLAUTH=' is not allowed in this context`;EXPIRE=' without `;URLAUTH='invalid date-time for `;EXPIRE='`;EXPIRE=' is not allowed in this contextEncountered stray ';' in SECTION path segmentEncountered stray ';' in UID path segmentEncountered stray ';' in mailbox referenceEncountered stray ';' after UIDVALIDITYEmpty auth-type value after ';AUTH='IMAP URL does not allow empty host identifierFragment component not allowed in IMAP URLEmpty IMAP URL search query not allowedSearch query part only valid for messagelist-type IMAP URLAbsolute IMAP URL requires `//' after `imap:'(flags & IMAP_URL_PARSE_REQUIRE_RELATIVE) == 0 || base != NULLUnexpected IMAP URL path segment: `%s'Empty URLAUTH access user for `%s' applicationUnrecognized IMAP URL extension: %s(flags & IMAP_URL_PARSE_SCHEME_EXTERNAL) == 0 || base == NULLimap_url_do_parseimap_url_parse%c%02x%c26&-escape_char != '&'imap-utf7.cescape_chars[0] != '&'imap-utf7.c:371imap_utf7_to_utf8_escapedimap_escaped_utf8_to_utf7�������������������������������������������>?���456789:;<=�������	

������ !"#$%&'()*+,-./0123�������������������������������������������������������������������������������������������������������������������������������������ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+,\Answered \Flagged \Deleted \Seen \Draft \Recent \Answered\Flagged\Deleted\Seen\Draft\Recent<%lu byte literal>imap-util.c<%zu byte multi-line literal>����8�����������Ȁ��Ȁ��j0�؂����������P�������������[0�istream-attachment-connector,crlf%s middle%s[base64:%u b/l%s]%s trailerAttachment %s points before the previous attachment (%lu < %lu)Attachment %s points outside message (%lu + %lu > %lu)conn->base_input_offset < conn->msg_sizeistream-attachment-connector.cistream_attachment_connector_finishpart->base64_line_blocks > 0(&outfd)(&part->temp_fd)ctx->data <= ctx->endrfc822-parser.hContent-Dispositionastream->part.temp_fd == -1set->min_size > 0set->hash_format != NULListream attachmentistream-attachment-extractor.cistream-attachment: BUG: Attachment base64 data unexpectedly brokeistream-attachment: read(%s) failed: %sistream-attachment: write(%s) failed: %sistream-attachment-extractor.c:85set->open_attachment_ostream != NULLset->close_attachment_ostream != NULL ������������@�������G-�astream_open_outputrfc822_parser_deinitastream_part_reseti_stream_read_morei_stream_read_bytesastream_decode_base64i_stream_create_attachment_extractorbstream->convert_part != NULListream-binary-converter.csize >= missing_lenold_size != new_sizeContent-Transfer-Encodingbstream->hdr_buf == NULListream binary converterContent-Transfer-Encoding: base64
stream_encode_base64stream_finish_convert_decisioni_stream_binary_converter_readdest > stream->posistream-dot.cdot-input stream ends without '.' linei_stream_dot_returni_stream_dot_read_somei_stream_dot_readistream-header-filter sync() not implementedsnapshot->mstream->snapshot_pendingpos == body_highwater_size || (mstream->end_body_with_lf && pos+1 == body_highwater_size)(flags & (HEADER_FILTER_INCLUDE|HEADER_FILTER_EXCLUDE)) != 0ret >= 0istream-header-filter.c!mstream->last_lf_addedstream->parent->eofmstream->istream.skip == 0pos > 0max_buffer_size > 0ret2 == 0hdr == NULLGROWING-header filter streamhdr_stream_update_posread_mixedread_headerhandle_end_body_with_lfi_stream_header_filter_stati_stream_header_filter_snapshot_freei_stream_create_header_filteri_stream_get_data_size(stream->parent) != 0istream-nonuls.ci_stream_read_parenti_stream_nonuls_readstream->skip <= bstream->buf->usedstream->pos <= bstream->buf->usedInvalid quoted-printable input trailer: %sInvalid quoted-printable input 0x%s: %sistream-qp-decoder.cbstream->buf->used == 0error_pos < sizei_stream_qp_decoder_readistream-qp-encoder.ci_stream_qp_encoder_readquot!--scriptstyle![CDATA[blockquote/blockquote>
></script></style>]]>mail-html2text.caposgtnbspiexclpoundcurrenyenbrvbarsectordflaquonotshyregmacrdegplusmnsup2sup3microparamiddotsup1ordmraquofrac14frac12frac34iquestAgraveAacuteAcircAtildeAumlAringAEligCcedilEgraveEacuteEcircEumlIgraveIacuteIcircIumlETHNtildeOgraveOacuteOcircOtildeOumlOslashUgraveUacuteUcircUumlYacuteTHORNszligagraveaacuteacircatildeaumlaringaeligccedilegraveeacuteecirceumligraveiacuteicirciumlethntildeograveoacuteocircotildeoumldivideoslashugraveuacuteucircuumlyacutethornyumlOEligoeligScaronscaronYumlfnofAlphaBetaGammaDeltaEpsilonZetaEtaThetaIotaKappaLambdaMuNuXiOmicronPiRhoSigmaTauUpsilonPhiChiPsiOmegaalphabetagammadeltaepsilonzetathetaiotakappalambdamunuxiomicronpirhosigmafsigmatauupsilonphichipsiomegathetasymupsihpivenspemspthinspzwnjzwjlrmrlmndashmdashlsquorsquosbquoldquordquobdquodaggerDaggerbullhellippermilprimePrimelsaquorsaquoolinefrasleuroimageweierprealtradealefsymlarruarrdarrharrcrarrlArruArrrArrdArrhArrforallnablaisinnotinniprodsumminuslowastradicpropinfincapcupintthere4simcongasympequivsupnsubsubesupeoplusotimesperpsdotlceilrceillfloorrfloorlangranglozspadesclubsheartsdiams����0����������������������@�������mail_html2text_more%Lumail-user-hash.c:21mail-user-hash.c:25mail-user-hash.cmail_user_hash???From   ctx->parser.data < ctx->parser.end(tmp[0] == ',' || tmp[0] == ':') && tmp[1] == ' 'message-address.c*ctx->parser.data == '<'INVALID_ROUTEMISSING_MAILBOXMISSING_DOMAINSYNTAX_ERROR�message-address.c:509message-address.c:523addr->next == NULL=?addr->mailbox == NULLaddr->mailbox != NULLResent-FromResent-SenderResent-ToResent-CcResent-Bccmessage_address_writerfc822_parser_deinitparse_addr_specparse_local_partparse_angle_addrmessage-date.c:248%s, %02d %s %04d %02d:%02d:%02d %c%02d%02drfc822_parser_deinitUTF-88bitquoted-printablemessage-decoder.c:173message-decoder.c*size >= skiporig_size < CHARSET_MAX_PENDING_BUF_SIZEctx->translation_size <= sizeof(ctx->translation_buf)�������������0���translation_buf_decodemessage_decode_bodyrfc822_parser_deinitnum == QCOUNTmessage-header-decode.csize > start_posmessage_header_decode_encodedmessage_header_decodei+1 < lenmessage-header-encode.cch < 0x80?=
	=?utf-8?q?=%02Xlen >= n_in?=line_len_left >= n_out?=
	=?utf-8?b?next_line_input[i] == '\n'input_idx_need_encodingmessage_header_encode_datamessage_header_encode_bmessage_header_encode_qversion >= 1 && version <= MESSAGE_HEADER_HASH_MAX_VERSIONmessage-header-hash.cmessage_header_hash_moremessage-header-parser.cmessage_parse_headeri_stream_read_bytesmessage_parse_header_nextrfc822_parser_deinit!ctx->preparsedblock->size > 0ctx->nested_parts_count > 0cur != NULL!full!ctx->input->blockingMime-Versionmessage-parser.c:671message/rfc822multipart/digestboundary!ctx->multipartctx->last_boundary == NULLctx->hdr_parser_ctx == NULLctx->part != NULLblock_r->size >= ctx->skipblock_r->data[1] == '\n'block_r->data[0] == '\n'block_r->size > 0!(ret == 0 && full)ctx->nested_parts_count == 0ret < 0 || *parts_r != NULL(**_ctx).preparsed == FALSE!eof(parent->flags & (MESSAGE_PART_FLAG_MULTIPART | MESSAGE_PART_FLAG_MESSAGE_RFC822)) != 0ctx->nested_parts_count < ctx->max_nested_mime_partsctx->total_parts_count <= ctx->max_total_mime_partsctx->input->eof || ctx->input->stream_errno != 0ctx->part->header_size.lines > 0(part->flags & MUTEX_FLAGS) != MUTEX_FLAGSblock_r->size >= ctx->skip + line_sizemessage_parser_deinit_from_parts: %sctx->input->eof || ctx->input->closed || ctx->input->stream_errno != 0 || ctx->broken_reason != NULLmessage_parser_parse_bodymessage_parser_parse_headermessage_parser_parse_next_blockmessage_parser_deinit_from_partsmessage_parser_deinitrfc822_parser_deinitboundary_line_findboundary_remove_untilarray_idx_imessage_part_finishparse_part_finishparse_next_body_to_boundaryparse_body_add_blockmessage_part_appendparse_next_headerparse_next_header_initi_stream_read_bytesmessage_parser_read_moreHeader larger than its cached sizePrologue boundary end not at expected positionPrologue boundary beginning not at expected positionEpilogue boundary start not at expected positionEpilogue boundary end not at expected positionPart larger than its cached sizectx->part->physical_pos >= ctx->input->v_offsetctx->part->children != NULLmessage-parser-from-parts.cEpilogue position is wrongctx->skip == 0Cached header size mismatchpreparsed_parse_prologue_morepreparsed_parse_next_headerpreparsed_parse_next_header_initmessage_parser_init_from_partsmessage-part.cparts->parent == NULLmessage_part_by_idx(params_count % 2) == 0message-part-data.cpart->parent == NULLus-asciifilenameIn-reply-toMessage-idReply-toSubjectContent-message-part-data.c:520MD5LanguageDescription%s/inlineIn-Reply-ToMessage-ID�9���8���9��X9��0:��X9��X9��`:��X9��X9��X9���:��X9��X9��X9��X9���:���:���9��X9��X9��X9��X9��X9��X9��X9��X9��X9��X9��X9��X9��X9���9���8���9��X9��0:��X9��X9��`:��X9��X9��X9���:��X9��X9��X9��X9���:���:���9��>��D<��D<��D<��D<���=��D<��D<���;���=��D<��D<��D<��D<��D<��D<���<��D<��D<��D<��D<��D<��D<��D<��D<��D<��D<��D<��D<��D<��D<��D<��>��D<��D<��D<��D<���=��D<��D<���;���=��D<��D<��D<��D<��D<��D<���<��message_part_is_attachmentmessage_part_has_parametermessage_part_has_content_typesarray_idx_irfc822_parser_deinitparse_mime_parametersmessage_part_data_get_filenamemessage_part_data_is_plain_7bitmessage-part-serialize.cNot enough dataToo much dataphysical_pos less than expectedheader_size.virtual_size too smallbody_size.virtual_size too smallmessage/rfc822 part has no childrenmessage/rfc822 part has multiple childrenchild part location exceeds our sizepart_serialize*normalized_key_utf8 != '\0'message-search.cmessage-search.c:76text/message/message-search.c:242message_search_msg_real
rfc822_parser_deinitmessage_search_initret == -1 || ret > 0message-size.ci > 0hdr->virtual_size >= hdr->physical_sizebody->virtual_size >= body->physical_sizemessage_skip_virtuali_stream_read_moremessage_get_body_sizemessage_get_header_sizemessage snippettext/htmlapplication/xhtml+xml*count_r <= sizemessage-snippet.csnippet_add_contentmessage_snippet_generateret == 3ostream-dot.c
.
ret == 5max_bytes > 0max_bytes >= chunkmax_bytes >= 2(size_t)ret == sent + addeddstream->state != STREAM_STATE_DONE�W��PX��0W���W�� �o_stream_dot_sendvo_stream_dot_finish'=' not followed by two hex digits'=<hex>' not followed by a hex digit'=<whitespace>' not followed by newline(*invalid_src_pos_r == SIZE_MAX) == (*error_r == NULL)CR not followed by LFqp->whitespace->used == 0Too much whitespace����`Z���Z��0Z���Y���Y���]���\���\��\\���[��D]��D]��qp_decoder_invalidqp_decoder_more_textqp_decoder_moremax_len > 0?=
 =?utf-8?Q?=
_src != NULL || src_size == 0=%02X%sqp encoder cannot do header format with binary dataqp_encoder_moreqp_encoder_init%s*%u*%s*%u''array_idx_i*ctx->data == '('rfc822-parser.cstart != ctx->datactx->data < ctx->end*ctx->data == '"'*ctx->data == '@'rfc822_parse_domain_literalrfc822_parse_domainrfc822_parse_quoted_stringrfc822_parse_dot_atomrfc822_skip_commentServer sent non-empty initial responseServer didn't finish authenticationEXTERNALauthid not setpassword not setmech-login.cPLAINn,a=%s,host=%sport=%uauth=Bearer %suser=%sclient->status != NULLmech-oauthbearer.cInvalid port valueStatus value missingError parsing JSON reply: %sFailed to authenticate: %sXOAUTH2OAUTHBEARERmech_oauthbearer_get_resultSASL mechanism not registered: %ssasl clientUnexpected NUL in input dataret >= 0 || *error_r != NULLdsasl-client.cret <= 0 || *value_r != NULLdsasl_client_get_resultdsasl_client_set_parameterauth-client.cauth-client: auth-clientauth_client_is_connected(client)auth_client_get_connect_idauth_client_get_available_mechsauth client requestauth-client-request.cauth-client-request.c:184AUTH	%u		service=service	final-resp-ok	secured=tlstransporttrustedinsecure	no-penalty	valid-client-cert	debug	session=	cert_username=certificate_user	lport=%u	rport=%ureal_local_ipreal_remote_ipreal_local_portreal_remote_port	real_lip=%s	real_rip=%s	real_lport=%u	real_rport=%u	local_name=local_nametls_ciphertls_cipher_bitstls_pfstls_protocol	client_id=client_id	forward_fields=	resp=auth_client_request_startedStarted requestCONT	%u	auth_client_request_continuedContinue requestauth_client_request_finishedevent_original_user=original_userauth_user=auth_userGot challengeInternal failureCANCEL	%u
Aborted: %s(info->flags & AUTH_REQUEST_FLAG_TRANSPORT_SECURITY_TLS) == 0Error sending request to auth server: %mError sending continue request to auth server: %mauth_client_request_challengedj�H��������X���auth_server_send_new_requestauth-client-connection.cMECHprivateanonymousplaintextdictionaryactiveforward-secrecymutual-authCOOKIEDONEauth server connectionauth input: %sAuth server sent empty lineCONTReceived broken input: %sauth server timeoutBuffer fulldeinitializing!conn->connectedVERSION	%u	%u
CPID	%u
conn->conn.handshake_receivedtempBUG: Authentication server input missing IDAuthentication server sent unknown id %uBUG: Authentication server sent broken MECH lineBUG: Authentication server sent invalid PIDBUG: Authentication server sent broken CUID lineBUG: Authentication server already sent cookieBUG: Authentication server returned no mechanismsBUG: Authentication server didn't send a cookieAuth server sent unknown handshake: %sAuth connection closed with %u pending requests (max %u secs, pid=%s, %s)BUG: Authentication server sent broken CONT lineAuth server sent unknown response: %sTimeout waiting for handshake from auth server. my pid=%u, input bytes=%luBUG: Auth server sent us more than %d bytes of datahash_table_count(conn->requests) == 0Error sending handshake to auth server: %shash_table_lookup(conn->requests, POINTER_CAST(id)) == NULLauth_client_connection_remove_requestauth_client_connection_add_requestauth_client_connection_connectauth_client_connection_deinitauth_client_connection_connectedauth-master.cConnecting timed outDisconnected unexpectedlyUser listing returned failureLISTconn->to == NULLwrite(auth socket) failed: %sAuth %s lookup failedUnknown reply: %s*args != NULL || len == 0pass=<hidden>auth %s input: %sauth-master: 	lport=%d	rport=%d	real_lport=%d	real_rport=%dUSER	%u	%suserdb lookup(%s): Started userdb lookupLookup didn't return usernameLookup failedUserdb lookup failedUserdb lookup failed: %suid=Invalid uid in replygid=Invalid gid in replyhome=chroot=PASS	%u	%spassdb lookup(%s): Started passdb lookupPassdb lookup failedPassdb lookup failed: %sFinished passdb lookup (%s)PASSCACHE-FLUSH	%uauth cache flush: Started cache flushCache flush failedFinished cache flushLIST	%uuserdb list:  user_maskauth-master.c:967Returned username: %sListing users failedFinished listing usersBUG: Received more than %d bytesUser listing returned invalid inputconn->event == conn->event_parentconn->event != conn->event_parentAuth %s lookup returned temporary failure: %sauth_client_userdb_lookup_startedauth_client_userdb_lookup_finishedUserdb lookup failed: Lookup didn't return usernameFinished userdb lookup (username=%s %s)auth_client_passdb_lookup_startedauth_client_passdb_lookup_finishedauth_client_cache_flush_startedauth_client_cache_flush_finishedauth_client_userdb_list_startedStarted listing users (user_mask=%s)auth_client_userdb_list_finishedauth_master_event_finishauth_master_unset_ioauth_master_connectauth_master_run_cmd_preauth_master_event_createarray_idx_iauth_lookup_reply_callbackauth_master_connectedsrcleft == 0charset-iconv.cpos <= *src_sizeUTF-8//TESTsrcleft <= CHARSET_MAX_PENDING_BUF_SIZE*src_size - pos <= CHARSET_MAX_PENDING_BUF_SIZEcharset_to_utf8_tryiconv_charset_to_utf8UTF8charset-utf8.ccharset_utf8_to_utf8ssl_iostream_opensslSSL certificate not received<built-in lib-ssl-iostream lookup>%s didn't call iostream_ssl_module_init() - SSL not initializedReceived invalid SSL certificateSSL certificate doesn't match expected host name %s: %s (08@HPX`hpxGROWING-ssl iostream context cache-----BEGIN CERTIFICATE-----
MIIF4TCCA8mgAwIBAgICEAAwDQYJKoZIhvcNAQELBQAwgYQxCzAJBgNVBAYTAk5M
MRMwEQYDVQQIDApHZWxkZXJsYW5kMRIwEAYDVQQHDAlCYXJuZXZlbGQxGjAYBgNV
BAoMEUNoaWNrZW4gQ29vcCBCLlYuMR4wHAYDVQQLDBVDZXJ0aWZpY2F0ZSBBdXRo
b3JpdHkxEDAOBgNVBAMMB1Jvb3QgQ0EwIBcNMTgwMjA4MjEyODE2WhgPMjExODAx
MTUyMTI4MTZaMHgxCzAJBgNVBAYTAk5MMRMwEQYDVQQIDApHZWxkZXJsYW5kMRow
GAYDVQQKDBFDaGlja2VuIENvb3AgQi5WLjEeMBwGA1UECwwVQ2VydGlmaWNhdGUg
QXV0aG9yaXR5MRgwFgYDVQQDDA9JbnRlcm1lZGlhdGUgQ0EwggIiMA0GCSqGSIb3
DQEBAQUAA4ICDwAwggIKAoICAQDgwuwUQ387ALkBO2YAvLiOi0rhQMis+TY34tpN
96Xx9Jaa8gdiAW9y3l8hGFm1+Ens5ZukwMysUoP7rrI5s0XOgCTChzrB4dEnbWHj
2YUYUBVLTLqZ4PTbY6xyrjYHKol1govkU+wclmyeI+Os946U0HFubg+KuXGZ2oLM
iYAmur/oxickEwJX932KhzQS4xdT5o38cVv470ot6eNEAiZcufP/gBSjAyUd8Wge
bwpW64fE/0LyCXYZrK5LWG1dMPC8MpETb8uLAB33r6q3yLTcEWg79bes7SgNrQdx
ncUXBoh8YSJvniZQ6OhwENPGTNhZWzgltDZHASyKXY2ojV70D8iiy/uB+owPSTla
txnu7z8B4kVCBWhCUizk7upjZNA0aFutjEHyYLtxqbTon+iLYm7M4iaga23YBdMU
1QVtulmUY6dcjTJ8GG3uo+qglPKuSodLSb23ovxAdVdIF+BNukd18ZhEIAe08hbw
YBHUYsKNkTMYcwxSgK3yQ4tQw0Cky4wAdsDv1XBK0LZ8+wnuWjnrnO/TRvgLWRU4
qI36OEMk9T0bxi+UwP3mzu78OoMCCdf67ccZ2/zFfHg+dqTBc9zV0sYJ/RQvmEN1
KDgqJAhz+VkDzTBiQYxoztTgBv9yxYufFvwZX4uhsvtMXUuRfvoVwK16vPXnMHwF
muIvwwIDAQABo2YwZDAdBgNVHQ4EFgQUWv/zcVnDWf53C2iN9f6uyUmhp1EwHwYD
VR0jBBgwFoAUsSOnSayEpzvbN21MEQGEyVKx+kIwEgYDVR0TAQH/BAgwBgEB/wIB
ADAOBgNVHQ8BAf8EBAMCAYYwDQYJKoZIhvcNAQELBQADggIBAJUlgJIHnnclDQMn
PSmruCl7bCRvLZYQtSiIv3/K4kPXJMYOvULoXGLA0+CdHoo06k8/TLk7gF1gNCPr
23z2+SCIuvVrVlveWyqD684yQ3UYeWoJnOv90F19267uELrWX4UMVE+z1r7iULyw
cxQokw6EGjw7xHiVETvNlHlmA0/8IuZv89CTztOP54NAXqu8WeloL/ipEhgj1HRx
TkuDf6SlTQ+mXKbiVJFiEA6rOsYFGGWE/SDNbLfx60OoHz0rQ95zw0rv/wPs1Oai
x71Ccuz/i2iI7ItXjQcUEcXvIDFJEMNXDaccIVmk1uda0Cm92W/sGc4vG2LUwEpl
LRj/x4Q39WaZTCrZzd6p2+6tYA45VnoblZ0enYU5XcQzryR/GC7VWFH1OvzOcSG5
NhpKIiWZvuMG5ilXyw7yh7cnWiPvGp8zCO7w1IOyk8sETQBstxuiALeEdrgdz6R5
jV5oIqsCmsIihfRgNufx/SImTJvue4uYgrKa4jo1tw+CFkEWPd7zXjferkxyU8C5
Y+Fr3yMuis5O4qa5mb94r0AQhc8MbCAuInSqNGX0Iu/UTg6Z+56omA2CnKGt6Rwd
LxLo2vhT9gTF88QwTMBPlhVjBbjTRhmY+mHv9gh3GczQ/i5VRXyYQH4h7EBtKFFI
t4mBWMavY+hS/zVkufYzUcUR7D1P
-----END CERTIFICATE-----
-----BEGIN CERTIFICATE-----
MIIF8jCCA9qgAwIBAgIJAN0zFa9E/xyxMA0GCSqGSIb3DQEBCwUAMIGEMQswCQYD
VQQGEwJOTDETMBEGA1UECAwKR2VsZGVybGFuZDESMBAGA1UEBwwJQmFybmV2ZWxk
MRowGAYDVQQKDBFDaGlja2VuIENvb3AgQi5WLjEeMBwGA1UECwwVQ2VydGlmaWNh
dGUgQXV0aG9yaXR5MRAwDgYDVQQDDAdSb290IENBMCAXDTE4MDIwODIxMjA1NloY
DzIyMTcxMjIyMjEyMDU2WjCBhDELMAkGA1UEBhMCTkwxEzARBgNVBAgMCkdlbGRl
cmxhbmQxEjAQBgNVBAcMCUJhcm5ldmVsZDEaMBgGA1UECgwRQ2hpY2tlbiBDb29w
IEIuVi4xHjAcBgNVBAsMFUNlcnRpZmljYXRlIEF1dGhvcml0eTEQMA4GA1UEAwwH
Um9vdCBDQTCCAiIwDQYJKoZIhvcNAQEBBQADggIPADCCAgoCggIBAKMvVLNtj1C+
ZQ4ypNIA5+zB8oseN65k8VqpyhcPAQv0M/HvOB8jXzWH4v1VfKOYkTxQXqu4v0RP
6k0awe/6FH0GDlYhKUuPNDH2djlGOVbq+qBdSXpC3UjEcksxIuigCmzdkuytnlhW
qQYnLVl6kXwYtzjWsetTZBGseCpSYBWnvdtG/MGQNozi03VsGFkj/fbwuLK7ZHVp
64QLk9j3IPZRPHUaFlnT+v2ySMjO8OncsZ/fMZ/nxmt8GJ/68cMy9czydauz2KZs
pQEFS6s/HCmRXT1VQZ7zw5V/PBnF7ecveTaQtxJoNO4Pr7sh77El/ChUxN1Acw4N
2UH/06k6xnirLsvJonCRbVX3bxPBoDzGHjPqb7r0AKD0WBvrzgjeooSjobEtcIvA
LntiGKp4KtvWKcANPWkutH9X71U7M773oMmrz5fWvz9yv3wVuyblZSaMBwrV16GX
mcym6KF+Oj7j86jNq4wxNtjiQVV0QZcBijtnWpHaD5EMhI/TZvLK9oCFyAL92Wzi
t95r8g3D/8ue0CHqB/EpodH88MdVwr7sgxLQ40KibpErOXb93CJnq/7MVMO/EzTj
4XiGGUOo0elLqEPjzBO6AiGEgXAE2iNoghX79cbMQFtk9sK7XdMVLoXwBvt+Naaz
w96+7R+rZ4SsfrtlrP7xoCPJXbeQ4YI9AgMBAAGjYzBhMB0GA1UdDgQWBBSxI6dJ
rISnO9s3bUwRAYTJUrH6QjAfBgNVHSMEGDAWgBSxI6dJrISnO9s3bUwRAYTJUrH6
QjAPBgNVHRMBAf8EBTADAQH/MA4GA1UdDwEB/wQEAwIBhjANBgkqhkiG9w0BAQsF
AAOCAgEAQ30mub/GBwThYX3h9p01kQh+/eXXQ47h1xG3B870EwJ2y36wlGbAhZmE
7o1kDZwhNMR4NxT2PSWQHn8m6RiuSGAG9DU2q55tPEZg2DqkQmoCFvV3n2MVIAwL
rZ8c9EaoM5RkeeDBmuVo8H1aCvd5oLJ5j64z6wkgsSRwVXkxQLOAEdmRSVHN/c/6
QEdg0Uh5wkeC7R5wiwQUEkhLie+XwUPG7dIJHWp9g5oVO7IN+KWBLWiqbAJhVFhF
evOSqGDRV/Q2kfwSqDRrokk7CaE8KO/i+AUTF4TFQc/ewCLSeBSkvV7ORXBbe7ob
ShGViL7WEngpGAVoDZEsSViXQ36a5zxCvYcGjHcsKUITPMiD55x0aKNWjc0XfEg4
JtWvYWwygxTcefbs9pxHrmEnyCPpyDB8cPj866JAeaEAhxhDtSqaBE/ek576aJ+Z
ZaGjBQDDhRndLhTPAx1EXB8jgl/yjD+KMUqHs39UowKH25iBxMiW3R1XDIyYFGyi
+UFP+5NgokW/z6JfpUYd4W3jRcareS10UrLQC8tk4vvixk+1MuNKmzBy2eRITYZz
KiYX6NTvbvRt6XsKil8ypHKvWH+i2Cn3JrnTaCzJ4y66lnbRs4/ZnRceqRz35i39
rNT5Ier3SjmyIulxnmoYXHInIcS0TSV1+byyaTUCHKHLx12RxAM=
-----END CERTIFICATE-----
-----BEGIN CERTIFICATE-----
MIIF/jCCA+agAwIBAgICEAMwDQYJKoZIhvcNAQELBQAweDELMAkGA1UEBhMCTkwx
EzARBgNVBAgMCkdlbGRlcmxhbmQxGjAYBgNVBAoMEUNoaWNrZW4gQ29vcCBCLlYu
MR4wHAYDVQQLDBVDZXJ0aWZpY2F0ZSBBdXRob3JpdHkxGDAWBgNVBAMMD0ludGVy
bWVkaWF0ZSBDQTAgFw0xOTAyMTkxMDI2MzdaGA8yMTIxMTAyMjEwMjYzN1owgbUx
CzAJBgNVBAYTAk5MMRMwEQYDVQQIDApHZWxkZXJsYW5kMRIwEAYDVQQHDAlCYXJu
ZXZlbGQxGjAYBgNVBAoMEUNoaWNrZW4gQ29vcCBCLlYuMSIwIAYDVQQLDBlDaGlj
a2VuIENvb3AgV2ViIFNlcnZpY2VzMRIwEAYDVQQDDAkxMjcuMC4wLjExKTAnBgkq
hkiG9w0BCQEWGmhlbm5pZUBjaGlja2VuY29vcC5leGFtcGxlMIIBIjANBgkqhkiG
9w0BAQEFAAOCAQ8AMIIBCgKCAQEA3mNxJKdYUP88HHAPP8FWSDYKofxg2ECJsBQP
cIEvhuDsOpU+kBp3CbVFL+it4kNq7KvYvQyGvag8JA3RFrvsj3/nFM99lPm6RP1y
h9hNYVWRHHWKyOTdwqhk9bOrLk8j8fxw4NfQ/dkURYLJ0OtVTtJELJsxif5BfIAP
ypHayfnFoNa3rFG3uGULzJlb5JOHJHr7vxOTrRUZGYFZeBFacKF14CHYMUkpr9dv
BLaGqKFF0Lx2TU0tzRIXGu2AIFydcM0eGhCFLOV8YqxwT0R+XyNoNG9jRVSewWx0
r7rAF/93vARdRQVDmVoLmxrUMldYN7mQ9MsuGkMBfecLO4HqrQIDAQABo4IBUDCC
AUwwCQYDVR0TBAIwADARBglghkgBhvhCAQEEBAMCBkAwMwYJYIZIAYb4QgENBCYW
JE9wZW5TU0wgR2VuZXJhdGVkIFNlcnZlciBDZXJ0aWZpY2F0ZTAdBgNVHQ4EFgQU
Ez4hL16BDA+GMrQs+g3/1Do4Vr4wgbIGA1UdIwSBqjCBp4AUWv/zcVnDWf53C2iN
9f6uyUmhp1GhgYqkgYcwgYQxCzAJBgNVBAYTAk5MMRMwEQYDVQQIDApHZWxkZXJs
YW5kMRIwEAYDVQQHDAlCYXJuZXZlbGQxGjAYBgNVBAoMEUNoaWNrZW4gQ29vcCBC
LlYuMR4wHAYDVQQLDBVDZXJ0aWZpY2F0ZSBBdXRob3JpdHkxEDAOBgNVBAMMB1Jv
b3QgQ0GCAhAAMA4GA1UdDwEB/wQEAwIFoDATBgNVHSUEDDAKBggrBgEFBQcDATAN
BgkqhkiG9w0BAQsFAAOCAgEAVbs9RDJiVvGAW2cQv5OvghvMECF2Lh0pxsyOeywz
AQBBEaz85ZTRjtQjTWxpJwgwnIFEmfMEpuZoDoffCWDKUNkt24DD9TN8kriHplPK
5P3qZsnuV/E6CiYxBNpYhEle001XO+sU3yjAMeynPZWSZVz1JnjAdh1+opVd62O8
RX7twWdaSUBdsw7JJ2tdtTPeYkyRqDbfQWZSbA4/3VOwLuOs38zgy5ZqHy+YF/MM
48D1cOI0K1qpJE4qYLzcoULSnJ6C8KsS9LsspiLSDGdEvFY0DnCOa/POG6WiuEGk
JGRD+bDbEPZmNU0OLWjzM3vC2qxjF2PC8Q4chhkm4s4cAT7DMf+nnwqTPGK1U3N3
S5xhHrQ1GMHDhrqmKIrBOxdc8Hg7CwCU+C7TXxIPuQlbdStqMW/lVfbRNKsm/Hr6
smOC/hTxuned5DxRkDTCKNof3bZt8k9dqFLjqj14txmITq7MLhJLcsXgECWe7HmX
imxYJzLHjJU6QoDqGXHEMNrIBp46aIOcTjJP6tfosgAzplj+o00xdpMH9Q9hG602
lpgS9JfemZI68jPTZeGie9wXilPp4kE4qmlxhKSsjh3RVHo6ju7uKI5vCBkk15C6
lQMIGAmkRJ5vkcpUWnO6dKCSQdru/gKn3X4JVAHwm4178gqfRkofT28xAZ+vZoFj
L7M=
-----END CERTIFICATE-----
-----BEGIN RSA PRIVATE KEY-----
MIIEowIBAAKCAQEA3mNxJKdYUP88HHAPP8FWSDYKofxg2ECJsBQPcIEvhuDsOpU+
kBp3CbVFL+it4kNq7KvYvQyGvag8JA3RFrvsj3/nFM99lPm6RP1yh9hNYVWRHHWK
yOTdwqhk9bOrLk8j8fxw4NfQ/dkURYLJ0OtVTtJELJsxif5BfIAPypHayfnFoNa3
rFG3uGULzJlb5JOHJHr7vxOTrRUZGYFZeBFacKF14CHYMUkpr9dvBLaGqKFF0Lx2
TU0tzRIXGu2AIFydcM0eGhCFLOV8YqxwT0R+XyNoNG9jRVSewWx0r7rAF/93vARd
RQVDmVoLmxrUMldYN7mQ9MsuGkMBfecLO4HqrQIDAQABAoIBAQCGV4Az6ju5wlXn
v/IWS4751Fub+z/tox8KFTQ2fHPfgORzh1Dh8HrUjIKdLGxOcPeYvT8TBQwoagba
qNYUa7W+Aj/wHF/6rNlPb+POGGa2U+BzVrZeIZOtUdibbMwOD5ThS+RMj1Ma5hYO
37FW2bMRCIhSgfXtLIEW2q2va2jF9VI+c7F9dL01COG65nwUSJaRSLPrK5WbVNZE
yNm2st88iiu3TtPJGty+wmFgyV0PjAYYqxVEPs6qcmYMuHrfKlrntDfYai6x7fb+
RDfHhmqmn2oV/LGl7YtH+jBML9WG+Rfw+M7pYsd3ffRjG4aRxSTotu0QZfjduP0a
NZL1C3OBAoGBAPrzC4X2/fPGfyHksg+ecPS2Pvnyr+L9Gtg2Dg9wAONbmYqGKYxa
7DUBr6WWbOy9qJKk1CHR2Gn5FK3KbHG1PhLiOuG00kjm6imSCFTpJ3sBXUCl9qMk
FJnBifT4//INLFIcLjFlygR20hHgqyLU8P2kKzM+7iPaF1GYdILYHnExAoGBAOLd
PmKFcwuD4VfzTwK/Va0L8FFi3Oo7O4OE+9PyfTCJ8fH9PW03e4DiddjM0djDovWW
sm1ySVTfHjE0rsnaMGngPvqhG5T6IMUtFowEa2VwqwfFrPzK4PUYeRV1G+rTL1ZX
RGV1nPxCRXog91gzDCuyYB7jblrjG+DP+ZfGI5I9AoGAJc8Mg2iNJndXnDGqqjPC
7PuwTVRFL7vWmZC7WZQUbizU20wPYngocmwInLgnPRvuE/oFg/rr0juW5ABFinQ2
H/45xNvLevRff1fjLXfbXOr9s8nNeRLsj6XbNS920G8vqEdaplKhtz53s/3Xiu3u
SSi84YGvu3MWZFLF6xjIrWECgYAI2tXahpbs9iLPigGle85eSL8CjjdNNS6nfYNO
zIIyaM/2wAmrv6SkbTJoWeY+7bPong8s0m8mTucgyIuh+VA2cbhDlBI9iF3LFG1y
3aFLflBOp1qPK2QIbQIc4ktKqR+J4TIcO7D676NClxLQcH2jHv09d2cRSRgHeFan
o+YziQKBgEtqnknKgedinexHheBhE/fo49bHwNYZBfA5ZKqQDguNBafU1BUOmPEO
eNb8S5cJDMR7zKeZJ9dHzf4j78sITigwxt8+Ee6VY92U/uTFkPKZNLpAr3OfDSdh
z+M/zgztKqdrSKhr64g/3Dbbe+XqdeGe8MIx+P+QN+SrJNNaNZ1r
-----END RSA PRIVATE KEY-----
dcrypt_dcrypt_vfs != NULLdcrypt.cNot implementedTruncated JSONparse_jwk_keydcrypt_verifydcrypt_signdcrypt_key_set_usage_privatedcrypt_key_set_usage_publicdcrypt_key_get_usage_privatedcrypt_key_get_usage_publicdcrypt_key_set_id_privatedcrypt_key_set_id_publicdcrypt_key_get_id_privatedcrypt_key_get_id_publicdcrypt_key_get_curve_publicdcrypt_key_load_public_rawdcrypt_key_load_private_rawdcrypt_key_store_public_rawdcrypt_key_store_private_rawdcrypt_name2oiddcrypt_oid2namedcrypt_rsa_decryptdcrypt_rsa_encryptdcrypt_key_unref_privatedcrypt_key_unref_publicdcrypt_key_ref_privatedcrypt_key_ref_publicdcrypt_keypair_unrefdcrypt_key_id_private_olddcrypt_key_id_privatedcrypt_key_id_public_olddcrypt_key_id_publicdcrypt_key_type_publicdcrypt_key_type_privatedcrypt_key_string_get_infodcrypt_key_convert_private_to_publicdcrypt_key_store_publicdcrypt_key_store_privatedcrypt_key_load_publicdcrypt_key_load_privatedcrypt_keypair_generatedcrypt_pbkdf2dcrypt_ecdh_derive_secret_peerdcrypt_ecdh_derive_secret_localdcrypt_ecdh_derive_secretdcrypt_ctx_hmac_finaldcrypt_ctx_hmac_updatedcrypt_ctx_hmac_initdcrypt_ctx_hmac_get_digest_lengthdcrypt_ctx_hmac_set_key_randomdcrypt_ctx_hmac_get_keydcrypt_ctx_hmac_set_keydcrypt_ctx_hmac_destroydcrypt_ctx_hmac_createdcrypt_ctx_sym_set_paddingdcrypt_ctx_sym_finaldcrypt_ctx_sym_updatedcrypt_ctx_sym_initdcrypt_ctx_sym_get_block_sizedcrypt_ctx_sym_get_tagdcrypt_ctx_sym_set_tagdcrypt_ctx_sym_get_aaddcrypt_ctx_sym_set_aaddcrypt_ctx_sym_get_iv_lengthdcrypt_ctx_sym_get_key_lengthdcrypt_ctx_sym_get_ivdcrypt_ctx_sym_get_keydcrypt_ctx_sym_set_key_iv_randomdcrypt_ctx_sym_set_ivdcrypt_ctx_sym_set_keydcrypt_ctx_sym_destroydcrypt_ctx_sym_createdcrypt_initializeinput->real_stream->max_buffer_size > 0snapshot->dstream->snapshot_pendingstream->skip <= dstream->buf->usedstream->pos <= dstream->buf->usedInput truncated in decryption headerStream is not encrypted (invalid magic)Cannot get public key hash: %sKey decryption error: invalid digest lengthKey decryption error: decrypted key is invalidDecryption context create error: %sUnsupported encrypted data 0x%02xDecryption error: unsupported/invalid cipher: %sDecryption error: unsupported/invalid MAC algorithm: %sDecryption error: dcrypt_key_id_private failed: %sDecryption error: no private key availableKey decryption error: corrupted headerCannot perform key decryption: invalid temporary keyCannot perform key decryption: %sCannot perform key decryption: invalid key lengthDecryption error: unsupported key type 0x%02xDecryption error: unsupported hash algorithm: %sDecryption error: corrupted header ekhashKey decryption error: Key data length mismatchDecryption error: truncate header lengthHeader too large (more than %zu bytes)Decryption error: footer is longer than dataCannot initialize decryption: %sistream-decrypt.cDecryption error: %sMAC error: %sInvalid or corrupted headerPrivate key not available: %sPrivate key not availableCannot perform ECDH: %saes-256-ctrKey decryption error: %sDecryption init error: %skey decryption error: %sAES-256-CBCTruncated headerCannot verify MAC: %sCannot verify MAC: mismatchi_stream_create_decrypt_callbacki_stream_decrypt_readi_stream_decrypt_snapshot_freei_stream_create_decrypt_commonCRYPTEDestream->finalized || estream->ctx_sym == NULL || estream->ostream.ostream.stream_errno != 0ostream-encrypt: Unexpectedly short write to parent streamCannot create ostream-encrypt: %sInvalid algorithm (must be cipher-mac)Encryption init error: Hash algorithm '%s' not supportedCannot perform key encryption: %sCould not initialize stream: %sostream-encrypt.cEncryption failure: %sMAC failure: %s!estream->finalizedostream-encrypt.c:489!stream->prefix_writtenostream-encrypt.c:758AES-256-CTRKey hash failed: %sKey encryption error: %sEncryption init error: %sCannot encrypt key data: %stemp_key->used == 48Unsupported key typeo_stream_encrypt_key_for_pubkey_v2o_stream_encrypt_send_header_v2o_stream_encrypt_send_header_v1o_stream_encrypt_sendvo_stream_encrypt_finalizeo_stream_encrypt_closeCRYPTEDshutdown() failed: %msocketpair() failed: %m(fuzzer data)(fuzzer input to program)!dstream->buffer_usedostream-final-trickle.clast_iov->iov_len > 0o_stream_final_trickle_timeouto_stream_final_trickle_sendvtest-common.c:345test-common.c:356test_prefix == NULLtest-common.c%u / %u tests failed
%s:%u: Assert failed: %s
test-common.c:241suppress == TRUEexpecting_fatal%s:%u: Assert(#%lld) failed: %s
        "%s" !=         NULL != "%s"
 : FAILEDtest_prefix != NULLexpected_errors == 0test_fatal_callback == NULLtest-common.c:398test-common.c:408(test_success = (test_prefix == NULL))%s:%u: Assert(#%lld) failed: %s
        %jd %s %jd is not true
        %ju %s %ju is not true
Desired assert failed to fire at step %iexpected_errors == 0 && expected_error_str == NULLtest_fatal_handlertest_deinittest_fatal_set_callbacktest_expect_errorstest_expect_error_string_n_timestest_endtest_beginstream->skip <= stream->postest-istream.cstream->skip != stream->pos%s isn't test-istreamtest_readtest-ostream.ctstream->flush_pending(test-ostream)%s isn't test-ostreamo_stream_test_flush_pendingsigno >= 0 && (unsigned int)signo < N_ELEMENTS(test_subprocess_notification_signal_received)test: sub-process: fork() failed: %mFailed to kill sub-process [%u] with SIGTERM: %mWait for sub-processes timed outSub-process exited with status %dSub-process forcibly terminated with signal %dSub-process stopped with signal %dSub-process terminated abnormally with status %dWait for sub-processes failed: %mForcibly killed sub-process [%u]Didn't receive wait notification signal from servertest-subprocess.csubp->pid > 0Terminating sub-process [%u]wret > 0Terminated sub-process [%u]subps_left > 0subps_left == 0sub-process ended properlykill(%ld, SIGHUP) failed: %mtest: test_subprocess_notification_signaltest_subprocess_notify_signal_resettest_subprocess_kill_forcedtest_subprocess_kill_allsize == array2->element_sizearray_equal_fn_ctx_iarray_equal_fn_iarray_idx_modifiable_iaqueue->full && aqueue->head == aqueue->tailorig_area_size < aqueue->area_sizeaqueue->tail < aqueue->area_sizeaqueue->head < aqueue->area_size && aqueue->head != aqueue->tailaqueue->area_size > 0aqueue.caqueue->head != aqueue->tailn < countidx < aqueue->headaqueue_deletearray_copyaqueue_growaqueue_init/dev/ttyopen(/dev/tty) failed: %maskpass.caskpass_str -> 0x%pbacktrace_base32.c������������ ����@�����@��������������������������������������������������	�������

������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������	

���������������������������������������������������������������������������������������������������������������������������������������������������������������������0123456789ABCDEFGHIJKLMNOPQRSTUVABCDEFGHIJKLMNOPQRSTUVWXYZ234567enc->w_buf_len <= sizeof(enc->w_buf)enc->max_line_len < SIZE_MAX-2enc->cur_line_len <= enc->max_line_lenenc->cur_line_len <= (enc->max_line_len - written)enc->w_buf_len <= (sizeof(enc->w_buf) - 3)enc->w_buf_len <= (sizeof(enc->w_buf) - 2)base64.cout_size > 2out_size > 1enc->max_line_len > 0!enc->finishing!enc->finished!enc->pending_lfptr < endptr == endptr <= endsrc_pos <= src_leftdest->used >= dst_poswritten <= line_availwritten <= enc->max_line_lensrc_p >= src_cdest != NULL!dec->finished!dec->failedsrc_pos_r != NULLsrc_pos < src_size!dec->seen_paddingbase64_decode_finishbase64_decode_morebase64_encode_finishbase64_encode_more_database64_encode_morebase64_encode_get_full_spacebase64_encode_get_out_sizebase64_encode_get_sizebase64_get_full_encoded_sizenum <= ((size_t)1 << (CHAR_BIT*sizeof(size_t) - 1))bits.cnearest_powernmemb < INT_MAXbsearch-insert-pos.cbsearch_insert_posbuf->used <= buf->allocbuffer.csize > buf->allocbuf->w_buffer == NULL<none>buf->w_buffer != NULLsrc_pos <= src->usedsrc->r_buffer != NULLused_size <= buf->allocbuf->alloc >= buf->usedret == buf->w_bufferbuf->w_buffer == NULL || buf->allocedTrying to reallocate %zu -> %zu bytesBuffer write out of range (%zu + %zu)Buffer full (%zu > %zu, pool %s)buf->used == 0 || buf->w_buffer != NULLbuffer_verify_poolbuffer_get_avail_sizebuffer_set_used_sizebuffer_get_modifiable_databuffer_copybuffer_check_limitsbuffer_allocbuffer_create_from_const_datais->eofbuffer-istream.cres != BUFFER_APPEND_READ_MOREbuffer_append_full_filei_stream_read_morebuffer_append_full_istreamchild_wait_refcount > 0child-wait.cchild_wait_deinit!conn->disconnected(conn:unix:fd=%did=%uconn->io == NULLconn->input == NULLconn->output == NULLSending version handshakeVERSION	%s	%u	%u
!conn->version_receivedsource_ipremote_pidremote_uidconn->remote_port != 0pid=%ld,uid=%ldUpdated peer address to %sfd_in=%d,fd_out=%dconn->list->set.clientserver_connection_connectedClient connected (fd=%d)conn->fd_in == -1Connectingconnection.c:82DeinitializingHandshake failedreasonDisconnected: %s (fd=%d)No input for %u.%03u secsvfuncs->destroy != NULLconn->list == list!list->set.clientclient_connection_connectedconn->fd_in >= 0conn->fd_out >= 0conn != list->connectionsUnexpectedly received empty lineconn->to != NULL || conn->input_idle_timeout_secs == 0Connected to wrong socket type. We want '%s', but received '%s'Socket supports major version %u, but we support only %u (mixed old and new binaries?)didn't reply with a valid VERSION line: %slabel != NULL || conn->property_label == NULLClient connection failed (fd=%d)Waiting for connect (fd=%d) to finish for max %u msecsconnect() timed out in %u.%03u secsserver_connection_disconnectedclient_connection_disconnectedconn->list->connections_count > 0No input since connected %u.%03u secs agoconnect() timed out after %u.%03u secsServer accepted connection (fd=%d)vfuncs->input != NULL || set->input_full_behavior != CONNECTION_BEHAVIOR_ALLOWset->major_version == 0 || (set->service_name_in != NULL && set->service_name_out != NULL && set->output_max_size != 0)X��(X��X��8X��XX���X��X��connection_list_deinitconnection_list_initconnection_set_handlersconnection_deinitconnection_client_connectconnection_init_from_streamsconnection_init_client_unixconnection_init_client_ip_fromconnection_client_connectedconnection_init_client_fdconnection_init_streamsconnection_init_serverconnection_init_fullconnection_update_property_labelconnection_update_propertiesconnection_input_resume_fullconnection_input_line_defaultconnection_verify_versionval->tv_usec < 1000000time-util.husage_diff >= 0cpu-limit.cgetrusage() failed: %msetrlimit() failed: %mcpu_limit_secs > 0type != 0getrlimit() failed: %mclimit == cpu_limitcpu_limit_deinitcpu_limit_inittimeval_addcpu_limit_get_usage_msecs_with�0w,a�Q	��m��jp5�c飕d�2�����y����җ+L�	�|�~-����d�� �jHq���A��}�����mQ���DžӃV�l��kdz�b���e�O\�lcc=��
�� n;^iL�A`�rqg���<G�K��
�k�
����5l��B�ɻ�@����l�2u\�E�
��Y=ѫ�0�&:�Q�Q��aп��!#ijV���������(�_���$���|o/LhX�a�=-f��A�vq�� Ҙ*��q���俟3Ը��x4���	���
j-=m�ld�\c��Qkkbal�0e�Nb��l{����W���ٰeP�긾�|�����bI-��|ӌeL�Xa�M�Q�:t���0��A��Jו�=m�Ѥ����j�iC��n4F�g�и`�s-D�3_L
��|
�<qP�A'�� �%�hW��o 	�f���a���^���)"����=�Y�
�.;\���l�� �������ұt9G��wҝ&���sc�;d�>jm
�Zjz��	�'�
��}D��ң�h���i]Wb��ge�q6l�knv��+ӉZz��J�go߹��ホC��Վ�`���~�ѡ���8R��O�g��gW����?K6�H�+
�L
��J6`zA��`�U�g��n1y�iF��a��f���o%6�hR�w�G��"/&U�;��(���Z�+j�\����1�е���,��[��d�&�c윣ju
�m�	�?6�grW�J��z��+�{8���Ғ
�����|!����ӆB����hn�����[&���w�owG��Z�pj��;f\��e�i�b��kaE�lx�
���
�T�N³9a&g��`�MGiI�wn>JjѮ�Z��f�@�;�7S���Ş��ϲG�0򽽊º�0��S���$6к���)W�T�g�#.zf��Ja�h]�+o*7������Z��-data-stack.ccurrent_block->next == NULLdata_stack_initdata-stack.c:514data_stack_growused_sizelast_alloc_sizelast_block_sizeframe_markerbacktracelast_buffer_block != NULLlast_buffer_size >= sizecurrent_block->left >= sizemarker != NULLMissing t_pop() calldata stack: Out of memory when allocating %zu bytest_pop() called with empty stackALLOC_SIZE(size) == current_block->leftwanted_frame_id+1 == data_stack_frame_idtotal_used=%zu, total_alloc=%zu, last_alloc_size=%zuGrowing data stack by %zu for '%s' (%s)data_stack_get_used_sizedata_stack_get_alloc_sizedata_stack_frame_containst_buffer_alloct_get_bytes_availablet_pusheacces-error.c missing +%c perm: %s, we're not in group %s, access(%s, %d) failed: %m/test, stat(%s/test) failed: %meacces_error_get_full: %s in an unknown directory in directory %s(<getpwuid() error>)(<unknown>) egid=%s(<getgrgid() error>), conflicting dir uid=%s(%s), dir owned by %s:%s mode=0%o, dir owner missing perms, conflicting dir gid=%s(%s)%s(%s, group=%s, group based on %s, UNIX perms appear ok (ACL/MAC wrong?) failed: Permission denied (euid=%s UNIX perms appear ok (ACL/MAC wrong?)) failed: Operation not permitted (egid=%s - see http://wiki2.dovecot.org/Errors/ChgrpNoPerm)strchr(name, '=') == NULLenv-util.csetenv(%s, %s) failed: %menv-util.c:29unsetenv(%s) failed: %mclearenv() failedenv-util.c:92environ != NULLsaved environmentenv_backup_saveenv_put_arrayenv_putfield->value_type == EVENT_FIELD_VALUE_TYPE_STRLIST(op == EVENT_FILTER_OP_AND) || (op == EVENT_FILTER_OP_OR)ctx->type < N_ELEMENTS(event_filter_log_type_map)event-filter.c>=<=event-filter.c:264event filterfilter->refcount > 0state.error == NULLstate.error != NULL AND  OR NOT source_location:%jucategory!filter->fragmentwarningpanic~��8|��(|��|��|���{��m��m��m����}���|���|���|��}��������������ȃ��ȃ���������������
���^��^��^��^��^��p���؄��H���K���������������������T���4������8��I�����ȇ���0�����������event_filter_match_iter_initevent_filter_query_matchevent_filter_match_sourceevent_match_strlist_recursiveadd_nodeevent_filter_parseevent_filter_unrefevent_filter_refyyset_lineno called with no bufferyyset_column called with no bufferout of dynamic memory in yy_create_buffer()realloc(ptr, %zu): Out of memoryout of dynamic memory in yyensure_buffer_stack()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()fatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowout of dynamic memory in yy_get_next_buffer()fatal flex scanner internal error--no action foundevent filter parsing: %scalloc(1, %zu): Out of memorybad buffer in yy_scan_bytes()state->len > state->posevent-filter-lexer.l_���x�������ؓ��������ؓ��������������
���˔������������ؕ��N���N���event_filter_parser_input_proc
   	

 
88888	8	8888+/3	

	


	syntax errorsyntax error, unexpected %sevent filter: %s*?memory exhausted"end of file""invalid token"TOKENSTRINGNOT'>'$acceptexprkey_valuesyntax error, unexpected %s, expecting %s or %s or %s or %ssyntax error, unexpected %s, expecting %s or %s or %ssyntax error, unexpected %s, expecting %s or %ssyntax error, unexpected %s, expecting %sOnly fields support inequality comparisons��������K�����������������k������������������أ����]���������������t���



	�
	


�������

	�����
�������������������	
!params->no_send || params->base_str_out != NULLevent-log.cevent-log.c:27event-log.c:46event-log.c:65event-log.c:84event-log.c:103event_logv_paramsexecv(%s) failed: %mexecvp(%s) failed: %m%s - [blocking on log write]%c%s %s=%s
%c%s prefix%u %s%06u%sfailures.cfailures.c:272write() failed to %s log: %mclose(%d) failed: %m
Can't open log file %s: %m
Raw backtrace: %sCORE_OUTOFMEMCORE_ERRORclose(%d) failed: %m%{usecs}(&log_fd)(&log_info_fd)(&log_debug_fd)file %s: line %d: unreachedDebug: Info: Warning: Error: Fatal: Panic: ctx->log_prefix_type_pos <= strlen(ctx->log_prefix)Broken log line follows (type=NUL)Broken log line follows (type=%d)`��0��p���������������failures_deinitlog_prefix_addfcntl(F_GETFD, %d) failed: %mfcntl(F_SETFD, %d) failed: %mLeaked UNIX socket fd %d: %sfd leak foundfd > -1fd-util.cfcntl(%d, F_GETFL) failed: %mfcntl(%d, F_SETFL) failed: %m = (fdp[i])Leaked socket fd %d: %s:%u -> %s:%uLeaked file fd %d: dev %s.%s inode %sLeaked unknown fd %d (errno = %s)%s: close(%s%s%s) @ %s:%d attempted with fd=%d%s: close(%s%s%s) @ %s:%d failed (fd=%d): %mdup2(/dev/null, %d) failed: %mfd_close_maybe_stdiofd_set_nonblockfdatasync-path.cfdatasync_pathsize > 0 && size < INT_MAXfdpass.cfd_readfd_sendmunmap_anon(%s) failed: %mpage_size > 0file-cache.c(size % page_size) == 0mmap_anon(%s, %lu) failed: %mpsize > 0psize == 1size > offsetUOFF_T_MAX - offset > sizemremap_anon(%s, %lu) failed: %mpoffset == cache->read_highwater / page_sizefile_cache_invalidatefile_cache_writefile_cache_readfile_cache_set_sizefile-create-locked.cTemporary file %s was unexpectedly deletedCreating a locked file %s keeps failingtry_create_newfile_create_lockedfile-copy.c:108file-copy.c(&fd_in)open(%s, O_CREAT) failed: %mfchown(%s) failed: %m�J��J�����file_copy_to_tmpfile-dotlock.clstat(%s) failed: %mftruncate(%s) failed: %mlock_info->fd == -1.temp.%s.%s.(&lock_info->fd)utime(%s) failed: %mlock_info.fd != -1.lockfile-dotlock.c:678file-dotlock.c:775deletedoverriddenfchownfile-dotlock.c:889Created dotlock file's timestamp is different than current time (%s vs %s): %sdotlock %s was immediately deleted under usdotlock %s was immediately recreated under usOur dotlock file %s was %s (locked %d secs ago, touched %d secs ago)Our dotlock file %s was %s (kept it %d secs)Our dotlock file %s was modified (%s vs %s), assuming it wasn't overridden (kept it %d secs)fchown(%s, %ld, %ld) failed: %mtry_create_lock_hardlinktry_create_lock_exclread_local_piddotlock_createfile_lock_slow_warning_usecs == -1FILE_LOCK_SLOW_WARNING_MSECS: Invalid value '%s' - ignoring (BUG: lock is held by our own process)fcntl(%s, %s, F_SETLK) locking failed: %m (File is already locked)fcntl(%s, %s, F_SETLKW) locking failed: Timed out after %u seconds%sfcntl(%s, %s, %s) locking failed: %mflock(%s, %s) failed: %m (File is already locked)flock(%s, %s) failed: Timed out after %u seconds%sfile_lock_free(): Unexpectedly failed to retry locking %s: %sfile_lock_free(): fstat(%s) failed: %mfile_lock_free(): stat(%s) failed: %mfile-lock.cFILE_LOCK_SLOW_WARNING_MSECSLock %s kept for %d.%03d secsREADWRITE (%s lock held by pid %ld)%02x:%02x:%llu/proc/locksfile-lock.c:111lock_wait_start.tv_sec == 0lock_wait_start.tv_sec != 0Locking %s took %d.%03d secswrite-lockunlockread-lockF_SETLKF_SETLKW%s%sflock(%s, %s) failed: %mfile_unlock(%s) failed: %m(&lock->fd)!lock->set.unlink_on_freefile_lock_wait_endfile_lock_wait_startfile_lock_freefile_unlockfile_lock_wait_init_warningfile_lock_dosize >= 0file-set-size.cfstat() failed: %mftruncate() failed: %mposix_fallocate() failed: %mpwrite() failed: %mfile_set_sizeclock_gettime() failed: %m%08x%08lx.%x.%s{%s}guid.cguid.c:158%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02xtable->frozen == 0table->nodes_count < UINT_MAXtable->frozen > 0opcode == HASH_TABLE_OP_UPDATEhash_table_thawhash_table_compresshash_table_resizehash_table_insert_nodehash_table_clearhash_table_destroy333333�?@No '{' after '%'Missing '}'hash formathash-format.c:129Unknown hash method: Invalid :bits number: list != NULLhash-format.clist->bits % 8 == 0Currently :bits must be divisible by 8: hash_format_digesthash_format_writemeth != NULLhash-method.cdata_len == 0 || data != NULLt_hash_datahash_method_get_digesthash2_remove_value(): key/value not foundhash2 value poolhash2_remove(): key not foundarray_idx_ihex-binary.cfile %s: line %d: memory allocation overflow: %zu * %zumeth->context_size <= HMAC_MAX_CONTEXT_SIZEokm_len < 255*method->digest_sizehmac.ckey != NULL && key_len > 0data != NULL || data_len == 0method != NULLsalt != NULL || salt_len == 0info != NULL || info_len == 0ikm != NULL && ikm_len > 0okm_r != NULL && okm_len > 0hmac_hkdft_hmac_datahmac_initgetpwnam(%s) failed: %mhook-build.chook build contextstack->vfuncs[i] != NULLstack->next != NULL(size % sizeof(void (*)())) == 0hook_copy_stackhook_update_maskhook_build_initDOVECOT_HOSTNAMEgethostname() failed: %m/
	Invalid system hostname: '%s'DOVECOT_HOSTDOMAINstr != NULLimem.cstr1 != NULLimem.c:69i_strconcati_strndupstream->refcount > 0iostream.cConnection closed: %sio_stream_unrefio_stream_ref!pump->output->blockingiostream-pump.c!pump->input->blockingpump->callback != NULLpump->refcount > 0_pump != NULLinput != NULL && output != NULL!input->blocking || !output->blockingA��@A��`A���@���@��iostream_pump_switch_ioloop_toiostream_pump_stopiostream_pump_destroyiostream_pump_unrefiostream_pump_refiostream_pump_set_completion_callbackiostream_pump_get_outputiostream_pump_get_inputiostream_pump_copyiostream_pump_startiostream_pump_createiostream-proxy.cproxy != NULLproxy->callback != NULLproxy->ref > 0left_input != NULL && right_input != NULL && left_output != NULL && right_output != NULLproxy != NULL && proxy->ref > 0iostream_proxy_switch_ioloopiostream_proxy_stopiostream_proxy_unrefiostream_proxy_refiostream_proxy_get_ostreamiostream_proxy_get_istreamiostream_proxy_set_completion_callbackiostream_proxy_startiostream_proxy_create%ld.%06u connect(%s:%u) failed: %m%s.in%s.outiostream-rawlog.c(&in_fd)rawlog: stat(%s) failed: %m%Y%m%d-%H%M%S%s/%s.%s.%uiostream_rawlog_create_prefixiostream-temp.c(&tstream->fd)instream->v_offset <= in_sizetstream->buf == NULLtstream->fd_triedtstream->fd != -1(temp iostream in %s)(temp iostream in %s for %s) for %s(Temp file in %s%s, from %s)iostream-temp: read(%s) failed: %sstream->ostream.offset == tstream->buf->usediostream-temp %s: read(%s*) failed: %miostream-temp %s: write(%s*) failed: %m - moving to memory(Temp file fd %d in %s%s, %lu bytes)(Temp buffer in %s%s, %zu bytes)o_stream_temp_fd_sendvo_stream_temp_move_to_fdo_stream_temp_sendvo_stream_temp_dup_istreamo_stream_temp_write_ato_stream_temp_closeo_stream_temp_move_to_memoryZ%c%02d:%02d%04d-%02d-%02dT%02d:%02d:%02d%sstream->w_buffer != NULLstream->skip == stream->posdest->real_stream->fd == -1<no error>_stream->skip != _stream->pos!stream->blocking_stream->skip < _stream->posmax_size > 0wanted_size > 0avail_size >= sizestream->real_stream->io == io(error)%s is missing istream.snapshot() implementationold_size <= _stream->pos - _stream->skipold_size == _stream->pos - _stream->skip(size_t)ret+old_size == _stream->pos - _stream->skip!i_stream_is_buffer_invalid(_stream)stream %s doesn't support seeking backwardsCan't seek to offset %lu, because we have data only up to offset %lu (eof=%d)Line is too long (over %zu bytes at offset %lu)stream->memarea == NULL || memarea_get_refcount(stream->memarea) == 1stream->buffer_size >= stream->posstream->w_buffer != NULL || *size_r == 0stream->real_stream->io == NULLseekable_i_stream_get_sizei_stream_unset_ioi_stream_set_ioi_stream_get_root_ioi_stream_alloci_stream_try_alloci_stream_w_buffer_realloci_stream_grow_bufferi_stream_compressi_stream_read_morei_stream_read_datai_stream_read_copy_from_parenti_stream_read_memareai_stream_default_snapshoti_stream_copy_fdistream-base64-decoder.cBase64 data ends prematurelyInvalid base64 data: 0x%spost_count > pre_counti_stream_get_data_size(stream->parent) == 0i_stream_base64_finish_decodei_stream_read_parenti_stream_base64_decoder_readistream-base64-encoder.cbuf.used > 0post_count == pre_countchars_per_line % 4 == 0i_stream_base64_finish_encodei_stream_base64_try_encodei_stream_read_parenti_stream_base64_encoder_readi_stream_create_base64_encoder_commoncstream->buf->used >= cstream->prev_posistream-callback.ccstream->buf->used > 0cstream->buf->used > posi_stream_callback_readi_stream_create_callbackstream->skip >= cstream->prev_skipstream->pos >= stream->skip + cstream->prev_stream_leftlink != NULL && link->stream != NULListream-chain.cstream->buffer != NULLbytes_skipped == 0cur_data_pos == data_sizelink->stream->eofcur_data_pos <= data_sizeret == 0 || ret == -1data_size > cur_data_posnew_pos > stream->posstream->memarea != NULLi_stream_chain_read_nexti_stream_chain_skipi_stream_chain_readi_stream_chain_snapshotstat(%s) failed: %sistream-concat.cSeeking past EOF by %lu bytescstream->cur_idx > 0cstream->cur_input != NULLcstream->cur_input->eofsize >= data_sizecount != 0cur_max != 0istream-concat: stat(%s) failed: %scstream->cur_input == cstream->input[cstream->cur_idx]cstream->prev_stream_left == cstream->istream.pos - cstream->istream.skipcstream->prev_stream_skip == 0ret != -1 || stream->istream.eofi_stream_concat_closei_stream_concat_destroyi_stream_concat_set_max_buffer_sizei_stream_concat_read_nexti_stream_concat_skipi_stream_concat_readi_stream_concat_seeki_stream_concat_stati_stream_create_concatistream-crlf.ci <= sizedest <= stream->buffer_sizesrc <= src_endsrc == ptr + 1dest != stream->w_buffercstream->pending_cr && size == 1dest <= dest_end && src <= src_endi_stream_crlf_read_crlfi_stream_crlf_read_commoni_stream_crlf_read_lf(buffer)istream-failure-at.cnew_pos >= stream->skip && stream->pos >= new_posi_stream_failure_at_readfile_istream.close(%s) failed: %mstream doesn't support seeking backwardspread(size=%zu offset=%lu) failed: %mfile_istream.fstat(%s) failed: %mfile_istream.stat(%s) failed: %m%s is a directory, can't read it as fileistream-file.cerrno != EBADFread(size=%zu) failed: %mret != 0 || !fstream->fileret != -1(file)(fd)<fd %d>*fd != -1i_stream_create_fd_autoclosei_stream_create_fdi_stream_create_file_commoni_stream_file_readSeeking not supported before hashing is finishedstream->istream.v_offset <= hstream->high_offset(size_t)ret <= sizeistream-hash.ci_stream_hash_readEOF before trailing <"> was seenUTF16_VALID_HIGH_SURROGATE(high) && UTF16_VALID_LOW_SURROGATE(low)unichar.hInvalid JSON stringistream-jsonstr.ci == 0extra > 0uni_join_surrogatei_stream_jsonstr_readistream-limit.ci_stream_limit_readmstream != NULListream-multiplex.cUnexpected EOF - %u bytes remaining in packetstream->pos + channel->pending_pos + used <= stream->buffer_sizestream->pos + used <= stream->buffer_sizeget_channel(chan->mstream, cid) == NULLi_stream_multiplex_readget_channeli_stream_multiplex_add_channelistream-rawlog.crawlog_path != NULLrawlog_fd != -1rawlog(%s)i_stream_rawlog_readi_stream_create_rawlogistream-seekable: safe_mkstemp(%s) failed: %mstream->pos == 0 && stream->skip == 0stream->pos == sstream->buffer_peakstream->pos <= sstream->buffer_peakistream-seekable: write_full(%s) failed: %m(seekable temp-istream for: %s)istream-seekable: Couldn't read back in-memory input %s: %sstream->istream.v_offset + stream->pos <= sstream->write_peakistream-seekable: read(%s) failed: %mi_stream_stat() used for non-blocking seekable stream %s offset %luistream-seekable.c*ret_r > 0sstream->fd != -1stream->skip == 0sstream->fd == -1temp_path_prefix != NULLseekable_fd_callbacki_stream_create_seekable_pathi_stream_create_seekableread_from_bufferi_stream_seekable_write_failedcopy_to_temp_filei_stream_seekable_readi_stream_seekable_stati_streams_mergeStream is smaller than expected (%lu < %lu)Stream is larger than expected (%lu > %lu, eof=%d)istream-sized.ci_stream_sized_readtstream->istream.istream.v_offset >= tee->input->v_offsettstream->istream.skip + old_used <= sizetee-istream: i_stream_sync() called with data still bufferedtee->input->v_offset <= tee->max_read_offsetlast_high_offset == input->v_offset + sizelast_high_offset < input->v_offset + sizestream->istream.v_offset + (stream->pos - stream->skip) == input->v_offset + sizeistream-tee.cstream->pos < sizestream->buffer == datai_stream_tee_destroyi_stream_tee_readtee_streams_update_bufferFailed to detect stream formatUnexpected error while detecting stream format: %sistream-try.cistream_try_createistream-timeout.c (requested timeout in %u ms)%s (opened %d secs ago)Read timeout in %u.%03u s after %lu bytes%sistream-unix.c(&ustream->read_fd)ustream->read_fd == -1ustream->fstream.skip_left == 0i_stream_unix_closei_stream_unix_readi_stream_create_unixtv_r->tv_sec > 0ioloop.ctimeout->next_run.tv_sec > 0!timeout->one_shotioloop.c:981CORE_IO_LEAK(condition & IO_NOTIFY) == 0ctx->ioloop->cur_ctx != ctxio->callback != NULLctx->ioloop->cur_ctx == NULL!cb->activatedioloop.c:1186ctx->ioloop->cur_ctx == ctxioloop.c:1204ioloop.c:706ioloop timeout handler %pioloop->io_pending_count > 0ioloop handler %ptimeout->msecs > 0!ioloop->ioloopingnew_to->msecs > 0ioloop.c:868I/O leak: %p (%s:%u, fd %d)ioloop->io_pending_count == 0Timeout leak: %p (%s:%u)IO wait timer leak: %s:%uRaw backtrace for leaks: %sret >= 0 && tv_r->tv_sec >= 0 && tv_r->tv_usec >= 0msecs == 0 || timeout->msecs > 0 || timeout->one_shotTime moved backwards by %lld.%06lld seconds.(io->condition & IO_NOTIFY) == 0BUG: No IOs or timeouts set. Not waiting for infinity.io->ioloop->io_pending_count > 0((*io)->condition & IO_NOTIFY) == 0io_loop_context_remove_callbacks() context not foundLeaked a t_pop() call in timeout handler %pLeaked a t_pop() call in I/O handler %ptimeout->next_run.tv_sec == 0 && timeout->next_run.tv_usec == 0(old_io->condition & IO_NOTIFY) == 0io_loop_find_fd_conditionstimeout_copyio_loop_move_io_toio_loop_context_pop_global_eventsio_loop_context_deactivateio_loop_context_activateio_loop_context_unrefio_loop_context_refio_loop_destroyio_loop_timeouts_start_newio_loop_handler_runio_loop_runio_loop_call_ioio_loop_handle_timeouts_realtimeout_get_wait_timeio_loop_get_wait_timetimeout_resetio_set_pendingio_remove_closedio_remove_fullio_add_fileio_add_toioloop-iolist.cio_add(0x%x) called twice fd=%d, callback=%p -> %pUID %s%s (UID %s)read(inotify) failed: %mevent->len < (size_t)retioloop-notify-inotify.cinotify_init() failed: %minotify_rm_watch() failed: %m(&ctx->inotify_fd)Inotify instance limit for user %s exceeded, disabling. Increase /proc/sys/fs/inotify/max_user_instancesread(inotify) returned partial eventinotify_add_watch(%s) failed: %mInotify watch limit for user exceeded, disabling. Increase /proc/sys/fs/inotify/max_user_watchesI/O notify leak: %p (%s:%u, fd %d)io_loop_notify_handler_deinitinotify_input_moreepoll_create(): %mclose(epoll) failed: %maddmodepoll_ctl(%s, %d) failed: %mdelioloop-epoll.cepoll_wait(): %mmsecs >= 0epoll_create(): %m (you may need to increase /proc/sys/fs/epoll/max_user_instances) - instead of '<file', try 'cat file|'epoll_ctl(add, %d) failed: %m (fd doesn't support epoll%s)array_idx_iio_loop_handler_run_internaljson-parser.cInvalid escape stringToken too large\b\f\n\r\t\"\u%04xparser->strinput != NULLInvalid unicode escape seenNULs not supported in stringsjson parserparser->strinput == NULLObject doesn't begin with '{'truefalseInvalid data as valueparser->data == parser->endExpected string as object keyExpected ':' after keyUnexpected data at the end!parser->skippingparser->highwater_offset <= cur_highwaterparser->highwater_offset < cur_highwaterHigh surrogate 0x%04x seen, but not followed by low surrogate\u0000 not supported in stringsInvalid unicode character U+%04xExpected ',' or '}' after object valueExpected ',' or '}' after array valueparser->state == JSON_STATE_OBJECT_COLON || parser->state == JSON_STATE_OBJECT_VALUE || parser->state == JSON_STATE_ARRAY_VALUE || parser->state == JSON_STATE_ARRAY_NEXTparser->state == JSON_STATE_OBJECT_NEXT || parser->state == JSON_STATE_OBJECT_OPEN || parser->state == JSON_STATE_ARRAY_NEXT || parser->state == JSON_STATE_ARRAY_OPENparser->state == JSON_STATE_OBJECT_COLON || parser->state == JSON_STATE_OBJECT_VALUE || parser->state == JSON_STATE_ARRAY_VALUE��X��X��X��X��X��X��X��X��X��X��X��X����X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X����X��X��X��X��X����X��X��X����X��X��X��X��X��X��X����X��X��X����X����(��`��������������������������������������`��������������������������������������������������������������������������������������������������������������������������������������`����������������������������0�����������������������P�����������p������������	����������	��������X��	�����@��X��	��@��json_strinput_destroyedjson_parse_next_streamjson_parse_skipjson_parse_skip_nextjson_parser_read_morejson_parse_denestjson_try_parse_nextjson_parse_nextjson treejson-tree.c��� ��8��`��������������������json_tree_find_child_withjson_tree_find_keynode->value_type == JSON_TYPE_OBJECTnode->value_type == JSON_TYPE_OBJECT || node->value_type == JSON_TYPE_ARRAYUnexpected exit - converting to abort
unlink(%s) failed: %m (in %s:%u)callbacks[i-1].priority == prioritylib.c!lib_initialized/dev/nullopen(/dev/null) failed: %mdup(/dev/null) failed: %m(&dev_null_fd)lib_deinitlib_initlib_atexit_prioritylib-event.c:126lib-event.clib-event.c:877event->refcount > 0GROWING-eventevent != current_global_eventevent == current_global_eventreason->event->refcount == 1module[0] != '\0'name[0] != '\0'field != NULLuser_cpu_usecs	%c%ld	%u	%jd	%ld	%uMissing required fieldsInvalid tv_created: %sUnregistered category: '%s'Invalid tv_last_sent: %sSource line number missingInvalid Source line numberField name is missingField value is missingField '%s' value '%s': %sField '%s' has too few valuesevent_import(%s) failed: %scategory == &internal->representativeevent_last_passthrough != NULLInvalid timeval seconds parameterTimeval missing microseconds parameterInvalid timeval microseconds parameterevent category parent mismatch detected: category %p internal %p (%s), internal parent %p (%s), public parent %p (%s)Can't create multiple passthrough events - finish the earlier with ->event()event != io_loop_get_active_global_root()event_reason_code_prefix(): Invalid module '%s'event_reason_code_prefix(): Invalid name_prefix '%s'event_reason_code_prefix(): name has ':' (%s, %s%s)event->log_message_callback == callbackevent->log_message_callback_context == contextInvalid field value '%s' number for '%s'Field '%s' has invalid count: '%s'Event %p leaked (parent=%p): %s:%ux:���9���9��x:���9���9���9���9���9���9��x:��x:���9���9���9���9���9���9���9���9���9���9���9���9��h:���9��:���9���9���9���9���9���9���9���9���9���9��X9���9���9���9���9�� 9��last_passthrough_eventevent_get_last_durationevent_strlist_copy_recursiveevent_unset_log_message_callbackevent_reason_code_prefixevent_reason_endevent_pop_globalevent_push_globalevent_unrefevent_refevent_find_categorysig_ioloop->refcount > 0lib-signals.csigemptyset(): %msigaction(%d): %msig_pipe_fd[0] != -1signals_expected > 0sis[i].si_signo > 0h->sig_ioloop != NULLsigfillset() failed: %msigprocmask() failed: %mread(sigpipe) failed: %mread(sigpipe) failed: EOFsis[i].si_signo != 0killkerneltimeraddress not mappedinvalid permissionsinvalid address alignmentnonexistent physical addressunknown %dhandler != NULLsignals_expected == 0close(sigpipe) failed: %msignal_ioloops == NULLobject-specific hardware errorTrying to set signal %d handler, but max is %dTrying to ignore signal %d, but max is %dsignal_handlers[signo] == NULLlib_signals_unset_handler(%d, %p, %p): handler not foundlib_signals_set_expected(%d, %p, %p): handler not found(h->flags & LIBSIG_FLAG_DELAYED) != 0(h->flags & LIBSIG_FLAG_IOLOOP_AUTOMOVE) == 0lib_signals_switch_ioloop(%d, %p, %p): handler not foundsignal: write(sigpipe) failed: lib_signals_deinitlib_signals_switch_iolooplib_signals_update_expected_signalslib_signals_ignorelib_signals_set_handlersignal_shadowsignal_handle_shadowedsignal_readlib_signals_init_iolib_signals_ioloop_unrefset->throttle_at_max_per_interval > 0set->unthrottle_at_max_per_interval > 0log-throttle.clog_throttle_initmd4memarea.cmemarea_empty.refcount > 0area->refcount > 0area != &memarea_emptymemarea_get_refcount(area) == 1memarea_get_refcountmemarea_free_without_callbackmemarea_unrefmemarea_refmemarea_init_emptymemarea_initold_size < min_sizemempool.cexp_size >= min_sizepool_get_exp_grown_sizemempool-allocfree.cblock->block == memapool->total_alloc_count > 0realloc(block, %zu)apool->refcount > 0(uintptr_t)mem >= SIZEOF_POOLBLOCK(block->prev == NULL || block->prev->next == block) && (block->next == NULL || block->next->prev == block)apool->total_alloc_used >= block->sizeapool->total_alloc_used == 0 && apool->total_alloc_count == 0pool_allocfree_refpool_allocfree_unrefpool_block_attachpool_block_detachpool_allocfree_clearalloconlysize > SIZEOF_POOLBLOCKmempool-alloconly.csize <= SSIZE_T_MAXblock_alloc(%zu): Out of memorynew_apool->block->prev == NULLpool->v == &static_alloconly_pool_vfuncspool_alloconly_get_total_alloc_sizepool_alloconly_get_total_used_sizeblock_allocpool_alloconly_createdpool->refcount >= 0mempool-datastack.cpool_data_stack_free(): stack frame changedpool_data_stack_malloc(): stack frame changedpool_data_stack_ref(): stack frame changedpool_data_stack_unref(): stack frame changedpool_data_stack_realloc(): stack frame changedpool_data_stack_unrefsystemmempool-system.cpool_system_clear() must not be calledpool_system_malloc(%zu): Out of memoryold_size == SIZE_MAX || mem == NULL || old_size <= malloc_usable_size(mem)pool_system_realloc(%zu): Out of memorypool_system_reallocunsafe data stackmkdir-parents.cfchown(%s, %ldfchmod(%s) failed: %mmkdir-parents.c:128mkdir_chown_full*length > 0 && *length < SSIZE_T_MAXmmap-util.cmmap_filelib_pluginGDBdlclose(%s) failed: %mmodule-dir.c:544module-dir.c:565module-dir.c:578.somodule-dir.c:504module loadermodule-dir.c:429module-dir.c:317module-dir.c:452dlopen() failed: %s_version_deinit_preinit_binary_dependency%s binarybinaries: %s (we're %s)_dependencies (you must set: %s=$%s %s)Module loaded: %sCouldn't load plugin %s: %sPlugin %s must be loaded alsomodule %s: dlsym(%s) failed: %sLoading modules from directory: %sMultiple files for module %s: %s/%s, %s/%sSkipping module %s, because dlopen() failed: %s (this is usually intentional, so just ignore this message)Module doesn't have %s functionCan't load plugin %s: Plugin is intended to be used only by Couldn't load required plugin %s: %sPlugin '%s' not found from directory %sModule is for different ABI version %s (we have %s)/etc/mtabsetmntent(%s) failed: %mswaprootfssocket() failed: %mnet.cnet_disconnect() failed: %msocket(%s) failed: %mbind(%s) failed: %mlisten() failed: %mlen <= SSIZE_T_MAXbind(%s, %u) failed: %mnet.c:945%s%s%s:%uerror != 0tcpgetsockopt(SO_PEERCRED) failed: %mnet_connect_ip(): ip->family != my_ip->familyIPADDR_IS_V6(ip) == IPADDR_IS_V6(net_ip)net_is_in_networknet_gethosterrornet_getpeernamenet_getsocknamenet_receivenet_acceptnet_listen_unix_unlink_stalenet_listen_unixnet_listen_fullnet_connect_unixnet_try_bindnet_connect_ip_once

nfs_flush_chown_uid: stat(%s) failed: %mnfs_flush_chown_uid: chmod(%s, %04o) failed: %mnfs_flush_fcntl: fcntl(%s, F_RDLCK) failed: %mnfs-workarounds.c:372nfs-workarounds.c(flags & O_CREAT) == 0nfs_flush_attr_cache_unlockednfs_safe_open!_stream->finishedaborted writing!_outstream->finishedinstream->stream_errno == 0outstream->stream_errno == 0!instream->blocking!outstream->blockinginstream->stream_errno != 0outstream->stream_errno != 0src->stream_errno != 0_stream->parent != NULLoutput stream %s is missing error handlingOutput stream buffer was full (%zu bytes)stream->real_stream->error_handling_disabled!i_stream_have_bytes_left(instream)(outstream->offset - old_outstream_offset) == (instream->v_offset - old_instream_offset)nsend-istream: read(%s) failed: %s!stream->real_stream->finished���@���p���л���o_stream_flush_parento_stream_copy_error_from_parenti_stream_read_moreo_stream_pwriteo_stream_nsend_istreamo_stream_send_istreamo_stream_sendv_into_stream_seeko_stream_flusho_stream_close_fullfile_ostream.close(%s) failed: %m(size_t)ret2 == new_iov.iov_lenret < 0 || !fstream->file || (size_t)ret == total_size(size_t)ret == total_size || !fstream->filesize <= foutstream->buffer_sizeostream-file.clseek() failed: %mlseek() returned wrong valueret2 != 0iov_count > 0size <= usedsize <= fstream->tailpos < fstream->tail!set(size_t)ret <= total_sizesendfile() failed: %mret <= 0instream->seekableIS_STREAM_EMPTY(foutstream)in_offset <= in_limito_stream_file_corko_stream_file_update_bufferi_stream_read_bytesio_stream_copy_backwardsio_stream_copy_same_streamio_stream_sendfileo_stream_file_writev_fullupdate_buffero_stream_file_sendvo_stream_file_writevmstream->parent->real_stream->callback == (stream_flush_callback_t *)o_stream_multiplex_flushostream-multiplex.c(size_t)ret == 1 + 4 + amto_stream_multiplex_sendvo_stream_multiplex_try_destroyget_channelo_stream_multiplex_add_channel(/dev/null)o_stream_create_rawlogiov[0].iov_len > 0ostream-unix.c(&ustream->write_fd)o_stream_unix_write_fdo_stream_unix_closeo_stream_unix_writevo_stream_create_unixwostream->output_ready != NULLwostream->output->stream_errno != 0wostream->ostream.ostream.closedwostream->output_finish != NULLwostream->ostream.ostream.stream_errno != 0wostream->flush_ioloop == NULLio_loop_have_ios(ioloop) || io_loop_have_immediate_timeouts(ioloop)wostream->buffer == NULL || wostream->buffer->used == 0wrapper_ostream_is_empty(wostream)ret < 0 || ostream->stream_errno == 0 || ostream->closedret >= 0 || ostream->stream_errno != 0!stream->ostream.blocking || sent == size*size_r == wostream->ostream.ostream.offsetwostream->pending_error == NULLostream-wrapper.cwostream->output != NULL!wostream->output_closed!wostream->output_finished!wostream->flush_waitingwostream->wait_begin != NULLwostream->wait_end != NULLWaiting for output flushCan now flush outputiov_pos == 0iov_pos < niov.iov_len(size_t)sent <= niov.iov_lenwostream->ostream.finished!stream->ostream.blockingi < iov_count*iov_idx_pos < iov_lensent <= sizeostream->stream_errno != 0wostream->output == NULLwrapper_ostream_set_errorwrapper_ostream_output_availablewrapper_ostream_get_buffered_sizewrapper_ostream_continuewrapper_ostream_corkwrapper_ostream_addwrapper_ostream_sendv_realwrapper_ostream_copy_parent_errorwrapper_ostream_output_finishwrapper_ostream_finishwrapper_ostream_flush_waitwrapper_ostream_output_readywrapper_ostream_writevwrapper_ostream_writev_fullwrapper_ostream_flush_bufferwrapper_ostream_flush_parentwrapper_ostream_flush_realwrapper_ostream_flushwrapper_ostream_flush_pendinggetcwd() failed: %mpath-util.cnpath_r != NULLnpath[0] == '/'npath_pos >= npathnpath_pos > npathlstat() failed: %mToo many symlink dereferencesnpath_link >= npath_posreadlink() failed: %mResulting path is too longnpath_link >= npathNot a directory: %sroot != NULLdir_r != NULLabspath_r != NULLt_abspath(%s) failed: %s(size_t)((npath_pos - npath) + 1) < asize(size_t)((npath_pos - npath) + seglen) < asize(size_t)((npath_pos + 1 - npath) + ltlen) < asize(size_t)((npath_link - npath) + lsize) < asize(size_t)((npath_pos - npath) + 1 + tlen) < asize(size_t)((npath_link - npath) + ret + tlen) < asize(size_t)(npath_pos - npath) < asizeFailed to get working directory: Could not find the wanted executable from PATHPATH environment variable undefinedt_readlinkt_get_working_dirt_abspath_tot_abspatht_realpath_tot_normpath_topath_normalizepkcs5.c%C�	 @� @	�+# @�����Duplicate %% flag '%c' starting at #%u in '%s'Too large minimum field width starting at #%u in '%s'Too large precision starting at #%u in '%s'Missing %% specifier starting at #%u in '%s'Unsupported 0x%02x specifier starting at #%u in '%s'sudcixXpoeEfFgGaA%%n modifier used%%m used twice(size_t)(p - fmt) < INT_MAXprintf-format-fix.cp[0] == '%' && p[1] == 'm'fix_format_realseteuid(%s) failedprocess-stat.cread(%s) returned EOF%s is larger than expected/proc/self/statrchar: wchar: syscr: syscw: /proc/self/iononvoluntary_ctxt_switches:	/proc/self/statusread_filemalloc() failed: %mmemblock == memblock_endprocess-title.cargv[0] != NULLprocess_name != NULLprocess-title.c:159process_title_setproctitle_hack_initargv_dupitems[idx1]->idx == idx1priorityq.citems[idx2]->idx == idx2idx < countarray_idx_ipriorityq_remove_idxheap_items_swapheap_item_bubble_up/dev/urandomopen(/dev/urandom) failed: %mgetrandom() failed: %mread(/dev/urandom) failed: %minit_refcount > 0randgen.csize < SSIZE_T_MAXDOVECOT_SRAND(&urandom_fd)open(/dev/urandom) failed: doesn't exist,currently we require itread(/dev/urandom) failed: EOFDOVECOT_SRAND is not available in non-debug buildsrandom_deinitrandom_fillupper_bound > 0rand.ci_rand_limitgetgroups() failed: %mtarget_uid > 0restrict-access.cseteuid(0) failed: %msetgid(%sinitgroups(%s, %s) failed: %mgetgrnam(%s) failed: %msetgroups() failed: %mchroot(%s) failed: %mchdir(/) failed: %mchdir(%s) failed: %msetuid(%s) failed with euid=%s: %m (ulimit -u reached)GID 0 isn't permittedrestrict-access.c:315RESTRICT_USERRESTRICT_CHROOTRESTRICT_SETUIDRESTRICT_SETGIDRESTRICT_SETGID_PRIVRESTRICT_SETEXTRAGROUPSRESTRICT_GID_FIRSTRESTRICT_GID_LASTInvalid uid: %sInvalid gid: %sInvalid privileged_gid: %sInvalid first_valid_gid: %sInvalid last_value_gid: %sPR_SET_DUMPABLE!process_using_priv_gidsetegid(primary) failed: %m) failed with euid=%s, gid=%s, egid=%s: %m (This binary should probably be called with process group set to %s instead of %s)setresgid(%s,%s,%s) failed with euid=%s: %munknown group name in extra_groups: %ssetgroups(%s) failed: Too many extra groups(This binary should probably be called with process user set to %s instead of %s)We couldn't drop root privilegesThis process must not be run as rootWe couldn't drop root group privileges (wanted=%s, gid=%s, egid=%s)prctl(PR_SET_DUMPABLE) failed: %mprctl(PR_GET_DUMPABLE) failed: %msetegid(privileged) failed: %mrestrict_access_use_priv_gidrestrict_accesssetrlimit(RLIMIT_DATA, %llu): %msetrlimit(RLIMIT_AS, %llu): %msetrlimit(RLIMIT_NPROC, %llu): %msetrlimit(RLIMIT_NOFILE, %llu): %mgetrlimit(RLIMIT_CORE) failed: %mgetrlimit(RLIMIT_NPROC) failed: %mgetrlimit(RLIMIT_NOFILE) failed: %mgetrlimit(RLIMIT_AS): %mlstat() failed for %s: %mCan't create directory %s: %mopen() failed for %s: %mfstat() failed for %s: %mNot a directory %sfchown() failed for %s: %mchmod() failed for %s: %mclose() failed for %s: %mlstat() check failed for %s: %msafe_mkdir() failed: %s (%o) is still not mode %osafe_mkdir() failed: %s (%s, %s) is still not owned by %s.%ssafe-mkstemp.csafe_mkstemp_fullsendfile-util.csafe_sendfileseq-range-array.cidx1 < countrange->seq2 >= range->seq1seq-range-array.hidx+1 < countdata[idx].seq1 >= seq1range[0].seq1 >= min_seqmin_seq == max_seqi == countn >= iter->prev_n!seq_range_is_overflowed(array)idx < count && data[idx].seq1 >= seqdata[idx].seq1 > seq || data[idx].seq2 < seqrange->seq1 > 0 || range->seq2 < (uint32_t)-1UINT_MAX - remove_count >= seq_range_length(&data[idx2])UINT_MAX - full_count >= countUINT_MAX - full_count >= remove_countUINT_MAX - seq_count >= seq_range_length(range)range[count-1].seq2 <= max_seqseq_range_array_iter_nthseq_range_array_invertseq_range_countseq_range_array_intersectseq_range_array_remove_seq_rangeseq_range_lengthseq_range_array_remove_rangeseq_range_array_removearray_append_array_iseq_range_array_add_range_internalseq_range_lookupseq_range_array_add_slow_pathseq_range_array_add%u,seq-set-builder.c%u:builder->last_seq_pos > builder->prefix_lengthseqset_builder_create_or_merge_rangesha1"�(ט/�B�e�#�D7q/;M�����ۉ��۵�8�H�[�V9����Y�O���?��m��^�B���ؾopE[����N��1$���}Uo�{�t]�r��;��ހ5�%�ܛ�&i�t��J�i���%O8�G��Ռ�Ɲ�e��w̡$u+Yo,�-��n��tJ�A�ܩ�\�S�ڈ�v��f�RQ>�2�-m�1�?!���'����Y��=���%�
�G���o��Qc�pn
g))�/�F�
�'&�&\8!.�*�Z�m,M߳��
8S�c��Ts
e��w<�
jv��G.�;5��,r�d�L�迢0B�Kf�����p�K�0�T�Ql�R�����eU$��* qW�5�ѻ2p�j��Ҹ��S�AQl7���LwH'�H�ᵼ�4cZ�ų9ˊA�J��Ns�cwOʜ[�����o.h���]t`/Coc�xr��xȄ�9dnj(c#����齂��lP�yƲ����+Sr��xqƜa&��>'��!Ǹ������}��x�n�O}��or�g���Ȣ�}c
�
���?G5q�}#�w�(�$�@{��2���
��<L
��gC�B>˾��L*~e��)Y��:�o�_XGJ�Dl�/�B�D7q����۵�[�V9��Y��?��^����[���1$�}Ut]�r��ހ�ܛt�i��G��Ɲ�̡$o,�-��tJܩ�\ڈ�vRQ>�m�1��'��Y����G���Qc�g))�
�'8!.�m,M
8STs
e�
jv.��,r��迢Kf�p�K£Ql���$�օ5�p�j��l7LwH'���4�9J��NOʜ[�o.htoc�xxȄnj�����lP������xq�ctx->byteIndex < 8sha3.cctx->byteIndex == 8ctx->byteIndex == 0memcmp(&t, buf, 8) == 0sha3-512sha3-256ctx->wordIndex < sizeof(ctx->s) / sizeof(ctx->s[0])ctx->byteIndex == 0 && tail < 8sha3_loop

	
$-7)8+>'=,���������������	����	��
���������������
�
�������������nanosleep(): %msample_count > 0stats-dist.cstats_dist_init_with_size�?:�0�yE>str[len] == '\0'ret2 == retstr_vprintfastr_new_conststr-find.ckey_len < INT_MAXj + size < key_lenj <= sizestr_find_morestr_find_initlen >= initial_posstr-sanitize.cmax_cps > 0…i <= max_bytesc <= max_charsstr_sanitize_skip_start_utf8str_sanitize_skip_startstr_sanitize_append_utf8str_sanitize_truncate_charstr-table.cstr_table_unrefstr_table_ref	count < alloc_countstrescape.c	
`���8�������������������������������P���@�����������Б�������������������������������Ȓ��p_strsplit_tabescaped_inplacemax_chars < INT_MAXstrfuncs.c*separators != '\0'array[count] == NULLmax_chars != SIZE_MAXi < bufsizepos >= 0(const char *) start <= (const char *) end(unsigned int)ret == *size_r-1accept != NULL || accept_len == 0reject != NULL || reject_len == 0PTR_OFFSET(ret, size) == (void *)parray_idx_idec2str_bufp_strarray_dupsplit_str_slowsplit_str_fastsplit_stri_memcspni_memspnt_str_ucaset_str_lcaset_strconcatt_strndupt_strdup_untilp_strconcatvstrconcatt_noalloc_strdup_vprintfp_strndupp_strdup_untili_snprintfNot a valid numberNumber too smallNumber too largebufsize <= STRFTIME_MAX_BUFSIZEtime-util.cgettimeofday() failed: %musecs_diff >= 0new_start_time != (time_t)-1time-util.c:152strftime_realtime_to_local_day_starttimeval_cmp_marginnet_listen_unix(%s) failed: %mchown(%s, %s, %s) failed: %munix-socket-create.cunix_socket_createunlink-directory.c(&dir_fd)fchdir%s(%s) failed: %mopendir(.) (in %s) failed: %mreaddirlstatrmdir.nfsunlink%s(%s/%s) failed: %mclosediropen(%s, O_RDONLY | O_NOFOLLOW) failed: %mCould not get working directory in unlink_directory(): %sCan't preserve current directory %s: open(.) failed: %munlink_directory(%s): Can't fchdir() back to our original dir %s: %munlink_directory_runlink_directoryunlink-old-files.c:69unlink-old-files.c(count) < INT_MAXunichar.clen == 1uni_is_valid_ucs4(chr)������`��P��@��0�����uint16_finduni_ucs4_to_utf8_c� uni_utf8_get_char_n�    '1D 41D 23D 4AAAAAA
C'EEEEIIIINOOOOOUUUUYAAA(CCCCDEEEE(EGGGG'HIIII(IIJJK'LL'LL�NN'N�nOOORR'RSSS'ST'TUUUU
UU(WYYZZZOUAIOU�����&�GKO(��jGN���AAEEIIOORRUUS&T&HAE'��O.Y   
 (   E ��������������#t��-###'+e�'S'THT'UJT'tHt�tJt�T�T�T(	<	0	<	3	<		<		<		<		<	!	<	"	<	+	<	/	<	�	�	�	�	�	�	�	�	�	�	2
<
8
<

<

<

<
+
<
GVG>GW!<"<��������FV����������F
>
G
>
F
W
�
�
�
�
�
�
�
�
M2������B�L�Q�V�[�@�qrqt��������q�������������%.55	55
55:5<5>5?5B5A%BB#B1�DD#D1D'D-E-E0(FGHH#HH'H.I0�KK#K1L#6L1L-MMM#NN#N1N-��LLPPRR#ZR1SS#Z`bTT#T1T-U$U0U-hjVV#WWWWW#XXYZZ#Z1h1tw
y
a�A#A	���	��	�E#E	E���	��I	I#O#O	���	�����	��#U#U	���	��#YY#Y	Y��		B	B����()()(B)B��89898B9B��HIHI�PPPB�YYYB��hihihBiBE	E
EEE
EEE(E)E*E+E,E-E.E/EhEiEjEkElEmEnEoEpE�E�B�E����E   B�BtE�E�B�E���E���B��B�B������B���B�B�����|E�E�B�E���E  3.....2 2 2 2 2 5 5 5 5 5 !! ???!!?2 2 2 2 Rsa/ca/s�Cc/oc/u�FNoSMTELTMFAX1D 71D 91D 101D 32D 31D 52D 53D 54D 51D 65D 61D 83D 85D 87D 81D IIIIIIVVIVIIVIIIIXXIXII0D 3�!8�!8�!8�!8�!8�!8"8"8"8#"8%"8+"+"+"+"+"."."."."."<"8C"8E"8H"8=8a"8M"8<8>8d"8e"8r"8s"8v"8w"8z"8{"8�"8�"8�"8�"8�"8�"8�"8�"8|"8}"8�"8�"8�"8�"8�"8�"81011121314151617181920(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)1.2.3.4.5.6.7.8.9.10.11.12.13.14.15.16.17.18.19.20.(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)+"+"+"+"::======�*8K0�0M0�0O0�0Q0�0S0�0U0�0W0�0Y0�0[0�0]0�0_0�0a0�0d0�0f0�0h0�0o0�0o0�0r0�0r0�0u0�0u0�0x0�0x0�0{0�0{0�0F0�0 �0 �0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0()()()()()()(	)()()()()()()()(a)(a)(a)(a)(a)(a)(	a)(a)(a)(a)(a)(a)(a)(a)(n)(ie�)(in)(N)(�N)(	N)(�V)(�N)(mQ)(N)(kQ)(]N)(AS)(g)(kp)(4l)((g)(ё)(W)(�e)(*h)(	g)(>y)(
T)(yr)(��)(]y)(�R)(�N)(|T)(f[)(�v)(O)(nj)(TS)(my)(O)(�)(�)PTE212223242526272829303132333435aaaaaa	aaaaaaaaa�intn3637383940414243444546474849501g2g3g4g5g6g7g8g9g10g11g12gHgergeVLTD�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�00�p1�p2�p3�p4�p5�p6�p7�p8�p9�p10�p11�p12�p13�p14�p15�p16�p17�p18�p19�p20�p21�p22�p23�p24�phPadaAUbaroVpcdmdm�dm�IUs^b-f�T'Yckf�l*h_O>ypAnA�AmAkAKBMBGBcalkcalpFnF�F�gmgkgHzkHzMHzGHzTHz�!m!d!k!fmnm�mmmcmkmmm�cm�m�km�mm�cm�m�km�m"sm"s�PakPaMPaGParadrad"srad"s�psns�smspVnV�VmVkVMVpWnW�WmWkWMWk�M�a.m.BqcccdC"kgCo.dBGyhaHPinKKKMktlmlnloglxmbmilmolPHp.m.PPMPRsrSvWbV"mA"m1�e2�e3�e4�e5�e6�e7�e8�e9�e10�e11�e12�e13�e14�e15�e16�e17�e18�e19�e20�e21�e22�e23�e24�e25�e26�e27�e28�e29�e30�e31�egalfffiflffiffltsttvtetk~vtm��������I��I������������������������������������������������������������&'&'&�&�&H&H&�&�&�&�&�&�&�&�&�&I&I&I&,&-&E&I&J(,(-(.(E(I(J*,*-*.*E*I*J+,+E+I+J,-,E-,-E.,.-.E3,3-3.3E5-5E6,6-6.6E7-7E8E9,9E:,:EA,A-A.AEAIAJB-BEBIBJC'C,C-C.CDCECICJD,D-D.DEDIDJE,E-E.EEEIEJF,F-F.FEFIFJG,GEGIGJJ,J-J.JEJIJJ0p1pIp LQ MQ NQ OQ PQ Qp&1&2&E&F&I&J(1(2(E(F(I(J*1*2*E*F*I*J+1+2+E+F+I+JAIAJBIBJC'CDCECICJDEDIDJE'EEF1F2FEFFFIFJIpJ1J2JEJFJIJJ&,&-&.&E&G(,(-(.(E(G*,*-*.*E*G+E,-,E-,-E.,.E3,3-3.3E5-5.5E6,6-6.6E7-8E9,9E:,:EA,A-A.AEB-BEC,C-C.CDCED,D-D.DEDGE,E-E.EEF,F-F.FEFGG,GEGpJ,J-J.JEJG&E&G(E(G*E*G+E+G3E3G4E4GCDCEDEFEFGJEJG@NQ@OQ@PQ7I7J9I9J:I:J3I3J4I4J-I-J,I,J.I.J5I5J6I6J4,4-4.4E413151617I7J9I9J:I:J3I3J4I4J-I-J,I,J.I.J5I5J6I6J4,4-4.4E413151614,4-4.4E3G4G7E3,3-3.4,4-4.7E8E'K'K*,E*-,*-,*-E*.E*E,*E-*E.,E-,E--EJ-EI3-,3,-3,I3E-3E-3E,3EE3EE5--5--5EE4-E4-E4,J4E.4E.4EE4EE6-I6.E6.E7E-7E-7EE7EJ9,E9EE9EE9EI:EE:EJ:EIA.EA.EBE-BEED-ED-JD-ID,,D,,D.ED.EDE-DE-E-,E-EE-JE,-E,EE.,E.EE,.GE,GEEF-EF-IF,EF,EF,IFEJFEIJEEJEE(.J*,J*,I*.J*.I*EJ*EI,EJ,-I,EI3.I5-J4-J6-JD,JDEJJ-JJ,JJEJEEJBEJF-JBE-D-E9EJCEJF,-E.JD,ECEED,EF,-,-J-,JE,JAEJ(-JCEE9,E5EE3.JF,J5D�BD�'DDG'C(1E-E/5D9E13HD9DJGH3DE5DI5DI 'DDG 9DJG H3DE,D ,D'DG1�'D K@K L M N@N O@O P@P Q@Q R@RD"D"D#D#D%D%D'D'������1'2'G>GW����������W�e�X�e�_�n�_�o�_�p�_�q�_�r���e���e���n���n���o���o�0.0,1,2,3,4,5,6,7,8,9,(A)(B)(C)(D)(E)(F)(G)(H)(I)(J)(K)(L)(M)(N)(O)(P)(Q)(R)(S)(T)(U)(V)(W)(X)(Y)(Z)0S0CDWZHVMVSDSSPPVWCMCMDDJ{0K0�0�00,g00	N00�N00�[00�p00Sb00�v00�R00We0	!$'*-0369<?BEHKNQTWZ]`cfilorux{~������������������������������������������� #&),/258;>ADGJMPSVY\_behknqtwz}�������������������������������������������

"%(+.147:=@CFILORUX[^adgjmpsvy|������������������������������������������	!$'*-0369<?BEHKNQTWZ]`cfilorux{~������������������������������������������� #&),/258;>ADGJMPSVY\_behknqtwz}�������������������������������������������

"%(+.147:=@CFILORUX[^adgjmpsvy|������������������������������������������	!$'*-036:=ADHKNQTW\_cgjnrux{�����������������������������������"%(+.147:=@CFILORUX[^adgjmpsvy|��������������������������������

#'+/37;?CGKOSW[_cgkosw{��������������������������������������										 	#	&	)	,	/	2	5	8	;	>	A	D	G	J	M	P	S	V	Y	\	_	b	e	h	k	n	q	t	x	|	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	







"
&
*
.
2
6
:
>
B
F
J
N
R
V
Z
^
b
f
j
n
r
v
z
~
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
 #&),/258;>ADGKOSVZ]afkpty}���������������������������
"(,17;>AGLRV\_cgkosx|��������������������������������

	






!
%
)
-
1
5
9
=
A
E
H
K
O
R
U
X
\
`
c
f
i
l
o
t
w
z
}
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�

"%(+.147:=@CFILORUZ]`chlorux{~�������������������������������������#'+/369<@DGJMPSVY\_behknqtwz}�������������������������������������������

"%(+.147:=@CFILORUX[^adgjmpsvy|������������������������������������������	"&*-0369<?BEHKNQTWZ]`cfilorux{~������������������������������������������� #&),/258;>ADGJMPSVY\_behknqtwz}������������������������������������������

"%(+.147:=@CFILORUX[^adgjmpsvy|�������������������������������������#'+/37;?CGKOSW[_cgkosw{��������������������������������#'+/37;?CGKOSW[_cgkosw{���������������������������

"%(+.147:=@CFILORUX[^adgjmpsvy|���������������������������������	"%)-159=AE���������������������������������
 "$(*,.02469;=?CEGILNPTVXZ\^`bdhjlnprtvxy{}������������������������
&(*,.02������Dz���������������
v������������������"#$%&uvwx���)	1	4	X	Y	Z	[	\	]	^	_	�	�	�	�	�	3
6
Y
Z
[
^
HKL\]����H�����J
K
L
�
�
�
�
3���CMRW\isuvwxy�������&
;=@AC
 "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~�������������������������������������������������������������	

()*+,-./89:;<=>?HIJKLMPRTVY[]_hijklmno������������������������������������������������������������������������ % & 3 4 6 7 < > G H I W � !!!!!	!! !!!"!;!P!Q!R!S!T!U!V!W!X!Y!Z![!\!]!^!_!a!b!c!e!f!g!h!j!k!�!�!�!�!�!�!�!"	""$"&","-"/"0"A"D"G"I"`"b"m"n"o"p"q"t"u"x"y"�"�"�"�"�"�"�"�"�"�"�"�"�"�"�"�"�"�"i$j$k$l$m$n$o$p$q$r$s$t$u$v$w$x$y$z${$|$}$~$$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$*t*u*v*�*L0N0P0R0T0V0X0Z0\0^0`0b0e0g0i0p0q0s0t0v0w0y0z0|0}0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0222222222	2
222
222222222222222222 2!2"2#2$2%2&2'2(2)2*2+2,2-2.2/202122232425262728292:2;2<2=2>2?2@2A2B2C2P2Q2R2S2T2U2V2W2X2Y2Z2[2\2]2^2_2n2o2p2q2r2s2t2u2v2w2x2y2z2{2|2}2~2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2333333333	3
333
3333333333333333333 3!3"3#3$3%3&3'3(3)3*3+3,3-3.3/303132333435363738393:3;3<3=3>3?3@3A3B3C3D3E3F3G3H3I3J3K3L3M3N3O3P3Q3R3S3T3U3V3W3X3Y3Z3[3\3]3^3_3`3a3b3c3d3e3f3g3h3i3j3k3l3m3n3o3p3q3r3s3t3u3v3w3x3y3z3{3|3}3~33�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3��������������*�+�,�-�.�/�0�1�2�3�4�5�6�8�9�:�;�<�>�@�A�C�D�F�G�H�I�J�K�L�M�N�O�����������������������������������	�
���
������������������� �!�"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�:�;�<�=�>�?�@�A�B�C�D�E�F�G�H�I�J�K�L�M�N�O�P�Q�R�S�T�U�V�W�X�Y�Z�[�\�]�^�_�`�a�b�c�d�e�f�g�h�i�j�k�l�m�n�o�p�q�r�s�t�u�v�w�x�y�z�{�|�}�~������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������	�
���
������������������� �!�"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�:�;�<�=�P�Q�R�S�T�U�V�W�X�Y�Z�[�\�]�^�_�`�a�b�c�d�e�f�g�h�i�j�k�l�m�n�o�p�q�r�s�t�u�v�w�x�y�z�{�|�}�~�������������������������������������������������������������������������������������������������������������������������������������������������������������p�q�r�t�v�w�x�y�z�{�|�}�~���������������������./KL�����^�_�`�a�b�c�d����������������������	�
����������������� �!�"�#�$�%�&�'�(�)�*�-�.�J�K�L�M�N�O�j�k�����@�A�B�C�D�E�F�G�H�ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefgijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzACDGJKNOPQSTUVWXYZabcdfhijklmnpqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABDEFGJKLMNOPQSTUVWXYabcdefghijklmnopqrstuvwxyzABDEFGIJKLMOSTUVWXYabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz17�������������������������"�������������������������"�������������������������������"�������������������������"�������������������������������"�������������������������"�������������������������������"�������������������������"�������������������������������"�������������������������"��������01234567890123456789012345678901234567890123456789'(,/H2-7JCDEF39A5B14*+.068:n��o(,G-JCDEF39A5B4*+.6:,-JDF395B4.6:�o(,G-7JCEF39A5B4*+.68:n�'(,/GH2-7JDEF39A5B14*+.068:(,/H2-7JDEF39A5B14*+.068:CRABCDEFGHIJKLMNOPQRSTUVWXYZ�0KbW[�S�0�NY�)Y�N f!q�eMR�_�Q�eRB}u���X9To�bUcN	NJ��]-N�Scp�Sb�yzzT�n	gg3urR�UM��_�S=N8NAN"`O�O�OPzP�P�P�P�4:MQTQdQwQ�4gQ�QK�Q�Q�N�Q�Qߑ�QR�4;RFRrRwR5�R�R�R�RSSSISQSZSsS}SSSS,
pp�S�Sc�S�ST�T8THThT�T�TUSUcU�U�U�U�U�U�UWVWQVtVR�X�W�W
X�W2X1X�X��X�XYY"YbY���YZ'Z�YfZ�6�6[>[>[��[�[�[�[�[\S_"\�7`\n\�\�\�C]�n]k]|]�]�]/8�](^=^i^b8�!|8�^�^�^�^���^1#1#�"_"_�8�2�ab_k_�8�_�_�_�_�`:99�`�&�`HaLaNaLaza�a�a�a�a�a�a�abb]b�b�bPc+=c�bhc�c�c�+"d�c�c.:id~d�dwdl:Oele
0�e�fIf;�f;�:�Q�Qg�f���Cgg!g^gSg�3I;�g�gRh�hm4�hhi�;Bi�i�i�j�6�j<!k�8TkN<rk�k�k�k�:�:Nl�<�l�lglm>mwmAmimxm�m=4m/nnn3=�n�n�>�mno^?�?�o9ppp�=Jp}pwp�p%EqcB�q�C(r5rPrF�r�r5GHzs�s�>�s�>�>Gt\tqt�t�t?$u6L>u�Lpu�!v�O�ODP�?@�v�P�PQ3QwwwJw9@�wF@�@TNx�x�x�@&VVy�V�V�y�y/A@zJzOz|Y�Z�Z�zB�[�{�{'B�\�|�B�|�|}�_c}C�}~E~4C(bGbYC�bz>c����d#e`��ep�_3�C���D>��Z�g�g�3�3����kD�������R�������<k��c���#����W�S�ʃ̃܃6lkm�l+E����sd�,o]EaE�o�pkEP�\�g�i�������y�(�k����E���E`�c�gv׈ވ5F���4�xfy�F�F�����U��|�����w�/ˍ����Ԏ8�҅�����.��8�גؒ|���������I��w��IÖ�]#�E��nJvJ�
��J����)����3K)���™���K0��@����L�Lg�Π�L������VM�������;�����������	�
���
������������������� �!�"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�:�;�<�=�>�?�@�A�B�C�D�E�F�G�H�I�J�K�L�M�N�O�P�Q�R�S�T�V�W�X�Y�Z�[�\�]�^�_�`�a�b�c�d�e�f�g�h�i�j�k�l�m�n�o�p�q�r�s�t�u�v�w�x�y�z�{�|�}�~����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������	�
�
����������������� �!�"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�;�<�=�>�@�A�B�C�D�F�J�K�L�M�N�O�P�R�S�T�U�V�W�X�Y�Z�[�\�]�^�_�`�a�b�c�d�e�f�g�h�i�j�k�l�m�n�o�p�q�r�s�t�u�v�w�x�y�z�{�|�}�~���������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������	�
���
������������������� �!�"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�:�;�<�=�>�?�@�A�B�C�D�E�F�G�H�I�J�K�L�M�N�O�P�Q�R�S�T�U�V�W�X�Y�Z�[�\�]�^�_�`�a�b�c�d�e�f�g�h�i�j�k�l�m�n�o�p�q�r�s�t�u�v�w�x�y�z�{�|�}�~�����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������	�
���
������������������� �!�"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�:�;�<�=�>�?�@�A�B�C�D�E�F�G�H�I�J�K�L�M�N�O�P�Q�R�S�T�U�V�W�X�Y�Z�[�\�]�^�_�`�a�b�c�d�e�f�g�h�i�j�k�l�m�n�o�p�q�r�s�t�u�v�w�x�y�z�{�|�}�~����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������	�
���
�������������������!�"�$�'�)�*�+�,�-�.�/�0�1�2�4�5�6�7�9�;�B�G�I�K�M�N�O�Q�R�T�W�Y�[�]�_�a�b�d�g�h�i�j�l�m�n�o�p�q�r�t�u�v�w�y�z�{�|�~���������������������������������������������������������������������������������������������������������+�,�0�1�2�3�4�5�6�7�8�9�:�;�<�=�>�?�@�A�B�C�D�E�F�G�H�I������������������ �!�"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�:�;�P�Q����������	�
���
������������������� �!�"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�:�;�<�=�>�?�@�A�B�C�D�E�F�G�H�I�J�K�L�M�N�O�P�Q�R�S�T�U�V�W�X�Y�Z�[�\�]�^�_�`�a�b�c�d�e�f�g�h�i�j�k�l�m�n�o�p�q�r�s�t�u�v�w�x�y�z�{�|�}�~������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������	�
���
������������������� �!�"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�:�;�<�=�>�?�@�A�B�C�D�E�F�G�H�I�J�K�L�M�N�O�P�Q�R�S�T�U�V�W�X�Y�Z�[�\�]�^�_�`�a�b�c�d�e�f�g�h�i�j�k�l�m�n�o�p�q�r�s�t�u�v�w�x�y�z�{�|�}�~������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������	�
���
�����������������hfjry{�wyclsx��;�����A�BDE�GHIJKLMNO"PRTUWaPQbdeY[\gkmKoTptuov%�����iruv�����=RcU�\f_aehij{�m��qprstux�������z������������`���            .  0i456789+"=()n0123456789+"=()aeoxYhklmnpstC�gHHHh'IILlNPQRRRZ�ZK�BCeEFMo����i����"DdeijIVXLCDM0	0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0jVa-�k��N(N6N?NYN�N�N�N�N?QeQkQ�Q�Q�Q�Q�QR�R�RSS8SAS\SiS�S�S�S�S�VW�XY
YY'YsYP[�[�[\"\8\n\q\�]�]�]�]r^z^^�^�^__P_a_s_�_b6bKb/e4e�e�e�e�e�e�e�fg(g kbkyk�k�k�k�kll4lkp*r6r;r?rGrYr[r�r�s�s�t�tuu(u0u�u�uvv}v�v�v�v�w�w�w:y�y�ytz�z�zs|�|6Q�����3������������n�r�x�M�k�@�L�c�~���҉�7�F�U�x���d�p�����ʎ��������I�Ƒ̑ёw���������Q�^�b�i�˗�����ۘߘ��������ؚߚ%�/�2�<�Z��u������Þ͞ў������ �;�J�R������� 0ASDSES���������!	

abcdefghijklmnopqrstu`��������� "#')+,-./26@GL��WXY��������N�N	N�V
N-NN2uYNNN)Y0W�NOU|^�e�{	N�N	N�V�NmQNkQ]NASgkp4l(gёW�e*h	g>y
Tyr��]y�R�y7usYi�*QpS�l�O�Qck
N-NN�]�S;S�[f[�vOnjTSY�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0JLo�&S'�7�kR�H��fʎȌ�n2N�S����QYё�UHY�aiv�?�������jm�p�s=�j���NuSkr-��P]�oͅd��b؁��^gjm�rΐ�O�Q�R�d�jr�v��\��2�o����xy�}Ƀ��֊�X_`|~�br�xŒ���Xb\j�mo/}7~K��R���Q�Qz�}�u����bj��9N�[`�spuS�x�O�_
N�lxe"}�S^XwI����k���l�b��ceu�NiQ�Q�h�|o�Ҋϑ�RBTsY�^�e�o*y��j���Ξ�R�fwkb�t^�ab�d#oIq�t�y�}o�&��#�J�R�R�T�pˆ���^�_{c�k>|us�N�V�[�]`�sit�F�4���H���O�y�����`�N�P�[?\�ej�qBv��|����f.��R{g�gAm�n	tYukx}^�mQ.bx�+P]�m*��_Dah�s��)RTe\fNg�h�lt�uyψ�̑�?S�nT�q�t����W����g�m��z {�|�r�pX��N6�:RR�^�b�|�[m�f;�L�M����^@Q�UZXtf�Q*s�v<y^yey�yV��|����8������(���ސ���O�PMQ�R�RQS�UVhV@X�Xd\n\�`ha�a�aOe�e�f�hwmn"onq+r"t�x>yIyHyPyVy]y�y�y@z�z�{�}	~A~r��y�y�W�����9�ӌ���8����;�u`�B�&N�QhQ�OEQ�Q�R�R�UUU�U�UZX�XDYTYbZ([�^�^i_�_�`Naa�a`a�a4b�cdRdVetfggVgyk�kAm�n�n"opnq�w5r�r*sqtu;uvv�v�v�vJw@w�x�z�{{|[}�}>�R��y�A���������ˊ����9����8�r���v�|��V�ۗ���;����J(D(�3�;@9@IR�\�~C������������+qq{{{{~~~~����zzzzyyyy����������������������������������������������������������������������������������w����������II����,00:;!?00& %   __(){}0000
000	00
000[]> > > > ___,0.;:?! (){}00#&*+-<>=\$%@!""##$$%%&&&&''(((())****++++,,,,----....//0011223333444455556666777788889999::::AAAABBBBCCCCDDDDEEEEFFFFGGGGHHIIJJJJ!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`{|}~�)�)00
00�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0�0d1112131415161718191:1;1<1=1>1?1@1A1B1C1D1E1F1G1H1I1J1K1L1M1N1O1P1Q1R1S1T1U1V1W1X1Y1Z1[1\1]1^1_1`1a1b1c1������� %�!�!�!�!�%�%��������������@ACt~�����,-.0123456789:<=>?@ABCDEFGHIJKLMOPQRSTUVWXYZ[\]^_`abcdefghijx�������������������������������������������������         	 
  $ / _ p q t u v w x y z { | } ~  � � � � � � � � � � � � � � � � � � � � � � � � � � � � !!
!!!
!!!!!!!!!!!!!$!&!(!*!+!,!-!/!0!1!3!4!5!6!7!8!9!<!=!>!?!@!E!F!G!H!I!`!d!i!l!m!n!o!)#*#`$a$b$c$d$e$f$g$h$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$|,},o-�.�./////////	/
///
/////////////////// /!/"/#/$/%/&/'/(/)/*/+/,/-/.///0/1/2/3/4/5/6/7/8/9/:/;/</=/>/?/@/A/B/C/D/E/F/G/H/I/J/K/L/M/N/O/P/Q/R/S/T/U/V/W/X/Y/Z/[/\/]/^/_/`/a/b/c/d/e/f/g/h/i/j/k/l/m/n/o/p/q/r/s/t/u/v/w/x/y/z/{/|/}/~//�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/0608090:0112131415161718191:1;1<1=1>1?1@1A1B1C1D1E1F1G1H1I1J1K1L1M1N1O1P1Q1R1S1T1U1V1W1X1Y1Z1[1\1]1^1_1`1a1b1c1d1e1f1g1h1i1j1k1l1m1n1o1p1q1r1s1t1u1v1w1x1y1z1{1|1}1~11�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1�1D2E2F2G2`2a2b2c2d2e2f2g2h2i2j2k2l2m2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�2����p�����\�]�^�_����������	�
���
������������������� �!�"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�:�;�<�=�>�?�@�A�B�C�D�E�F�G�H�I�J�K�L�M�N�O�P�Q�R�S�T�U�V�W�X�Y�Z�[�\�]�^�_�`�a�b�c�d�e�f�g�h�i�j�k�l�m�n�o�p�q�r�s�t�u�v�w�x�y�z�{�|�}�~����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������	�
���
������������� �"�%�&�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�:�;�<�=�>�?�@�A�B�C�D�E�F�G�H�I�J�K�L�M�N�O�P�Q�R�S�T�U�V�W�X�Y�Z�[�\�]�^�_�`�a�b�c�d�e�f�g�h�i�j�k�l�m�p�q�r�s�t�u�v�w�x�y�z�{�|�}�~�������������������������������������������������������������������������������������������������������������������������������������������������������������� �!�"�#�$�%�&�'�(�)�P�Q�R�S�T�U�V�W�X�Y�Z�[�\�]�^�_�`�a�b�c�d�e�f�g�h�i�j�k�l�m�n�o�p�q�r�s�t�u�v�w�x�y�z�{�|�}�~����������������������������������������������������������������������������������������������������������������������������������������������0�1�2�3�4�5�6�7�8�9�:�;�<�=�>�?�@�A�B�C�D�G�H�I�J�K�L�M�N�O�P�Q�R�T�U�V�W�X�Y�Z�[�\�]�^�_�`�a�b�c�d�e�f�h�i�j�k������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������	�
���
������������������� �!�"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�:�;�<�=�>�?�@�[�\�]�^�_�`�a�b�c�d�e�f�g�h�i�j�k�l�m�n�o�p�q�r�s�t�u�v�w�x�y�z�{�|�}�~�������������������������������������������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~�������������������������������� ���������a�������23�����1o���������������������������������������������������������������������	

 !"#$%&'��������������������������������������������������������������������������������������������������������������������������������	�
���
������������������� �!�()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO�����������������������������������������������������������������������������������������������������������������������"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�:�;�<�=�>�?�@�A�B�C�
 "$&(*,.I2469;=?ACEGJLNPRTVXZ\^`bdfhjlnprtvy{}SC�������= ������������������������������������������
"$&(*,.02;~,,AFHJLNo,m,p,��������������������b,���n,��d,�����D��E������prv������������������������������������������������������������ !"#$%&'()*+,-./	

`bdfhjlnprtvxz|~������������������������������������������������������������
 "$&(*,.123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUV������!""*bJ�}�c,
 "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~�����������`������������������������������������������������	

()*+,-./89:;<=>?HIJKLMY[]_hijklmno�������������������������������������������������2!`!a!b!c!d!e!f!g!h!i!j!k!l!m!n!o!�!�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$,,,,,,,,,	,
,,,
,,,,,,,,,,,,,,,,,,, ,!,",#,$,%,&,',(,),*,+,,,-,.,`,:>g,i,k,r,u,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,����������������������������������������@�B�D�F�H�J�L�N�P�R�T�V�X�Z�\�^�`�b�d�f�h�j�l�����������������������������"�$�&�(�*�,�.�2�4�6�8�:�<�>�@�B�D�F�H�J�L�N�P�R�T�V�X�Z�\�^�`�b�d�f�h�j�l�n�y�{�~�������������������������������������������������������������������������������������������������������������������������!�"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4�5�6�7�8�9�:�	
!#%')+-/1357:<>@BDFHKMOQSUWY[]_acegikmoqsuwz|~����������������������������������������������������	
#%')+-/13<?@BGIKMOPQRSTVWY[\`acefhijkloqru}�����������Eqsw{|}����������������������������������������������������������0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_acegikmoqsuwy{}������������������������������������������������������������	
!#%')+-/abcdefghijklmnopqrstuvwxyz{|}~����������������������y}	
!#%')+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuwy{}������������������������������������������������������������ !"#$%&'01234567@ABCDEQSUW`abcdefgpqrstuvwxyz{|}�����������������������������������N!p!q!r!s!t!u!v!w!x!y!z!{!|!}!~!!�!�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$0,1,2,3,4,5,6,7,8,9,:,;,<,=,>,?,@,A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,[,\,],^,a,e,f,h,j,l,s,v,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,---------	-
---
------------------- -!-"-#-$-%-'---A�C�E�G�I�K�M�O�Q�S�U�W�Y�[�]�_�a�c�e�g�i�k�m�����������������������������#�%�'�)�+�-�/�3�5�7�9�;�=�?�A�C�E�G�I�K�M�O�Q�S�U�W�Y�[�]�_�a�c�e�g�i�k�m�o�z�|����������������������������������������S�p�q�r�s�t�u�v�w�x�y�z�{�|�}�~����������������������������������������������������������������������������������������������������������������������������������A�B�C�D�E�F�G�H�I�J�K�L�M�N�O�P�Q�R�S�T�U�V�W�X�Y�Z�	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~�������������������������������������������������������������������������������������������������������������������������������xUnexpected URI boundary after '%'Expecting hex digit after '%%', but found '%c'Expecting hex digit after '%%%c', but found '%c'Percent encoding is not allowed to encode NUL characterInvalid domain label in hostnamePath component contains invalid charactercount == array_count(&segments)Query component contains invalid characterFragment component contains invalid characterExpecting ']' at end of IP-literalFuture IP host address '%s' not supportedInvalid IPv6 host address '%s'str_len(host_name) > 0uri-util.cInvalid URI schemeEmpty IPv6 host addressInvalid host identifierInvalid port numberInvalid host portMissing schemeret <= 0 || relative == 0Fragment part not allowed*host_name != '\0'%%%02xhost_ip->family != 0host_ip->family == AF_INET6uri_append_host_ipuri_host_copyuri_parse_absolute_genericuri_parse_pathuri_do_parse_host_name$D%x%llx,dc=envUnknown variable '%%%s'UNSUPPORTED_VARIABLE_%sUnknown variable '%%%c'UNSUPPORTED_VARIABLE_%cvar != NULLvar-expand.cpkcs5roundstruncatesalthexucstart != NULLif*ptr->key != '\0'ptr->func != NULLCannot parse hash arguments:'%s' is not number for roundsCannot parse hash arguments:rounds must be at least 1Cannot parse hash arguments:'%s' is not number for truncbitsCannot parse hash arguments:'%s' is not supported formatCannot hash: PKCS5_PBKDF2 failedarray_idx_ivar_expand_unregister_func_arrayvar_expand_register_func_arrayvar_has_long_keyvar_expand_with_funcsif: requires four or five parameters, got %uif: Unsupported comparator '%s'==if: missing parameter(s)array_count(&params) == 5var-expand-if.c!=!*!~ops[i] != NULLif: %s (lhs) is not a numberif: %s (rhs) is not a numberif: regex failed: %sec == REG_NOMATCH������������������e����X��w��w��_��S��G��;��k��var_expand_if_str_to_compvar_expand_if_comparray_idx_ivar_expand_if;����8�ȵ���H7��Y7�p�j7���7�p�28�Թ�8�|��8�Ⱥ�8�h��8��[9�|�i9�4��9�H��9��	:��1:�l��:�4��:���;�h�;��l;�|��;���<��\<���<����<��==���=���>���C>�8�k>���>���>�l��>��6?��^?����?���N@�D��@���@� �A��>A�h��A����B�,�C��/C���WC��C���C�|��C���D���$D�\�)D���QD���yD���D�$��D��E�h�AE���iE�t��E��	F�8�YF���F�(��F�d�!G��IG���G�|�QI���I�8��I��iJ���J�L��K��IL�<�qL���L����L���L�,�M��9M����M��N�<�)N��QN��yN�\��N���N�,�)O�d�QO��yO�(��O���O�H�P��AP��iP���P��Q��?Q��gQ�`��Q�h�Q��/R�@WR��R���R�HS�GS�,�S��S��7T��_T��T��T� wU��U�LV���V�pW�/W�	WW�@	�W�t	�W�
GX�
_Y�
�Y�D�Y�'Z� OZ�wZ���Z�
�Z�@
�Z�
[��
?[�g[�H�[��[�\��\�d�]���^�d�^��'_�hO_���_�8`�x�`��a��a���a��Ub�}b�P�b���b�<Ec��c�@�c���c�!d�tqd��d��d�4�d�h�d��d���d�p%e�T^e��e�f�H �f� �f�$!g�!kg��!�g�@"�g�"�g�#h�T#[h��#�h�D$�h�h%i�p&4i��&�i�'�i�X(�i�)�i��)$j�x*5j�|+Cj� ,Qj�,_j�-�j�D-�j�.
k�/5k�1�k�H1�k�1�k�@2�l�t3�l�3�l��5m�(64m�7\m�7�m�<8�m�d9$n�D:tn�:�n�H;o�;<o��<do�D=�o�=�o�=�o�>p�p?,p�P@|p��@�p�XA�q�B�q�C.r�D�r��E�r�F�r��Fs�dG`s�G�s�DH�s��H�s�HIt��I[t�LJ�t�J�t��Ju�K-u�KUu�L}u�DL�u��M#v�$N3v�NNv�O�v�dO�v�Ow�P3w�\Q[w�Q�w�TR�w�R�w��R!x�S\x��S�x�T�x�T$y�Uty�V�y�W�y�@W�y�W�y�LXz�,Y0z��YFz�PZxz��Z�z�<[�z�\�z�\�z��\{�]G{�P]U{�|]}{�]�{�\^A|�^�|�_�|��_�|�`?}�a�}�`a/~�(bj~��b�~�\c�~�c�~�\e���e��f��$g���g��Ph��di��<j)��jy���j'��pkO���k����l���m��n7��@o_��dq���<rׂ�Pr��rW��s���xs����s���8tq��t����t����uτ�v݄�hw��x���x���x1��y����y��z���zLJ�X{��{��|���}���p}���}4��d~B���~P�������\���Ā0��T�A���R��,�z������ ����`����c���q���ҋ�@����t�"������L�s��Ԏ��L�;��|���������ێ�L�+���?���D����������t������P��������<�#�������Ñ�<����;���c������D�����ے�D�S���d��̝�������$�ܓ�P���Ğ,���T��\�|��$����D������8���p�4�� �\��X���������L�� �t��h�ė��u��X�#������H�Ù��������|�ޚ��	���4��T�a������(�ٛ�`�.��@�V���n������@��$�h���r��,�w�������Ǟ�H�#���P���x���E��<�m������b��d���İ����Ң������]��L�գ��R������ ������p���\��������h�"��̺r������ �Ŧ����4�����˧�мЧ�H����,�H���p��p�������,���������������������P�^�������\��������$�N��l�v���������$���l�f������������ެ�@���l�V�������έ�p��������0�F������l��������6���֯�`�_�������O��x�DZ�����P��p�����&����N��H�v��\�Ƴ�������d�>���f�����������|�޴�����.��0�V��d�~������0�ε������������,�϶�X�����-����U���}���d�������������t����9��L�a��4����X������ٹ�D�����m��H�˺���Q�����T�O���]���ռ����4�i�������%��L�u����Ӿ�<�1��t�?���M����[��4�i��t�����տ��������A��L�O����]������P����������X�
������C��d�k���y������D�������x�'���O���w��������������������������,����-��U��X}��������<9��a������	���L
��
)��Q���y�����
����
�������������|�����P0��X��n�����\������9���a��$r������:��b�� ���l���H/��\������H�������+��{�����@ ��� ���p"��"k��#���h#���#���,$3��$[���$���0%���%����%#��'K��'����'���d-
��/Z���/k��0���0��D1���1���82���2���H3��X4B���4j��P5{��,6���X7����7���8,��9T��t9����9���<���<=��p>D��P@l��@���DA���tA���A����A���C���dC���C[��,D����D���pE[��LF���F1���FY��$J���K����K���(L���L
��N5��DNC��XNn���N���@O���O����O��P����PM��$Ru��lR����R���S���TK���Vs��DW���W����X���@Y���dZ���Z/��([@��[���[e��<\��\-��]U���]���|^����^M��4_b���_���`����`���a��ha��@bj��b���pcZ��Hd���e���8f��g0��hX��$h���h���Xi����i���j���pj����jq��l���l���n���nb��Lo���o���o*��`p���p6��dq^��Tr���r���Hs���s���s���Pt���tL���tt���t���lu���u?�� v���\v��w
���wZ��x���x���y\��dy���y���z���{$���{t��H|���|����|���(}��}8���}���0~����~���,��;��c��\����|�����������ȂJ��0�r����������l������d����ԅ����������|���<�0���5��$�]��ԉ���\���� �M��D�u����������ď������P�4��ȑ\��L����X����,�������,���l�)��Жy������̘������8�'���O���w�������������[��P�������T�������4���\��H����t�������̦����$��$�L��P�t��|�������ԧ�����,�<��X�d����������ܨ�����4�,��`�T���|������������<���h�D���l��Ȫ������� ���L���x�4���\��Ы�������(���T�����$��L�جt����0���\������<��d����8���d������,��T��|�P����������� �D�T�l����������$��X�4��\�������L������0�$�ijt�������<������L���������������и%�t�3�̹A��i�X���������p������>�8�f����4������P����"	��J	�0�r	���	�l��	���	��	
�H�
��?
��g
�@��
�p��
���
��Z������<���A��������8�1
����A��	���Y�����H���p����I�����D����/���v�4����]�l��������������X��������4������P����<�<�d���T�<�|�$���|���@�D���c�8�t�������p�����X�<��d����p�|����4���\���L�D�m��{�����,����L�@�Z��h�������\���0�(�O��������x����&�0�b�����������<�������8�% ��G ��r ��� �,�� ��� �P�� ��!���m!�P�~!����!���!�p��!���"��"��1"���F"��\"���q"�h��"���"�x��"���"�(�W#�l��#���#���#���#�L��#���#���#�P��#��$�(�$�D�0$��%��0%�>%�$&�@�&�`5'�U'��1(�T(���(��(��(��(�)�L)� �)�|�)���)�D*��3*�	�*�t	�+��	�+�t
*,�?-�V-�p-�4
�-�
�.�d/�/�`1/�$X/��/��/�$0�&0��N0�v0�d�0�,�0�1��81��1���1�D�1�x�1�$�1�2���2��2��3�XF3�d3�,�3�$4�p<4�g4�l4��q4�  v4�� �4�!�4��"�4�#
5�$ 5�$.5��$V5�$�5�p%�5��%�5�&�5�&	6�'M6�)u6�4)�6��)�6�+7�+77��+�7�+�7�(,�7�T,'8�,w8�,�8��,�8�-9�d-?9�-P9��-a9�$.�9�T.�9�.:�.):��.Q:�/y:�H/�:�x/�:�/�:�`1Z;��1p;��2�;�3�;�X3�;��3�;�(4!<�4I<�X7q<��7�<�|8�<��9=� ;K>�$=s>�=�>�>�>�??�L?;?�?c?��?�?�@@�@+@�AS@��A{@�,C�@�@D�A�D�A�E[B�hE�B�(F�B�FD�0G;D�pH�D�H�D�I�F�PI�F�I#G��IKG�JsG�lJ�G�J�G�K�H�dK;I�LcI�`MqI�MaJ�,N�J�hN�J�N�J�<O)K�PL�PAL��QiL�R�L��R�L�S	M�DTYM�U�M�U3O�PV[O�V�O��V�O�,WP��W3P�4Y�P�Y�P�Y�P�$Z�Q��\IR�(]qR��]�R�D^S��^9S�@_aS�P`oS��`�S�(a�S�a�S��a	T�b1T�c�T��c�T�0d�T��dU� eeU�he�U��e\V�f�V�lf�W�f�W� g�W�tg�W�,h&X�i�X�hi�X�j8Y�<kaY�ktY�k�Y�\l�Y�l�Y��lZ�Hm;Z�m�Z�Hn�Z�na[��n�[��p�[�p)\�(qy\�q�\�s�\�s]�dt8]�tW]�u]�u�]��u�]�Dv�]�v^�0w/^�DwZ^�xw_^�x�^�xx�^�y�^�Ly_�y:_��y�_�z�_�lzc`�zh`�{m`�{�`��{�`�H|�`�|�`�~�`�P~�`���`���`���`�X�
a��a��a�\�a��!a�P�&a��+a��Sa��da��ua���a�<��a���a�܈b�\�*b��c�̊Mc���c�l��c���c�̋d���d���d�P�e�|�,e��Te�ܐ�e���e�<��e�ܑDf�4�g�|�7g�ؒRg��zg�@��g�|��g���g���g�8�ch�ȕ�h���h�8��h���h�Ж�h��i�(�;i�t�Ii�ܗ^i��ti�t��i��bj��pj�T��j� ��j���j� ��j�x��j�$�)k�\�Kk��ik�h��k���k�(��k���k�ġ�k�d�l��nl���l�X��l���l�H��l��m�d�m�̦<m��dm���m�Ш�m�Щ�m�\��m�T�^n�ح�n���n�\��n��>p��wp�<��p���p�@�q�Բ?q��Oq�<�wq���q��r��?r��gr�X��r��t��0t�|�Xt���t���t���t�d� u��Hu��su���u�@�@v�x�hv���v��]w�T�Mx��ux����y���y����z�`�"{���J{���{�H��{�4����"������� ���X�:��������ځ����D������Ђ�$����t�.����~������|�у�������������0�)��D�Q������4�܄�������p�?����N���a��d���������φ�4���l���������'���=��L�S������4�(��h�P���x�������<�����C���k�������4����8�� �e�������-��h�U���E���S���{������X�����C��|��������d�������3����[��������ݎ����p�>���O��0���l�&�� �\��`�����
�����t�j������D�ȑ�p������H�@��t�h�������ɒ������<'��l5��]�� �������$���l“�ؓ�-���X��H	���(
Д�����H��p���������<8��������l8��T�x��������ؘ��ؙ�<���\�����H������h�����ȸX�����H�X��`�ȣ�x�Ȥ�����8�� �8���h��ܺȧ�����ت�|����Ȼ(���ȯ�h�X���ȱ�����0�8��P����ȳ�̽����H������ؾ���X��0����T�������� �X�������(������@�H��������������$�8��`�������H������������$�x��`��������x������������`�������������8���x�� ����H����\�(��p�X�������������� �H�������x��H����\�x��������H������4����X�h���8�����������4���x������(��(�H��d�(�������X��4�(�������������D�X��|����������X�H�h�\�x�p�X
���h
��x
����|�h��x�������$���8��d�������(�����@�h������������,���d�(������8�H�x�p�������H���8�8�h���(����(� �h)�H��)�|��*����+� �x,�T��-���5���x6��7�D�X7�x�x7���8���X9�L�:��(;�(�<�<�(<�X�H<���<���=���(>���>�`��>���>���?��X@�T�x@�h��@�|��@���F����I�X��J����J����K�4��L��xM����M����M��8N�8�XN�L��N�|��W���x[�@��[�h�H\��X\��h\����\��(]�<��]�X��^��Ha��Xa�,��d���d���e����e���e��Hf�D�hf�X��f���f��h���8h��(i�p�Hi��8k���Xk���k�8�xl�l�8m���o���8q��r�h�Hs���s���xt���t�8��u���u���u���(w� �Xz�|�H|��8���H���������X��L����p�(���x������<�X��x�Ȍ��x��$�����8������H��L�����������`����(�������$����P����d�Ȝ�x��������h��$����@�Ȟ�T�(���������������ء�,�(��T�8������������@�X�������X���(��d�h��������ج��H��D�(�����������H��P�Ȳ��h���x������(����p�����(���8������X��d����������@���T��������������L����x���������X��<�8��`�h�������H������\�X���h�������X�������h��8��������������<�(��`�X��t�(���������$���x�8����������h�����8x��|�������X��Th��hx���������\��|���X�@��`�����tx����x	�0�	�`8
�x
�h�8x�LX�8������0��`(�H���H������	H�T	��	h�	x�0
��L
�!�
�"��#�X�$�h%���&�4h(�h�(�)��*�(
H*�T
X+�
H,��
�,��-�`.��.���5�0h6�p(7�(8�9�x�9�H<�h<�=�x(=�>��X>��?�|H@��8A�L�A�xB���C�$�C�P�D�XE�xE���E�XF�G�4XG�P�G�x�G�xI���I�8J�d�J�HK���L�PhM��M��M���M��(N��XN�hN��N�(�N�<(O�P�O��O��O��P�Q�\�Q�8R�XR���R�XT�8�T�l�U��U���V�0HW�H�W�\X�(X��X��HY��Y�H(Z�|XZ��Z�x\��\��\�]��x]��]�(h`�h8b��c��d�(�g��i��(j� �l�\ �m� o�� �o�!�o�8!p�L!�p�!�p�!�p�!(q��!�q�T"xr�p"�r�"�s��"Xt�#u�h#�u�#w�#�x��#�x�$8y�X$�y�x$�{�$�}�%H~�|%�~�%�%8��%��%��&H��&x��&(��P'8��'���'(���'x��$(8��l(x��(����(��(���)���8)���L)���`)���)����)����)H��(*���T*h��*���*���*ؖ��*h��*���+���$+��+ؙ�+Ȝ��+���4,���,ؠ� -H��X-���x-����-���0.���L.ؤ�h.��|.��.إ��.����.���/���X/8��/���/����/(���/���40Ȭ�X0���0H��18��\1h��t1(��1ȶ��1ض��1h��T2x��h2���|2ȸ�2ظ�2ȹ��2ع��2���3���3(��P3���3Ⱦ�3����38��3���$4(��T4���|4���4H��4����4���4���$58��`5X��t5����5����58��6x��<6��h6���6����6����6���$7���@7x��`7��7����7���P8���8���8����8���8���09X��x9���9��9����9���X:��:(��;��\;���;��;h��<���`<(��<h��<����<���=���X=��=X���=���>X��,>���x>����>����>(��8?���?(��?���?���@���d@���@���AH�lA8�A���A���A��DB��XB��lB��B8
��B��(C�
�dC��C���C�� Dx�\DH�DX�DX�EH�TEH�E��FX�,F��HF8�F��F� �F8!� G�"�xG�"�Gh#��GX$�H�$�XH�$�lH%�Hx%�H�%��H&�I(�\Ih(�I�(�I8*�J+�0J�+�dJ,�J�-��J.�$K�.�\K/�KH/�Kx/��K�/��K�/�L�0�XL�1�L�2��L�2��L83�,M�3�`M�7��M�8�N�8�8N89�pN�9�N<�O�=�xOh>��O�>��OX?�P�?�0Px@�tP�A�P8B�QhC�pQ�C�QD��Q8D��Q8F�8RhF�hR�F�|R�G�R�H��RXI�0S�I�LS�M�SXN��SHO�$TP�\TXP�|T�P�T(U�UW�hUxX�U�X��U�Y�VhZ�HVh\�|V]�VX]��V^�W�_�TW�`�W8a�W(e��W�e� X�f�`X(h�X8h�X�h��X�h��X�l�@Y�l�XY�m�Y�n��Y�n�Z�n�Z�o�dZxp��Zr�Z�r�P[�r�d[s�x[(v�[Xv��[�v��[8w�$\Xw�8\hw�L\xw�`\xy�\�y��\�{�,]H|�d]x|�]�|�]�|�]�|��]�|��]�|�^H��p^X��^h��^����^����^Ȅ��^؄�_��_���(_(��D_8��X_X��l_؅�_���_��`H��`��L`��`����`ȉ��`��� aH��ta���a(���a����a(��bȍ�<b���db����b��c8��pcx��c���cȓ��c����c��dH��8d��Xdȕ�|d���dx���dȢ�pe���eȥ�fh��8f���Lf8��fH���fX��8gh��|g���g(��h���dh��hX��hx��h����h����hȽ�iؽ�i��xih��i���i���Pj���j���k���k���k���k���l���Dl���l��l���lH��m���,m���hm����mX���m���(n���`nx��n����n8��o���To���o����o����oH��p(��Pp���p���p���xqh���q����q���lr8���r���,sX��s���s���Lt��lt��tX��tx���t��t��u��$u��8u��|u��u���uX�@vh�Tv(�vH��v��w�|w�w8
�xH
�0xx�x���x8�4y��y��yX�Pz��z(�{X�({(�l{(�{X!�|(�|x*�}�*�0}�+�}8,�}�,��}�-�~�-�0~�.�x~(0��~�1�8H2�l�3���5�0��6�p��7��7��7�؀�7��88���8�h�89�ȁ�9��(:�L��:�;��x<�@��<�T��<�h��<�H=�؃X=���=�4�(?�x��@���A� �8B�8�hC�h��N�O��hO���O� ��O�<�xQ�R�(X��8Y�d��[�\�ȇ�\���\��]�H�X]�t��]��]�̈h^���^���^�D�8_�l�X_�x_��_��_�h`�ԉ�`��a�4�8b�p�hb��b�hc���c�L��c�`�Hd�hd��d���e�<��e�\�f�p�Xn�،o��8o���o�T�Xp��r��(}�`��}�x~������x��`����ȃ�����$����P�(�������x��0����\���X�����8��`������ȒH������(�(��D�؍�h����������`���H��̔؛����8�8��L����X���������P�H��h�������(���8��$�h�����8�� ����d�����������x��P������h���(��,����X���h�����H��$�h��P�H�����ԛ8���x��,����X����l������������ܜ8���(��X����������X������8����d������X��؞�����������0�X��D����p�����������(��ԟ���8����d���x�������Ԡx���x��L����������4����l�H��̢����8��4����|�(�����(��l�X��̤8���������,���`��������(�����0���p�����h��@�8��Ч8�����h���|���H�����<�x�t��������Щ�(�H�T��	���Ԫ
���
�8��h���ȫ����@�X���Ԭ��\�x���(����@�x�t���X ��X!�P�X$��&��X4�x��4�X6�ذx6���7�4��8�X9�Ա�;�,�(<�d��<��<�=�Բx>� �@�`�XA��A��C�$�HC�@��C�T��C�h�8E��E�ԴL�4�xL�H��L�d�M�x��M�HN���P�P�8R�ԶHS��HV��W�з(X��Y�hZ�h[���e�p��e��e�Xf�̹�f�g��(h�|�hk��k�4��l�l�hn�̻�t�H��w��y���y��{�\�x|��}�ܽ~���@�������,���H��ؿ��0�X��D����x�ȍ�8��x�����d����X���8��@�ؔ�l�Ȗ���H��������h��H����d�X���h���X���Ȟ�`����H������������@�(��d����x�����ȥ������ȭ�$�Ȯ�d����|����������(�����p�����������������H��8�8���ط���h������8�h������������h������� ����T�8�����������ȼ��H��D�ؽ���������(����h���X��D�ؿ�x��������������x��0�����(���H����X��,�(��t���������8��<����h����(��������H�� ���T���������H����X�� �8���h��������h���8��\�x��x������������(���8���H��(�h��D����p�����H���������������(�x��x�������������8����L����8���������������������8��8�h��L����d�����H����������@�x�������(���X��@�(��t�x��������(�����D�h��x��������D����������h��P����H���X����x���(�L�h�`���t����x�������������(� �X�4���H���\��|����(�����@�(�l��	���	���
���X
���
����`���8�����(�8��������h�H�H ��h ��� ���!��"�@�h#�|�x#���#���#���X%�0��&���'����'����)��x*�`��*�|��*��h+��x+����+���,��H,�H��,�p�-��8-��x-���.����.�@��.�l��.���.��/��8/��H/����/���0�X�X1���1��X2���3�\��3�p�4��5���X5��x5� �(7�h��:����:��;��>��(>��8>��x>���8?���?�H��?�\��@��B���B���C�$�D�`�hD���D��8E����G�P�hH���H���hI��(J�H��J���K���8M� �XM�4�hM�H�xM�\�8N��HN��(O��XP�`�hP�t��P��8Q���8R�$�HS�d�8T���XU�,�hV�l�X���X��Y�(�(Z�x�([��(\��]�X�_���_��8`�(�X`�<�x`�P��`�h��`�|��`�(a��a��b��Xc� �d�D��d�8e��f���g��h�<��h�h��h�i��xk���k� ��k�@�l�T�8l�h�(n��o��hq���q�<��q�X�xr�(s�Xs��t���t�T�Xw��w��Xx���x�0�Xy�T�z�8z�hz���z���z��({���|�H�H}�p��}��}�����؁�8�(��l�x��Ȃ�����h�� �؃�T�(��h��Ȅ��(���x��D�ȅ�|�X��؆�H��,��P���(���x�����؉�(h��P���d��ȋ�x������X��,���l������H��,��P������$(��t��������Pؠ�X�����$���h���ȥ������(�� ��d8��|h�������(���8���H��h��x��(���<Ȫ�P��xH�������(��,	���T	ȭ�t	(��	����	(��	x��
(��0
h��`
��
����
��X��@���X���p��X���������0���X(��X������x��(
���T
���
����
���
���$��h���������$���@x��8������8������$���XX�����X�����0h��d������(���8���H��X��h��,x��@���T���h���|����������8���H��X��(h��<x��P���d���x�����(��h���������4���P���x�����������(��H��p8������X�����X8����������H(��`8��t���������$��t8��x������x��8H��\h������X��x��0���L(��tH������4�����(��8���H���X�����h��\�����������\���������L(��x������ ��T��px�����x�� X��T h� ��� ��!x�,!��p!8��!�	�$"(
�L"�
�"��"h�#H�0#��|#8��#��$��@$��$(��$H�D%��X%h�%��&��X&��&X"�'h$�'�%��'�%�'&�(�&�D(�'�((�(X(��(�(��(�(�)�)�8)*�`)�*�)�,��)h.�$*�.�`*1�*X1�*H2�+3�4+�4�+�5�+�6�+�7�(,�8�T,H:�,;��,�E�x-HF��-�F��-�G�@.8H�l.�H�.(I��.xM�(/N�\/HP�/T��/(U�40xU�P0hV�0�Y��0�Z�1H\�X1h]�1^��1(^��1Xb�L2�c�2Hd�2�h�\3hi�3�i�3�j�4xk�,4xl�l4�l�4Xm�4hn�5�t�d5�u�5Hv��5�w�@6�x�6�y�6�z�7h{�l7h|�7H}��7�}�8�}�(8~�D8��8����8���(9؇�9؈��9����9��:(��:8��(:H��<:h��P:x��d:؉�:��:���:��:���:(���:8��:H��;���,;���@;(��x;x��;؋��;����;X��(<h��<<��h<؎�<(���<8���<H��=���P=x��=���=���=���$>H��>x��>ؗ��>(��?���X?��t?(��?8��?H��?���,@���h@���|@Ȝ�@��@��@8���@X���@؝�A��(Ah��XA���A��AX���A���B��$B��pBH��BX��B(��C��xCx���Cȭ�@D��D����Dص�EX���E��`F��F����F���G���$G8��PG���GH���Gh��H���(H��LHh��H����Hh��I���PI��I���I8��8J���hJ���Jx���J���8K8��K����Kx��<L���XL(��tL���L8���L���HM��\MH��xM���MH��N���tNX��Ox��TO��O(��O����O���P(��P8��0PX��DP���P���P���Q��,Q���`Q��tQ(��Q8��Qx���Q��Q���R���8RX��R����R���S(���S����S(��(Th���T���Th��U���$U���`U����U����U���U�!��@V�!��TV�%���V&���V(&���V�&��W�&��,W'��XW�'���WX)���W�)��X�*��@X�*��lXH,���XH.��TY�.���Y/���Y�/���Y�1��@Z�2��xZ�2���Zx3���Z�3��[6��<[�?���[�F��\8H��P\HH��h\�H���\�I���\J��]xJ��D]�M���]XQ��^XR��8^�R��h^hS���^X���^�X�� _�X��P_hY��x_�Y���_xZ���_�Z���_([��`�[��D`\��l`x\���`X^���`�`��a�k��|ahl���a�l���a�o��Tb�o��xb�q���b8r���b�r��$cxu���c�u���c�v���c8w��d�x��\dHy���d8z���dhz���dh���(e����Te؃���e����eH���Pf؆��|fh����f���g���Xg�����g�����g����@h����h�����h���h����i����li8����i؞��j���4j�����jX����j���� k���<kH���Pkx���dkȤ���k8����k���� l���Xlȭ���l����mد��`mx����mX����m�����m���n(���(n����Tnع���nȺ���n���`oh����o(����ox��p8��tp����p���q��xq����q����q����qH��r���hr���|rx���r���r���\s(��ps����s���t���dth���t���u��u8��u(�4v��pv���v���vh��vx� w���w��w(�$x��Lx��x��xH� y���xy�����y�����yX����y���zh���<z����dzH����z�����z���{����H{8���|{X����{���|h���,|����`|����|�����|���|���D}����}����}���D~����~�
���~���@8�������X��p������8��؀�������@������H����x��́���,�(��H�h��p��������D�����������x ���� ��D��&�����'����'���(,��x��,�����-���8.���x.��4�83�����3��Ȇ4���84��0��8����X9�����:���;��X��A�����A��Ԉ�C��8�D��l��D�����E���HF����G��p��H�����J��4�xK�����L��ЋM���hM����M��$�HN��P��N��d�xO����xP���8Q��,��Q��X�hR����XT����T��<�U��X�(U��l��U����V�����V���(W��@��W�����W�����W��؏HX�� ��X��8�Y��P��Y����HZ����hZ��ĐxZ��ؐ�Z����Z����Z����Z��(�([��d��[�����[���\���e��`�e��t�(e����8e����He����Xe��Ē�f���k��l��k�����l�����l����n��@��t����u����(u��Ĕ�u����w��H��z����8{�����{��̕�|���8}��@�(����8������������h���L�(���x������������8����X���8�����T������8����x��������L�؉����������h������������8�����ȓ��Ě�������������������H�h�����h�����X���H����������ĜX����ة��@����T�8���p�ȫ������d����������̞��$�����8�H���h�h���|�������������X������������������,�����X����p�8�����X�����h���Ġh�����ȳ��0�س��D����X�ȴ���������������H���ȡX���ܡh����x�������������,�����@�����T�ȵ��h���|������(�����H�����h���̢����������x���(�(���p�h���������(����H����h���(�����@�(���\�h���t�H�����h���Ф�����8��������$���8����P�h�����x���ĥ����إ�������0����\�H�����x����������������8�8��d�h�����������������(��@�X��l���������Ĩ�������H��H�x��t���������̩����8��$�h��P����|��������ܪH���x��4����`����������8���h������<����h������(����X����������D����p�����H��ȭx������ ����L���x�8����h��Ю��������0�8��d���������̯(���h��4����h������(��аh������8����l�(����x��Ա�������`��������������ԲH������D���l�x�سh� ���H���\���p�8����Ĵ�����(�P����h���̵����`�
������ض���(�8��H����h��
�������(���H������H����t�8����X�������H��0�����������������$�8��<����l�x����(������ �H��8�H��t������������@����T�(�������̼���������� �8��L����d����������8��Ƚh���(��H� ����� ����(!��ؾX!����!����#��d��#����h$�����$��ȿ�$���(%�����%����%��$�H&��\�'����H'�����'����(���X)��8��)��T�H*��|��*�����*����(+���H+���x+����+��D�X,����x,�����,�����.�� ��4�����4�����4����5����85����5��\�7��|�x7�����7�����7�����7����8���x8��0��8��D��9�����:��T��;�����;����h<�� ��<����H=����x=�����>��0��>��D��>��X�@����(@����B���hB��D��B��p��C����8D����(G��P�K����(K����HK����hK�����K�����K���(L��D�HL��X�hL��p�M�����M�����N����O��L��W�����[��(�hb�����b����c��T�(d��x��d�����d�����e��\��e����hf�����f�����f����(g��0�8g��D��g��d��g�����g����i����hj��X��k�����l����m��H�Ho�����o�����o��(�p��<�(q����8q����xq�����q����r��(��r�����r����s����8s����xs�����s��$��t��P��u�����v���Xw��H��w��`��w����Xx����(y����Hy����y��$��z��h��z��|��z�����z�����z����X|���H}��P��~�����~������������P����|�8�����H�������������8�X������������������T�����������h���L�ؓ��|�Ȕ����ȕ������,����@�h��������������������$����l�Ț���������؛���؜����X�����x�����h����؞��H�����x�������X����x���X�����H��������@�h���p�������إ����(�����8�����ئ�������t�H�����x�����8��������D���p�(�����X���������������<�����P���l������h���������4���H����`�X�����������ز��������0�غ������������������X���D������8�����X���������P�����l����������������x�������0��������������L�(�����������H����t�h����x������$����8����d�����������X��8����d������8����H���X������T���h�H�������H���������X��0����D����X����p�x���������X���h������,����@����T����h����|���������H����x�����������$����8����L����`����t������h����8���h��L����|�H�����������,�x�������8���8��0���<���P�h�������������h� ���<�(������������� ������������(������4�(����X������ ����`������x���������������������(	��0�8	��D�h	��\��	��x��	�����	����
�����
����
�����0���D�
����h
����
������8�(��d�H����x�������`����t�x����H�������4H��pH�����������������|�������0���L(��hX���8��������� ��48��PH��dX��x�����������������(��,���p���� ���( ���� ���� ����!���!��8�!��L"��`�#���($���x$���&���H'����'��H�(���X)���*��+��Xh+���x+����+����,��$	0���	(0���	�1���	�1��
(3���
5���
�:��0�=����>����?��0�?��D�@��p�A���B����B��H
�M���
�M��hO��xP���HP����P���R��t8T���XT����T��8U��8HV���(W���hW���W��8�X��dxY����Y����\���\��0�\��Dh]��lx]����]���^���_��Xc��x�c����c���hd���d��@Xf���(g����g���g�� Xi����i���Xj����j��$l��XHl��lhl����l����l���m���m����m��,8o���Ho���Xo����o���xp��88r���ht���u��@(u��T�u���xv����v��Xw��`hw��txw���Hx���Xx���(y���8y��hy��,�y��lz����z���{���h{���{��|��0��������(����؂��@���`H���xX����h����������������8x����ȅ������ ����h�����8����؈�� ����4 X���p x���� ���� ����!����(!���<!����h!�����!(����!�����!8���"Ȏ�� "8���P"����|"ؒ��#��#(���P#����#�����#�����#����$(���0$x���H$�����$h����$X���%���� %؟���%(����%�����%ؠ���%8��� &X���4&x���H&����\&����p&���&�����&آ���&(���0'����h'(����'x����'(����'Ȧ��4(h���p(����(����((����(x����(����)Ȩ��H)X���t)h����)x����)�����)x����)���� *x���<*����*(����*H����*����+h���l+����+�����+ȯ��,��<,���h,8����,h����,ذ���,X���(-h���<-����x-ر���-����-H����-����8.(���h.H����.�����.���.���(/����\/�����/���/����/����0x���@0����|0ȷ���0���08���1H���t1x����1���2��@2����T2����|2�����2�����2���3���l3H���3x��<4���4X���4h���4x��5���`5����5����5(��6h��06���\68���6H���6x���6����6����6H��7x��(7H��l7����7����7���8���8���,8���@8��T8h���8����8����8���88���8H���8X��9���$9���89���L9(��`9����9���9���:���4:��H:���d:����:H���:���:h��4;���`;���;��;x��;��<(�<<X�P<���<���<���<��<��8=��T=�p=H��=���=��>��$>���>h�,?��`?h��?���?(�D@���@(��@���@��AH�0A��XA��lA(�A���Ah�B��,B��XBh�B8����B���B����@C����lC�����C����C����C�����C����TD�����D����D�����DH��EX��0E���|E���E8���EH���Eh���E���F���<F8���F����Fh	��DG�	��lG�
���G�
���G�
���Gh���G���DH(���H(���H���$I���dI���I����IH�� JX���J���J8��K���xKx���K����K����K����K����K��L���8L ��hLX ���Lx!���LX"��Mx"��M�"��,M#��HMx#��tMH&���M8'���M)��@Nh)��|N�)���N*���Nx*��Ox+��POH,���OH-���O2�� P�2��HP�3��lP�3���P�5���PH6���P7�� QH7��HQ�7��\Q�8���Q�8���Q�9���Q:��R�:��@R�:��TRh>���R�>���R8?��(SH?��@S�?��TS�?���SXA���SHB��T�B��XT(C��lT�C���ThD���T�D���T�E��U�E��U�F��lU�H���UhN��VhP��dV�R���VS���V�S��@W�S��TW�T��xWU���W�U���W�X��X�Y��4X�Y��LX�Y��tXZ���X(Z���XXZ���X([���XH[��YX\��HY�\��dY�\���Y�]���Y�]���Y�_��8Z(`��lZ8a���ZXa���Z�a���Z8c��[�c��<[(e���[xe���[�f���[(h��X\hh��t\8i���\�i���\�j��]Hk��<]Xk��P]hk��d]�k��x](l���]xm���]�m��^o��X^ho��x^xo���^�o���^�p���^�p���^�p��_�p�� _8q��T_�q��p_�q���_�q���_�q���_�q���_�q���_r���_r��`�r��d`�s���`�s���`ht���`�t���`Xu��a�u��<a(v��haHv���aHw���axw��(b�w��Db(x���bXx���b�x���b�y��c�y��,c�y��@c�y��Tcz��|cHz���c�z���c�{��d|��dH|��Ddx|��`d(}���d�}���d~���d8��4e���|ex����e8��� fȆ���fH����f�����f�����fH���4gh���HgX����gx����g�����gȉ���g���h(���hh���@h����lh؊���hH����hh����h؋���h��i����0i(���Hi����|i�����ih����i�����i���i����j�����jؒ���j����Pk����kȕ���kH���l����$l8���pl�����l8���m����\m8����mȜ���mH���nx��� n���\n�����n(����n8����nX���o���� oH����o����oȦ��pئ��p����Hp�����ph���q��<qh����q�����q�����q����r����@r8����rX����r���rX���s���� sص��ps���s8����s����tȶ��$t����8t(���xth����t�����th���ux���,u��Xu����lu����uȹ���uع���uh����uH���Xv���tv�����vH����vh���w����`w���w�����wh���(x��`x����x8���xX���xH��y���`y���ty8���y����y����y(��$zX���zx���z����z����z����z���{��({x��`{���t{����{���{H���{���0|���\|��p|8���|X���|h���|8��}���L}���}8���}h���}���~���8~��d~����~���~��$��p�����������X��0�H��d���������Ȁh������,����l�(����h�������ԁ����8��D�x��p����������������8����d����x������������̃8����������$���8����l������������������$����@�����h�܅���X�8���������X�І�������,���H���������x�̇��������P�H���(��h����<�h�p�X�������������,����@�(���l�h�����x���������(���4������8���������������(���\�������8���Ȍ���������(�8���H����x�X�������Ѝ�������4����H���x�(�������Ȏ����X�� �h��4�h����x�������ȏ���܏h������d������ ����x ���� ���� ��P�� ��d�!��x�!�����!����!����!���X"��H��"����H#���h#����#��T�8$�����$��Г�$����%���%��(�8%��@�H%��T�X%��h�h%��|��%����&����x&����&���h'��L��'��x�X(����)��ܕ()���h)�� ��)��P��)��d��)��x��)�����)����(*���X*����*��<�+����X+����h+����x+��ȗ�+�����+��(��+��<�8,����H,����X,����h,��Șx,��ܘ�,����,���-��<�-��P�(-��h�h0��șx1��(��1��<��1��P��1��d��1��x��1�����2����2����2����2�� ��3��h��3��|��3�����3����84�����4��ԛ�4����5��4��5��\��5�����6���7��4�88����x8����9��ԝF��8�hF��p��F�����F�����F��Ȟ(H���xH��4�J����hJ�����J�����J����L���HL��<�XL��P��M����XN�����N���O��4�xO��P��O��l�XP�����Q��ء�R���(T��x��T�����U����V��,�(X��l��X����hY��У�Y�����\��\��\��p��\�����\����8`�����`���Hb��x�d�����d��ܥ�d����e��D�xf�����f����8g����Xg���8h����Xh����h��(��h��\�hi����8j��ا�k��(��k��D��k��X�l��l��l����Xm���8n����n��<��n��P��n��d��n��x�Xo�����o����o�����o���p�� ��p��p�8q�����q����Hr��Ъhr����r����xs��h��s����t����t����ht��̫xt����t����t�� �u��4�u��H�(u��\�8u��p�xu�����u�����u��Ĭ�u����u���(v���Xv��(�xv��<��v��P��v��d��v��x�w����8w����Hw�����w���8x����x��$��x��L�Hy��p��y�����y�����y��Ȯ(z��ܮXz���{��0��{��p��{����|����(|�����|��د�|���8}��,�h}��@��~��������8���P�X���d�(�����8���бh�������������� ����T�H���t�Ȃ����8����X��������(�x���D�H���p���������������������س����$�H���@�����\�8���������ش��������@�Ȍ��\�H���x�X��������������X��������,�����@�h���������ȶX���P�����p�8���ȷH����X������T���������������l����̹x��������������<�����x�������Ȩ����x������������(�ت��t�H�����h���Ļ�������,�(�������ܼ�����ذ��4�8���H�h���d�Ȳ�������������8���T�H���h�����|������X���̾8��������P�X�����(����x���8���x������h������������h��������0���L����`�X�������������������T�8�����������X������������@���������H��h������X������,�����������������t�����h���������8���x��,����\���p��������H���\�x���������h�4���l�����H���P�������H���������X�(���������(�������X�h�����������X���,�����@����x�H�������8���������(�������������x���������(��(�h��H����\����|������8����x�����������`�h
��������X�����������H�h���������h
��$��
��X�(��l�x����(�� �H��D������h����x�����������(�8��H�x��x����������������������H�H�������������h��(����`������!����H$��@�X$��T�x$��h�%�����%���(&��H��&��|�H)�����+��P�H,����X,�����,����-����-��L��/����81�����1��H��2�����2����X3���4��4��5�����5�����6����H7�� ��7��<�X8��|�9����X9�����<��(�8=��<�H=��P��@��x��A�����A����XB���hB����B��X�xE�����H�����K��H�L��\�(L��p��M�����M����hO�� �xO��4��O��p��P�����P�����Q�����Q����T��H�(T��\��T����HU����XU�����V����V��$��X��p��X����XY�����[����[��$�(\��8�8\��L�x\��`��\��t�_����_����H_���X_��$��_��L��_��`�(`�����`����(a����a��4�b��P�Xb��l��b����8c�����c�����c�����c�����c�����c��,�d��@�8d��\�Xd��p��d�����d����e����e����(e�����e����e��(��f��H�xg��p��g�����g����h����xh����h��8��h��`��h��t�i����(i����Hi�����i�����i���k��l��k����l�����n�����n���Xq����hq����xq����8s����t��x��u�����v��0��v��X��w�����w����Hx�����x��0�z��|��{�����|��@�}��l��}����H~�������(���h�8��������������X���x�8�����X�����x�����������X���D�X��������������D�X�����������Ȋ�������4�����t������8��������(�����(����x����������������X������������������(��������X�����x�������������0�(���\�X��������������������������(�(���D�����`������8�����h�����ș���ؙ������H��������,���@������������Ȝ����������� ����4�H���\�����p�ȝ����X������������4�(��������������������X����ȡ��0�8���D�����h�����|�����������x��������H��� �X���4�����X�Ȥ��l�(�����x�����h����Ȧ��ئ��8���8H���L����p����x����������������X���(����<���`(���t���������������h����ȫ��ث��,8���PH���d�����8�����������������(�������@����dh����x����د������H������������0���Tx���x�����������������������$����P����8����H����x���������8���4H���Hx���h�����ض���ط��8����������h���0����8����x���	����	(��\	H��p	����	x���	��$
���`
8���
����
����
����
����
���D�������X����������X���8���(���H��<
���x
����
������P�������8��<h��P���|���X������$���\X���h��x����4��H�\(�p8��H��h����x�\����������$�@8�T���(��X��x�����P��d�xh��x�������� 8�8(��X��������,��X��X�x�������8�8���X(����h�� ���4���X���l�������(�����Px��������������������(�������zRx�$��PFJw�?:*3$"D�@0\���F�D�A �K0�
 AABB����2E�_
LA`����sB�I�E �B(�A0�C8�G@�
8H0H(B BBBJD8E0A(B BBB zRx�@������(\��LL���F�B�B �B(�A0�D8�D�j
8A0A(B BBBG$zRx��������,��8����F�B�B �A(�A0��(A BBB zRx�0�����(~�xLL���F�K�E �B(�A0�D8�G�6
8A0A(B BBBD$zRx��������,j�P@����F�B�B �A(�A0�D`t
0A(A BBBD(8��FF�P�A �kABPH\��F�E�E �E(�A0�I8�J�D
8A0A(B BBBI����pdG����pdG8�H���F�E�D �A(�D`�
(A ABBIzRx�`����$V~�P<���9TVT��*A�[
LA8t��F�B�A �A(�GP)
(A ABBHzRx�P����$�}�(����+A�ezRx�� �}�(0���SH@E
A L���KE�L@�
ABHp���F�K�B �B(�A0�A8�D�l
8A0A(B BBBG$b}�(H�T��B�B�B �E(�D0�D8�Gp.
8A0A(B BBBFD���xF�E�E �A(�D0�t8H@OHFPI0A(A BBBTd��F�E�E �B(�A0�D8�G@eHKPHXA`I8A0A(B BBBF@P�X��F�E�E �B(�D0�I8�D@zHHPOXD`I8A0A(B BBBT���pF�E�E �E(�K0�A8�DP�XK`KhEpN8A0A(B BBBIPh���!E�W����4A�h
GCL�����B�I�B �A(�D0�P
(D BBBD~
(D BBBH(�p��A�D�D@N
AAG, ���A�C
B�J�N��D��
EpP���F�B�B �E(�A0�D8�T��
8A0A(B BBBD��N�u�A���E�D�D�]�$zRx��������,Zz�a$	��[E�M�D DA0,	��oE�A�D W
AAEDAA `	�8J�`
AFA� �	 �EJ�g
GFA�h�	L��O�B�D �D(�G0k
(C� A�B�B�MP
(A� A�B�B�JD(A ABBF����\
��O�E�D �A(�G0
(A� A�B�B�Kn(A� A�B�B�T0����8t
��O�D�D �l
ABJP���F ���zRx� ���$�x�8�
��T�D�F qFAJ��H ��`FA$ �9E�D�G fAAHH,�F�E�B �B(�A0�A8�D@:
8D0A(B BBBAH���yF�B�B �B(�A0�A8�F�}
8A0A(B BBBE8���F�D�A �V
ABD>
DBA$�E�A�F �CA0D��1E�D�G M
AAADGA8x��pY�D�H �ABD���A ���8����F�B�A �D(�D`L
(A ABBEp�d�vO�B�E �B(�G0�A8�DPf
8A0A(B BBBDr
8I�0A�(B� B�B�B�LM������ zRx�P������(-v�P@�
8�F�B�B �A(�A0�D`z
0A(A BBBF4�
��r�B�D �D(�L0q(A ABB\<�F�B�B �B(�A0�E8�D@J
8G0D(B BBBMp8A0A(B BBB8x��F�E�D �D(�D`S
(A ABBH0��LE�A�D l
CAFDFA�,�C �h�VJ�l
JFJ� ��V@4��F�B�E �A(�A0�DpZ
0A(A BBBK zRx�p�����(it�(L� �vF�E�D �D(�D0y
(A ABBJ�
(F ABBA0P�B�I�E �G0�
 AABAzRx�0���$�s�(|l��GO�B�B �B(�A0�A8�D`�
8G�0D�(B� B�B�B�L8A0A(B BBBA������A`������ zRx�`������(Es�($$ �8E�I�G TIA$L8�3E�I�D WDA$tP�3E�I�D WDA�h�!���7���/H���~F�B�B �B(�A0�A8�Dp�
8A0A(B BBBD8$�?F�E�E �D(�D0�[(A BBB`�Ht��F�B�B �B(�A0�A8�DP�
8D0A(B BBBF`�q�Q<���F�B�E �D(�G�
(A BBBGH!�F�B�E �E(�D0�D8�J��
8A0A(B BBBD$zRx��������,Fq�(�(&�@�$&��F�E�E �D(�D0�D��
0A(A BBBB(��'�OE�D�D@z
AAA0 �'�tF�D�D �D@D
 AABF0T@(�\E�A�D 
DABFDA �l(�ME�J0w
AA(��(�lE�G�D@A
AAE8��(�F�B�A �A(�D@
(A ABBA0p)�F�A�A �D0s
 AABA<H�)�J�A�D j
G�A�OLAAB��` ��@�L*�J�A�D j
G�A�OLAAB��` ��H��*�mF�L�A �C(�D0
(A ABBAD(C ABB`�*�F�B�B �E(�D0�A8�GP�
8A0A(B BBBF�
8A0A(B BBBD8|�+�F�F�D �A(�D`J
(A ABBK@��-��F�B�B �A(�A0�DP�
0A(A BBBA@�x.�F�E�E �A(�D0�GPc
0A(A BBBID@�.�bF�E�E �E(�H0�D8�D@b8G0D(E BBB\�/�F�B�B �B(�A0�A8�DP�
8F0A(B BBBCD8C0A(B BBB4��/��F�A�D ��
DBJAAB< 40�yJ�B�D �D(�D0T(A ABBF����4`t0�ZF�A�A �|
ABIFAB4��0�eF�E�D �C(�D0H(A ABB4��0�F�A�A �y
ABDQ
ABT,\1�^�D�D �N�A�B�8�1�
LL�1�F�I�B �B(�D0�D8�G�>
8A0A(B BBBF�8�
�8�
d�8��F�B�E �B(�D0�D8�G@�
8A0A(B BBBD�
8D0A(B BBBE�j�a@d:�
T`:�4h\:�lE�D�G �
AAFD
KAHzRx� �� �j�,�d;�qZ�D�D �D�A�B��;�
L�;�$F�L�B �B(�A0�A8�J�
8A0A(B BBBAd�A�
x�A�
(��A�FM�D�G �jABL��A��F�B�E �D(�D0�Z
(A BBBJ[(D BBB�`i�P8C�
04C�LD0C�F�B�A �A(�D0Y
(J ABBJJ
(C ABBF8��C�F�A�D �o
KBI�
ABD$�h�P,��D�aH�D�A �LABD���(E�?F�D�C �nAB(@$E��E�C�J��
AAAl�E�+4��E�F�G�D �A(�D0g(D ABB`�<F�F�B�B �B(�A0�A8�G@�
8A0A(B BBBBB8I0H(B BBB�g�P(0DG�zF�A�G �dAB��g�P(p�G�F�A�I �g
ABF$��G�4E�I�D XDA�H�&I�\(�H�2F�I�A �^AB4(H�_F�A�D �q
ABAMNB(DPH��A�D�J��
AAAp8g�+AAbH��H�#F�B�B �B(�A0�C8�D@y
8C0A(B BBBGL��I�	B�E�F �B(�H0�A8�D�\
8A0A(B BBBF��f�a4< �R�jF�E�A �I(�D0G(D ABB$t �R�pE�A�D bAA0� S�7E�D�G R
DAIDAA8� $S��F�D�D ��
JBDE
AFD`(f�U8 !�S��F�D�D ��
JBIE
AFD�-f�U0t!`T��B�D�D �J��
 AABA0�!U�B�A�A �G@�
 AABDL�!�U�dB�D�E �B(�A0�A8�K�x
8A0A(B BBBD��e�(@"^�|M�D�I �^AB(l"X^�F�D�A ��AJ0�"�^�7E�D�G R
DAIDAA�"�^�L�"�^�,F�E�E �D(�D0��
(A BBBBN
(E BBBG !7e�((D#�_�E�A�D0n
AAFzRx�0�� e�( �#`�E�D ]
AIzRx� � �d�(L�#``�F�E�D �D(�G0~
(A ABBBU
(A ABBEzRx�0����${d�(|$�`���$�a�E�T�$�a��$Gd�+AAb$�$�a�S�X
EX�K�(%0b��A�A�G �
ADI$0%�b�cA�m
BR
FZ\ �c�PDl%c�B�J�E �E(�K0�A8�D@f8D0A(B BBB�%`c�HMzRx��c�(�%<c�	8&8c��F�A�A �r
ABCa
CBJ�bc�xH\&�c�F�B�B �A(�A0�Y
(D BBBAD(A EBB�&�c��&d�5�&4d�H�&@d�F�B�B �B(�A0�A8�D�s
8A0A(B BBBA�$�b�x0D'j�F�A�A �D@�
 AABJzRx�@���$c�P8�'8l��F�B�A �K(�D@�
(A ABBFzRx�@����$�b�P(�l�iHP[
A88(m��F�B�A �A(�D@�
(A ABBA��b�(@�(�m�F�B�B �A(�A0�D@�
0A(A BBBA zRx�@�����(rb�(()0n�E�A�N0o
AAA0)�n�D)�n�(A�b(`)�n�aF�H�A �GDB�)�n��)o�VHe
A��a�PH�)4o�/	F�B�B �B(�H0�D8�D`1
8A0A(B BBBI4�a�QL0*x�F�B�D �A(�G0�
(D ABBKR
(M ABBL@�b�($�*0{�7E�H�F ^DA �*H{�E�F ^
AF sb�(�*�{�+�{�(+�{�\F�A�D �`
GEI� 3b�(0\+�{�\E�D�G0M
DANbDA�+�{�K��
A8�+�|��F�B�B �D(�D0�u
(J BBBI�)�a�(X�+(}�mF�B�B �B(�A0�A8�D`�
8F0A(B BBBDehUpLxH�K`psa�Pl,(�L�,$�rB�E�B �B(�D0�A8�D��
8A0A(B BBBF8*Ka�(�,@�� �,<��E�F e
AG\	'a�($0-���?E�J�D fDAX-̂�(l-؂�JF�G�G �rAB�-���$�-��BE�J�G fDA�-0��H�-<��2F�E�E �E(�D0�C8�G@�
8D0A(B BBBK$-7`�H.��HB THd. ���F�E�H �E(�D0�D8�D@�
8D0A(B BBBH�-�_��.���HB TH�.����F�H�E �H(�D0�A8�DP
8A0A(B BBBC�!I_�(@/D��4T/P��A�A�D k
AAED
AAB0�/���qB�A�A �D0_
 AABA(�/��B�P�A ��AB0�/���B�A�A �D@�
 AABE�}^�(840��?B�B�A �A(�D@

(A ABBFHp0��B�J�E �K(�A0�l
(A BBBHa(A BBB<�0���<B�E�E �D(�G0��
(A BBBF�0���H P
A1��H [
EzRx� y]�(`1d��"HY�u]�(H�1h��F�E�E �E(�A0�D8�D@�
8D0A(B BBBA(�1��4F�G�I �ZAB20��	(2,��/E�A�D@S
AAAzRx�@�� �\�P(t2��%E�A�DP�
AAIzRx�P�� �\�(p�2ԑ��A�A�D �
MMLZ
DAIt
FWGT
AAJD
DAGD
DAG\DA�I\�(HX3<���F�B�B �B(�A0�A8�Dp�
8A0A(B BBBK zRx�p������(�[�P4�3���
A�A�D0O
AAI�
AAD��[�P(4l��fE�J UA@H4���F�B�B �A(�A0�D@�
0A(A BBBH��[�P �4��]E�D0.
AH8�4@��bF�B�A �A(�D`�
(A ABBJ�0�[�P(5`��OE�D�D@z
AAA8@5���eF�N�D �A(�GP�
(A ABBB�0y[�P$�5���eE�A�D MHA�[�(�5ؠ�fE�b
Iu�0�[�(`6��F�B�B �B(�A0�A8�D@
8A0A(B BBBJw
8D0A(B BBBLT51[�Tx6L��-F�B�A �A(�D`t
(A ABBHh]pVhB`�h]pXhB`�2e[�h�6��A�hG�H7����F�L�G �J(�D0�A8�G@u
8D0A(B BBBG<6Q\�x(`7��3F�A�A �cAB�,�\�(H�7��IF�L�J �E(�D0�A8�G`�
8A0A(B BBBD'Q\�xH8���F�J�L �E(�D0�A8�GP�
8D0A(B BBBD�*i\�x<`8���qF�B�B �A(�A0��
(A BBBK�6�\��8�8����F�B�A �A(�D0�
(I ABBI�]�9P��\9\��ZF�A�A �O
ABFI
ABLF
ABGo
ABFF
ABGx9\�� HS�]�(�9P���9L���9H��$H[�\�(<�9L���Hs
EK
EK
EK
E{
EK
EP
Ap�\�((L:��vE�A�G@a
AAAx:<��DE�~�:p��4�:l��ZB�A�A �@
ABIFAB �:���A�J�j
AJ,;0��B�A�A ��
ABD,4;��B�P�C �h
ABHd;���9A�w$�;���DA�D�J kDA`�;̰�
B�B�B �B(�A0�A8�D@u
8A0A(B BBBC
8J0A(B BBBN�:[�( <d��Ta�r@<<���A�A�G d
AAAW
AAGs
AAK�!�Z�(l�<p��F�B�B �B(�A0�H8�N@�
8D0A(B BBBI_HHP^HA@N
8A0A(B BBBB0=���E�A�N t
AAFTDA8=��AA�{X8	Z�(Lh=<���B�E�B �A(�A0�GP�XH`bXAP�
0A(A BBBG0�=���7F�D�A �G0�
 AABC@�=ȷ�K�A�A ��
�C�E�OA
ABDh����3UY�x$D>���GA�A�D ~AA(l>���gE�A�N@�
AAE8�>����B�E�D �D(�J��
(A ABBA(�>���pA�I�G@W
AAAL?��B�B�D �D(�D0r
(A ABBH�
(C ABBF�X�P(d?���E�A�D Q
DAH�$�X�(8�?��rF�A�D ��
ABE�
ABG45�X�(H�? ��B�B�E �L(�A0�D8�Dp
8A0A(B BBBG�]X�(T@`��h@\��0|@X��F�A�D �G@�
 AABF<X�(4�@ ��ZF�A�A �D
ABAFAB�@H��!Ad��@$A`���S�A�A �b
ABFJ�H�B�T ���LhA���:N�A�G `A�A�P ��P
H�A�Ol
D�A�OH�A���`�B�A �A(�D08(A ABBJ����H0������V�(B��!0,B8���F�A�A �Dp�
 AABFzRx�p���$�V�`�B���(�B���
E�A�D@r
AABH�B����F�G�E �E(�D0�G8�Q@�
8D0A(B BBBJ0 C4��F�D�J �G0c
 DABKHTC���F�G�D �F(�Q0q
(D ABBFL(D ABB�C4��$H[��U�((�C8��E�A�D@�
AAC��U�((D���A�P�F0�
AAH@8D���F�B�E �D(�A0�Gp�
0A(A BBBD5IU�P �D���E�|
OS
M8�D���.B�D�D �
FBOZ
FBND:%U�((E���sV�A�J iK�D�<0E��[E�A�D n
AAFD
AAJDAA(pE$��E�O�G N
FML+�T�(H�E���hF�N�B �B(�A0�A8�J��
8A0A(B BBBF$zRx��������,AT�(08Fl��F�P�A �G0�
 AABG@lFH��F�B�B �A(�A0�D��
0A(A BBBI zRx�������(�S�(@�F����F�P�A ��
ABAT
ABIGAB�<�S�(@Gd��>H u0XG����E�D�D0�
CAAPCAL�G(��F�B�B �B(�A0�A8�G�
8A0A(B BBBKDES�8�Gt��F�B�A �A(�G`�
(A ABBC(D7S�((@H$��E�O�G W
FMK lH����E�D �
AA �HT��E�D 
AG�H���+�H����E��,�H���F�M�F �m
ABGLI��-F�N�A �D(�I0v
(A ABBB\
(A ABBN$%'R�(8xI��F�M�D ��
ABE{
DBO?�Q�P,�I���F�F�K ��
ABJ$�I���^E�D�D NAA$J���+E�e @J��E�D p
AF$dJP��HE�A�G xAA,�Jx��F�A�D ��
ABC@GQ�(H�J��+F�B�B �B(�A0�A8�G`y
8D0A(B BBBE4:Q�P0K��HIHHK��B�E�B �E(�A0�G8�Dp�
8A0A(B BBBF��P�(�K����K���0�K��F�A�A �D0�
 AABB�;�P�P(L��lA�O�DP#
AAG��P�(<\L���E�A�D _
AAEQ
FAHDDA2P�P�LD��<E�R
I[@�Ld��E�A�D f
OAH^
FJJD
QFEx2WP�(0,M���F�A�A �GP�
 AABEzRx�P���$P�P�M�QDg
E`8�MP��F�E�A �A(�G@@
(A ABBF&�O�P0N��[E�A�D h
AAD`AA�3�O�PxLN��!W�L�B �A(�A0�@
�(F� D�B�B�KM(A BBBD�����`0�����K�(D� E�I�G�(�N��QF�A�D �jSD$�N��kE�A�D PKA�4gO�(84O�F�A�A �H
ABES
ABB�D;O�x,�O@�jB�A�A �G
ABB0�O��GE�D�D Q
AAHMID�O��?Hr8*#O�(\P���F�B�B �B(�D0�A8�D���T�K�A�
8A0A(B BBBF�M�N�x�P(	�8�P$	��F�B�A �A(�D@�
(A ABBG�(�N�xH�P�	��B�E�B �A(�D0�p
(A BBBK�(C BBB0<QH
�SE�I�D Q
AAKQIDpQt
��Q�
�8E�b�L�N�(\�Q�
�%F�B�B �B(�A0�D8�G�^�O�X�A�`
8A0A(B BBBH$zRx��������,'N�xTR �E�Y(pR$�Qa�A�D gAAA��$�RX�fE�A�D YAA(8N�x4�R��E�A�D `
EAHq
AAEt8CN�(0$S��VE�A�D w
AAEDDA�8#N�($lS��IE�A�D uDA�8N�P�S��jHW
AI.+N�((�S(�E�A�D0�
AAD@T��B�B�B �A(�A0�G`
0A(A BBBB zRx�`�����(�M�x�T@�E�PH�TD�?F�B�B �B(�A0�A8�Dp�
8A0A(B BBBAL!�M�LU$��B�B�A �A(�D0z
(G ABBHb
(I HBBI1[N�P0dU���F�A�D �D0�
 AABGdEcN�(,�UX��O�A�A ��ABH���4�U���F�F�A ��
ABCqABhKN�PH(V��UF�B�B �B(�D0�A8�DP�
8A0A(B BBBDI�M�(0�V��F�A�A �G@	
 AABD0�V��WE�A�D y
DAHDAAT<�M�(W�?HrT1�M�(00W$�F�A�A �G0�
 AABH0G�M�(|W��?Hr�1M�(0�W��F�A�A �J@�
 AABKh0_M�(0�W���F�A�A �G0�
 AABD�G;M�(<XX�?Hr�27M�(0hXl�"F�A�A �J@�
 AABD(1M�(4�XP�OF�D�A �e
ABEIGB@N�L�(0YT�E�A�D v
KFODQFL4Y��3F�E�B �B(�A0�A8�D��
8A0A(B BBBC<�Y�&�K�A�G V
E�A�ID
AABP��,�Y�&�B�D�D �c
ABHHOL�PHZl'�B�B�B �B(�A0�A8�DP�
8A0A(B BBBA�L�K��LhZ(��B�B�A �A(�G0r
(A ABBKy
(C ABBGx6cL��(�Z�(�A�H�G O
DALH�Z�(�F�B�B �B(�A0�A8�D�h
8A0A(B BBBD�X�L��X[<+�Hl[H+�F�B�B �B(�A0�A8�D@n
8D0A(B BBBC�ZM�P�[�+�4�[�+��F�D�G ��
ABHUABlQM�P,,\(,�AT�E�D �^ABB���\\\H,�(F�B�B �B(�A0�A8�D@�
8I0H(B BBBJU8A0A(B BBB�[�L�(D�\-�F�B�B �E(�A0�D8�D@�8A0A(B BBB\�L�P\,]h-��F�B�B �A(�A0�M
(A BBBHd
(A BFBIv(A BBB|[_L�x(�]�-�E�A�D a
AAK0C�L�x4�]D.�F�B�A �A(�D0y(D ABB�9�L��H,^�.�B�B�B �B(�A0�D8�D`�
8A0A(B BBBB(x^l/�<F�D�D �fAB�^�/��K��
AzRx�� �L�(�^0�K��
A_�0�HM$_�0�,H\t9�L�(P_�0�K��
Al_81�K��
A�_�1�5E�k$�_2�5E�I�D YDA$�_2�8E�I�D \DA8�_02�F�B�A �A(�D@r
(A ABBJL8�K�D`�3�'H^�:EL�(0p`�3�E�A�D A
AACfKDF%L�(4�`�3�F�N�A �A(�D0c(D ABB(�`$4�zF�A�A �^ANpV�K�P80ad4�PF�E�A �D(�G��
(A ABBH zRx������(�K�P4�a@5��F�B�A �A(�D0�(I HBB�=�K�P�a�5�$b�5�,b�5�$,b6�$@b46�$TbP6�hbL6�Q|b�6�$�b�6�$4�b�6�E�A�G R
MHLTAA�b87��b47�\c07�B�D�B �B(�A0�A8�D@e
8F0A(B BBBDD8C0A(B BBB,dcp7�B�H�A �X
DEL�cMJ�+AAb,�c�7�B�F�K ��
HBC �c48�lE�G0Y
AAd�8�E�Q$_�I�44dp8�:F�E�D �D(�G0I(M ABBldx8�O�W
Z0�d:�rE�A�D O
DABLDAL�dd:��F�B�D �A(�D0�
(D ABBGL
(D ABBKe;�H$e;�F�B�A �A(�D0|
(A ABBHL(A ABB0A�H�P�e`;�}�e�;��et<�#HZ@�H�P�ex<�HO,@�H�(0fl<�wE�O�G |
AAGPAA<f�<�Z`NF�@�H�pf$=�^r�@bH��f�=�7Hc
EF�@3H�(�f�=�*E�d�a+H�(4g�=�F�A�A �{
ABJDAE�\H�LLg�=�vF�B�E �E(�D0�C8�G�'
8A0A(B BBBG$zRx��������,�G�-�g�>��g�>�JE�b
IUh(?�E�X,(h,?�jF�O�A �@
ABG Xhl?�y\�{
�YD�(|h�?�bE�A�D0�
AAE<E�F�98�h�A��F�E�A �K(�G@
(A ABBEA�F�(8ixC�BF�E�D �C(�D@~
(A ABBF0Hi�D�F�O�A �G0[
 AABD@|i�D�F�B�B �A(�A0�DP�
0A(A BBBH zRx�P�����(�E�}8�iH�F�B�A �D(�D0C
(D ABBK84j�I�F�A�A �L
FBDH
IGH(pjJ�E�A�D@R
AAB\8�E�(�jDL�HE�A�D@p
AAD�8F�P,�jPM�R�A�A ��
�D�E�I8$k@N�F�J�E �K(�A0�Z(A BBB`k�N�1QU�E�E�(�k�N�0�k�N�E�A�D u
MMGDDA8Q�E�P�kO�	�kO�/l4O�"HU`F�E�(T<l8O�F�B�B �A(�A0�J8I@W8A0A
(A BBBAN(F BBB�jKE�(�llO�K��
A(�lP�dF�G�D �HDB�lDP�E��
XDh�D�(0$m�P�E�A�D i
MMKDDA�R�D�(8lm8Q�F�B�A �A(�D0�
(A ABBJhI�D�P�m�Q��8�m0R�KF�E�A �C(�D@J
(A ABBE nDS�vE�D �
AHtJsD�9Hn�T�	8\n�T�F�B�A �A(�D0`
(F ABBGXJHD�P�n�T�GH O
If<�nU�,F�B�J �A(�K0��
(A BBBG`o�V�F�B�B �B(�A0�A8�D@�
8A0A(B BBBH�
8A0A(B BBBBHpo�X�F�B�B �A(�A0�`
(D BBBJC(D BBB�mtC�( �o�X�E�G K
AH�o0Y�%pLY�#,phY�QY�A�D �gABH���Lp�Y�``p�Y�F�B�B �B(�A0�A8�D@
8M0M(B BBBND
8D0A(B BBBO�o�B�(`�p�Z�-F�B�B �B(�A0�A8�D`�
8M0M(B BBBGD
8D0A(B BBBOT`DB�PPPqt\�F�B�H �E(�D0�G8�DPHXG`XXEPK8A0A(B BBB<�q�\�F�G�E �A(�D0�

(C BBBF�o�A�( �q�_�A�G�K
AD r`�;A�u8<r8`�LB�D�D �s
ABHa
ABD0xrLa�B�A�A �G0w
 AABJxbLA�($�r�a�7A�D�G ]AHL�r�a�'B�E�E �B(�K0�I8�G��
8A0A(B BBBH8s�i�2Ls�i�	(`s�i�E�X
C{
EE
KP�sHj��sDj�(�s@j�IF�A�A �}AB4i@@�((�sPj�E�A�D@�
AAA�A(@�(4t�j�0Ht�j�O�O�G _
H�A�Kh��(|tk�k�O�G G
AAF �t�k�aVg
KDLDO�?��t�k��t�k�u�k�!0ul�L�O�G c
F�A�Lh��Pudl�dupl�4xull�|F�D�D �G�J
 AABEzRx�����$�>��u�m�A�~
Am8v n��F�B�A �A(�GP 
(A ABBI0@v�p�/F�I�A �FP
 AABE)>�<�v�q�F�E�D �D(�G�l
(A ABBD zRx������(�=�\ws�F�B�B �B(�A0�A8�D@�
8A0A(B BBBGZ8A0A(B BBBPvK=�6 tw�s�iH@
HD
LD�QI=�(�w�s�<E�b
IKT�wt�gF�E�E �E(�D0�A8�D`FhdpghA`�
8A0A(B BBBGH$x u�F�B�E �E(�D0�D8�JpC
8A0A(B BBBG�D�<�P�x`v�E�X�xdv�E�L�xhv��xdv�H�xpv��F�B�D �C(�G0G
(F ABBHQ(A ABB0y�v�(Dyw�E�O�G �
DAI8py�w�B�B�A �A(�D@�
(A ABBD4�yHz�E�A�D n
CAD
CABH_u;�(�y�{�EH w
Az�{�eH W
A0z|�(H _<Hz,|�[E�A�D n
AAFD
AAJDAA �zL|�<E�G V
AE0�zh|�F�O�A �D0�
 CABGH�z�}�F�B�B �B(�A0�A8�D�@
8A0A(B BBBD$zRx��������,-:�a0h{,���F�A�A �D@�
 AABA(TF:�6�{ԃ�*H a(�{��E�C�D0�
AAF�X$:�((|l��E�O�G i
AAJ4|��HH|܄�F�B�B �E(�A0�D8�Dp$
8A0A(B BBBJ�H�9��|���|���|��+�|0��4�|,���E�A�L g
DAJl
DAG0}��D}��X}��4l}���gF�A�D �G��
 AABE �}Љ��E�G s
AHZ9�( �}h���E�G s
AH@Z9�(~��.E�d0~��;TU(L~8��gE�D�Q W
KAK,x~|��qF�F�K �A
ABE$�~̍�^E�D�D NAA�~��+E�e$�~��E�D p
AF$���CY�D�G WFA<���$P���7E�D�G `AA8x���PB�B�D �C(�KP�
(A ABBE�Џ�L�܏�EB�G�B �B(�A0�D8�G��
8A0A(B BBBF�ܑ�3E�_
D8{�6�(H���I\�(��@A�S
Dg�{�6�((��4��q�D�G l
G�A�H(�����vY�D�G l
G�A�H4���F�L�I �A(�D0�(D ABB �ē�2E�e
FA4@���F�J�K �A(�D0�(D ABBx�l��!E�[�����E��
GQ ����E�D Y
AA^�5�(�x��~E�x}�5�PH�ȕ�BF�B�B �B(�A0�A8�N��
8A0A(B BBBE$zRx��������,h5�P,������E�D�GP�
AAB8Ԃ@���B�B�A �A(�N0p
(A ABBF���$$���&A�C�G PHA4L�����[�A�G �
FAED
CAH0�����E�A�D @
AADdFAi�4�(̃؛�/E�b ���E�R
Ia
A8�X��R�M�E �K
�A�B�NA
ABDLH�����F�B�A �A(�D0�
(F ABBL�
(I ABBJX`�3�PL��(��zF�B�A �A(�G0_
(C ABBHa
(C ABBGL��X��F�B�A �A(�D0�
(D ABBI�
(I ABBJat3�x8`����F�E�A �A(�DPG
(A ABBA��3�((�����rE�R�G x
IAH(܅��rE�R�G x
IAHD�\��GE�O�G 9
AAJ|
AAB]
FAL�k3�(Ld�P��F�E�D �D(�G0
(M MBBKD
(D ABBK$�����7E�K�G ]AA$܆���>E�D�N dAA$����GE�D�N mAA,�ئ�*H]|aD2�(<X�ܦ�F�B�B �A(�A0��
(A BBBI��2�((�����E�G�G@�
AAG,؇���>F�A�A �-
ABA\}�1�(0����7E�O�D �
AAJtAA�m�1�(d����E��H��$��F�O�H �B(�D0�H8�Dp�
8A0A(B BBBI4̈x���E�A�D s
AAAWIAhn$1�((����E�A�G@�
AAJDD����eB�A�A �o
ABJ
ABG�
ABI4����F�A�A �p
ABEnAB�0�(؉\��5O�W�X����nA�A�G }
AAHH
MMND
DAGo
FMNDDAP����"E�X4l�����E�A�N �
AAHL
DAOp�/�P\��L��RF�B�A �A(�G0�
(A ABBBP
(D ABBGq
(D ABBF��/�+AAb$4�0��a�T
KG
INL\����F�B�B �I(�D0�A8�D�Y
8A0A(B BBBA�G/�9H�����F�I�H �B(�K0�A8�D@�8D0A(B BBB�x��BE�m
NA,����E�SLH�����E�O�G �
CAE�
FAEL
FAEk
CAI��L��	��H��(��D���E�G�G0�
AAA�@/�EAH0����F�A�A �GPd
 AABI(<�H��OE�A�N08
AAB�i�.�98|�X��7F�A�D �~
ABLV
ABO ��\��E�G ]
AFD܍H��B�A�A ��
ABBK
ABB]
ABH8$����F�B�A �D(�D@
(A ABBJ|f.�x8t����F�A�A �p
FBHQ
ABL(�����E�A�N �
AAH4܎���E�A�N �
AAHYAAH����F�B�B �B(�K0�A8�DPX
8A0A(B BBBBD`�D���F�J�B �L(�D0�A8�DP�8A0A(B BBBD������F�J�E �O(�D0�E8�DP�8A0A(B BBBH����F�B�B �B(�A0�A8�D`V
8A0A(B BBBAT�,�(T����mF�A�D �VEB��$��CA�}8��X��F�E�J �D(�H0�\(A BBBؐ���jE�Y��,�(,����F�A�A ��
ABJ���+�>$L����vE�v
EJ
Fe@t���CF�B�B �A(�D0�D@�
0A(A BBBK�h�+�C̑��E���+�GZ
E0�����B�D�D �DPl
 AABB80�����F�E�D �I(�G@e
(A ABBF(l�8��F�A�D �tAB�[+�6�����	�����4Ԓ���cB�B�A �A(�D0R(A ABB����&E�\(����[A�YH��*�@X����F�I�B �D(�A0�D@�
0A(A BBBA�j�*�$$�����AE�I�D iDA$ؓ���RE�A�D DAA@���hF�E�J �D(�D0�D`i
0A(A BBBF�?*�D(X�,��o�A�G }AAJ�������E����*�`_��\��8A�v؏3*�H�l��F�B�B �B(�A0�A8�G`
8A0A(B BBBDL��)�3H����^A�Qh��)�(4x����gF�J�D �D(�D0A(D ABB$��$��E�A�D yAA<{�)�(�x��,E�[����+E�^$����8����4E�gX�M)�((l����A�A�D t
AAD�{1)� \��(��-B�E�B �B(�A0�A8�J���I�I�I�M�W
8A0A(B BBBA �����H k
EG
A0����*H a4H����kF�L�I �A(�D0A(D ABB0����F�A�A �D@�
 AABAL������F�B�B �B(�A0�A8�G��
8A0A(B BBBH$zRx��������,�'�@����K��
A\����&E�`|��'�4�����bB�F�D �A
ABHFAB0���B�N�F �D@W
 AABK�q�'�H�8��B�E�B �E(�D0�A8�Dp�
8A0A(B BBBA�eB'�YHl�����B�D�B �B(�A0�A8�G`Z
8A0A(B BBBIЈ;'�%4̙h��wB�A�A �N(Q0a(A ^
ABAX�'�?(����~A�A�G0x
AAE(D����mF�P�A �RABp�4��!@��P���F�E�B �A(�A0�G@z
0A(A BBBHHȚ���(F�B�E �B(�A0�D8�D��
8A0A(B BBBA8����F�A�A �U
ABHF
ABG��&�(Hd� ��'F�B�B �B(�A0�A8�DP�
8A0A(B BBBEP��%�($��:E�I�D bDA���Sch<v�%�(�<��)\,�X���B�B�E �B(�D0�A8�G�4�O�Y�A�m
8A0A(B BBBA�����/A�m��'%������T МD���A��
NA
G���$�P(����
A�A�D �
AAG���$�;$H����A�A�G �AAԂ�$�;�� ��%E�[H��4��F�G�B �B(�A0�A8�J��
8A0A(B BBBG,����F�D�D ��
ABGp��$�P00�t���F�A�A �D0�
 AABA0��$�P4x����M�I�D ��
DBMAAB�����2E�U
FM(��A�E�D0L
AAH�{L$�(H�4��#F�B�B �B(�A0�A8�D��
8A0A(B BBBBĜ$�PHp���F�I�B �B(�A0�A8�J��
8A0A(B BBBHH����kB�E�E �B(�A0�I8�G@�
8D0C(B BBBK���2A�c
LA8(���?B�B�A �D(�G@
(A ABBB4d���oB�P�I �|
CBDICB0���F�D�A �J0
 AABC��D0�
A�h�OA�M��"�(4���B�A�D �Q
ABEEDB���"�(h���xE�D�D0c
AAA(~b"�0��,��B�C�G �D0X
 AABD ܡ��A�D R
AH@~"�(0�p	��F�D�A �G@K
 AABG(H�,
�E�A�G l
DAJ(t��
�A�A�D a
AAG��!�(8����5F�L�I �E(�G0(D ABB������PH B
A ���H4���*F�E�E �B(�D0�D8�D`�
8A0A(B BBBD��� �(����4��x�B�B�A �D(�D0�(A ABB@�@�Q�I�D �C(�D0\
(A ABBIP����(���.A�lH�8 �X���4l����A�C�N M
AAGiAA���2\��<��F�B�A �D(�G0@
(A ABBFD
(A ABBFD(F ABB ���E�G �
AB|���6<P��aH�E�E �H(�C0�x(A BBBD�������j���0���,�k0̥��F�D�A �D0e
 AABH�t�&E�Y���0L�\(8���E�A�D0n
AAF����x�� ������(���E�D�DPk
AAFDt?�$���WE�A�G ECA���(80���F�B�A �A(�NPH
(A ABBJ����6 ��d�E�K {
AD�������+Hb���(���������� ���4���?Hv��}�(L`���JF�B�B �B(�A0�A8�D�d
8A0A(B BBBH�A�Ĩ�%�ب�%���%�<Hs<���P��%�,��%�	@��%�	T��%�	h��%�	|��%�$E�^���%����%�0���%�uQ�D�G x
AAJRAAX���BH
C�A�E�&�(H[d���(@�&�T�&�*4h�,&�F�B�K �A(�D0�(A ABB$���&�E�G�B
AAzRx��� c�D(��<(��E�A�G0r
AAG$��(�$8��(��E�m
NR
Njd�+� t�p)�E�N@~
AFzRx�@� w�P(ȫ�)�IL�D�F iAAG�� ��)�T�J
�JA
G�\*�fE�Q
J$4��*�E�n
EA
GD\�+�E�p
KO����;$���+�*E�D�J JGAD���+�F�B�B �D(�A0�G�o
0A(A BBBC zRx�������(��n(8��-�aL�D�F ~AAJ��Hd��-�"F�B�B �E(�I0�A8�QPd
8A0A(B BBBHP�t�ĭ�.�<H n
A��.���.�6A�
I��(��/�-E�cD�0�E�T(`�0�*E�D�G PDA��0�A�|
Ki ���0�A�G��
AAЮD1�+E�aH�X1�xB�E�D �D(�F0r
(A ABBCJ
(D ADBAL8��1�AB�O�B �I(�D0�A8�G�
<
8A0A(B BBBB$zRx��
������,��(įP=��E�A�J�@
AAFL�>�F�B�F �B(�D0�D8�D��
8A0A(B BBBB����4T��?�F�A�A �G0}
 AABA��(@�8��4@�B�E�D �D(�GPX
(A ABBD0ܰ�@�F�D�A �G0x
 AABB���+AAbH,�hA�B�E�B �B(�D0�A8�J��
8A0A(B BBBK�k��@��F�B�E�E �D(�A0�G��
0A(A BBBB б�G�E�Q�w
ABH�PH�'F�B�E �E(�D0�A8�G��
8A0A(B BBBCHl��LT� J�m
F�F�B �E(�A0�K8�J�d
8A0A(B BBBIH�����,T�xK�g
A$Բ�T�2E�A�N XDA���T�HS��T�+E�S0��T�D��T�X��T�Hl��T�F�B�B �B(�A0�A8�DP�
8A0A(B BBBHX���8̳hU�wB�A�A �v
ABC�
ABH8��V�sF�L�J �D(�A0�J(A BBBHD��V��F�B�B �B(�A0�A8�Dpz
8A0A(B BBBJ���8��`X�F�A�A ��
DBFA
ABA4���PL� Y�F�E�B �B(�A0�A8�J�W
8A0A(B BBBDLo��@\��_��F�B�B �A(�A0�G��
0A(A BBBA zRx�������(��(ص\`�(�X`�E�A�G��
AAEzRx����$c�HL��a�'E�a(l��a��B�I�L ��AB`��lb�-F�G�B �B(�A0�D8�DP�
8A0A(B BBBHv
8C0A(B BBBF��8c�HM�@c�(�<c�*Hax���((T�@c�uF�D�D �cAB8���c��F�E�D �G(�J0}
(A ABBEH��8d�=B�B�E �E(�G0�D8�G`
8A0A(B BBBH ��P(�g�jE�R�G {
AAE0H�\g�SF�F�D �N@�
 AABB4|��h��E�A�G V
AAKcAA(��0i��A�A�D0�
AAAt�{�((��i�_B�I�K �AAB4 �j�]M�A�A �|
ABJAAB8X�,j�M�B�B �A(�A0�o
(F BBBB����(8��|k�F�A�D �W
ABK^
ABG8�l��B�B�A �D(�D@O
(A ABBF ��l�E�S(<��l�N�D�D �
ABH8h�,m��E�A�D ]
AAGTHAL���m�{F�E�B �H(�A0�L
(A BBBGA(C BBBH�n�mF�B�E �B(�A0�D8�DP�
8A0A(B BBBFL@�$o�
F�B�B �B(�A0�D8�G��
8A0A(B BBBJ$zRx��������,��PH̻8y�B�B�B �E(�D0�D8�DpT
8A0A(B BBBK��|�HO\0��|�B�B�E �B(�D0�A8�D��
8A0A(B BBBCt�J�S�A���k�(���+AAbH��4�B�B�B �B(�A0�A8�D�_
8A0A(B BBBIt�B�UH �d��xB�B�B �B(�A0�A8�D`K
8A0A(B BBBE��7�6H�����B�B�B �B(�A0�A8�Dp�
8A0A(B BBBJ,�
�H�ă�B�B�B �B(�A0�A8�D`�
8A0A(B BBBHD���H@���B�B�B �E(�G0�D8�GPQ
8D0A(B BBBE,�i����D��BE�u
FA��t��HV���(�h��NE�H����HVX���(4����NE�HP�Ć�	d����x����@��Ȇ�F�B�E �D(�D0�DP
0A(A BBBG��	H����F�B�E �E(�D0�D8�D`
8A0A(B BBBHH���LD�Љ�M�E�D �D(�F0A
(A ABBID(F ABBA��������	T����F�E�E �E(�D0�K8�D`nhGpThA`x
8A0A(B BBBA���`��HE L<0�d��F�A�A �D0P8B@F8A0[
 AABAHp����.F�B�B �B(�A0�A8�DP�
8A0A(B BBBH\�m
�(����L����B�B�B �B(�A0�A8�G��
8A0A(B BBBE$zRx��������,��p���L����,F�B�B �B(�A0�A8�G�
8A0A(B BBBAx�
�\H��ܕ�MF�B�E �B(�A0�D8�D`t
8J0A(B BBBIL�
�0<H�̘�jF�B�B �A(�A0�O
(D BBBAL�����F�B�E �B(�A0�A8�G�n
8A0A(B BBBA@���`H��8��F�B�B �A(�A0��
(F BBBGA(C BBB(���PTL����T�B�B �A(�A0��
�(D� B�B�B�I�(D BBBA�����H����AB�B�B �B(�A0�A8�J��
8A0A(B BBBE�~=�H���tF�B�B �B(�A0�A8�DPT8D0A(B BBB��Dd���#H Z,|�(���B�K�D �q
ABK�g�8�����B�H�D �D(�G0r
(A ABBG��3�(H�d��'B�E�E �L(�D0�A8�G��
8A0A(B BBBBl\�H��F�B�B �B(�A0�D8�G��
8A0A(B BBBA��B�K�A�m�B�K�A�$zRx��������,c�H�\��YB�B�B �B(�A0�A8�G��
8A0A(B BBBC����(h�\��NH0@
A ������E�G0�
AHzRx�0� D�P ����E�G0h
AK�����yH0g
A(����E�A�J@X
AAF��((X����<F�A�A �pAB0�����F�D�I �G0v
 AABA���
�H��(��qF�B�I �B(�D0�A8�GP
8A0A(B BBBA��v
�\,�H��jF�B�D �D(�D0v
(C ABBFl
(H ABBGf
(C ABBJ0��X��F�D�D �L@i
 AABAH��Բ�hF�E�E �E(�D0�A8�D`�
8A0A(B BBBE$��	�L ����F�B�B �B(�D0�A8�D�w
8A0A(B BBBJ���	�(�����E�A�D0�
AAHD��	� ��@���E��
FT
A���������4E�i�S	�,���(@���8M�A�C �cAB8l���fM�B�B �A(�A0�z
(G BBBB����H��8��F�B�B �B(�A0�A8�DPY
8F0A(B BBBB����H�h��F�B�B �B(�A0�A8�DP^
8C0A(B BBBD4h����UF�B�A �A(�D0@(A ABBH��Է�mF�E�D �A(�D0~
(A ABBHD(C ABBD�����sF�B�B �B(�A0�A8�D@V8A0A(B BBBH4�0��`F�B�B �B(�G0�A8�Jp
8A0A(B BBBG��(��0����,��0��8��MA�A�D N
CAHhCAT���$�@��IE�I�D qDA,�h��0@�d��E�A�D X
AADcAAسm�((�����6E�D�G 
CAE�U�V������N�H�I �G(�A0�A8�G`�
8A0A(B BBBG]
8C0A(B BBBGm8C0A(B BBBA������F`������\�ػ��t����q,�����-B�A�A �g
ABBH����� F�I�B �B(�A0�A8�D�q
8A0A(B BBBD0����zF�A�D �D0a
 AABA<���UHiF ]\�X��$H [t�p��>A�e
J@�����B�B�B �A(�A0�G��
0A(A BBBC4�����A�D�G {
JAND
AAJH�H��B�B�B �B(�A0�A8�G�|
8A0A(B BBBI���PHl���F�H�E �E(�D0�D8�D��
8A0A(B BBBEL�����qF�E�E �E(�A0�I8�G�!
8A0A(B BBBG����]$�H��gO�E�U {AA(D����2F�I�A �^AB(p����NF�D�D �|AB(�����=F�D�D �kAB(�����2F�I�A �^AB(�����2F�I�A �^AB$ ���E�A�L lDA$H�l��JE�I�D nDA$p����?E�I�D cDA$�����8E�I�D \DA�������������������C� ��q((����8F�D�A �iAB0T����iE�D�G B
FAGDCA8�����b�F�D �A(�G0h
(A ABBF�����-(�����KF�D�A �|ABD����F�E�E �B(�D0�D8�D@v8D0A(B BBB@�_�8d�P��yF�B�B �A(�A0�e(A BBB�����4�����JF�A�A �t
ABAFAB�����HRL����|F�E�B �A(�A0�J
(D BBBEA
(F BBBA8T����F�E�E �I(�H0��(A BBB��T��BE�l
OA�����#L�����;F�B�F �E(�H0�A8�D�
8A0A(B BBBK|����a,�x��@���'E�]4\�(��E�A�G v
DAHF
AAH�����(�����`vQ
IK�~��(`�����pF�B�B �B(�D0�A8�DP�
8D0A(B BBBGF
8A0A(B BBBH��.��xHT����Q
F�E�L �B(�A0�H8�D�N
8A0A(B BBBB�F���(�����M�I�D �pCB(��4��E�I�D �IA����D{
A`����x(<����A�C�D �
AADHh����B�F�E �B(�D0�D8�Dpu
8A0A(B BBBF<����qc�E�I �I(�D0*(A ABBB����@��P���B�B�B �D(�I0�QP�
0A(A BBBA<8�����F�B�J �A(�D��
(A ABBA(x�|��E�A�M@�
AAE4��P��}F�A�D �J
DBEUAB4�����oF�D�A �A(�D0X(A ABB4���}F�A�D �J
DBEUAB4L���[F�D�D �e
ABJPDB(��@��2F�I�A �^AB4��T��[F�D�D �e
ABJPDB(��|��2F�I�A �^AB(����E�E�D@�
AAA8@�$��F�B�A �A(�D��
(A ABBA zRx������(���P����JE�~�����P4����{F�E�D �D(�M0T(A ABB�8��=E�s,8�\��F�A�A �z
ABK��o��(|���+Q�Y ����E�F C
AA8��h��<F�B�A �D(�DP�
(A ABBDL���(L�X��F�B�B �B(�A0�D8�G��
8A0A(B BBBF@\����F�B�B �A(�A0�D@|
0A(A BBBDص���P8��@�cO�A�D �m
FBGACBJ�����t�-�s��AAMH �t�F�J�E �L(�D0�A8�D`�
8A0A(B BBBEl���:E�i
JA����4����jF�D�D �l
ABCbEB,����L���F�B�E �B(�G0�G8�G�G
8A0A(B BBBK��T��>T�P�O8h���cO�A�D �m
FBGACBJ�������-8����;B�B�D �A(�L0�
(D ABBJ����(4���TF�E�I �D(�D0n(D ABBD���:E�b
QAd��Lx��$F�I�E �B(�A0�H8�G��
8A0A(B BBBC0�.��9d����B�B�B �B(�A0�F8�DP�
8D0A(B BBBM
8A0A(B BBBJ����(X���!E�W,t��RB�A�A ��
HFJ�����x��, �^A�K
AH��l ��L(���(L�!��K�H�B �B(�A0�D8�D`�8A0A(B BBBH������8T��!��B�E�D �D(�GP�
(A ABBD��g��x8�� $�B�A�A �
ABGR
ABK4����xD��p%�B�E�J �E(�A0�K8�D@�8D0A(B BBB$<�(&�OQ�A�K oAAd�P&�A��(���&�VF�G�G �~AB$��('�E�J�D qDA(���'�PF�K�I �rAB8��'�WF�B�B �A(�A0�C(A BBB,����($P��'�vE�D�N UDAx�(�HUȿ��(8��(��F�A�A �J
ABKF
CBE4�W��P0���)�F�A�A �D0
 AABC(�+�4H`x�G��(T�0+�3Hj��C��(��D+�"HY�?��(��H+���D+���@+� ��<+�E�G0S
AH ��+�xE�G0e
AA0�$,�"HY�����(8\�(,��F�B�A �A(�D0�
(A ABBDX����x0���,�F�A�A �D0i
 AABG�������0-��,-�#HZX����(4�0-�2Hi�����(`�D-�#HZ�����(��H-�#HZ�����(��L-�E�S$��P-�8E�D�G eAA��h-�4E�n�8��(,�x-�4E�nL�0��(\��-�p��-����-�r��.�xHo�����(��`.�	��\.�	��X.�	�T.��P.�L(�L.�J�B�B �A(�A0�X
(A BBBA
(A BBBBh�P��(���/��E�A�GP�
AAC��L1�I0���1��E�A�D �
CAJDDAd�h��(� 2��((��2�E�A�D0�
AAA��<��P h�\4��E�D �
AC��T��x ��$5�E�D0�
AE $���(0��6�CF�A�A �D��
 AABG@�(7�B�B�B �A(�A0�G��
0A(A BBBF zRx�������(��( ���7��E�D �
AI�����(H��T8�zB�B�B �B(�A0�D8�D`G
8A0A(B BBBF$����x  �t;�E�D P
AF����PX��;�WH I
AD�$��(0���;�rF�A�A �D0�
 AABD����P(��4=�dE�J�D@�
AABH��x>��F�B�B �B(�A0�A8�D`c
8A0A(B BBBA`����L\�B�F�B�B �E(�A0�A8�N�

8A0A(B BBBE�s��H���H�+F�B�A �A(�D`�
(A ABBD4hhpHhA`�c��x( ��K��A�A�G0d
AAAL�8L�PH0e
C_l�hL���tL�RH D
Al�K��(0���L��E�A�D �
FAHlAAL�'��P4��8M��A�A�G y
AADi
AAI 4��M�kA�N
AN
I(X�N��A�A�G0+
AAJ<���O��O�O�A �C
�A�B�Kh���H ���|���Q��B�B�E �B(�A0�A8�GPI
8A0A(B BBBId
8A0A(B BBBB�
8A0A(B BBBC����8X��S�oF�E�A �A(�G@�
(A ABBG8�� U��F�B�A �D(�GP�
(A ABBA��/��+AAb��>��+AAb�M��+AAbD$�`V�B�A�C �r
ABEj
ABCt
ABI8l�W�XB�B�A �D(�D@
(A ABBH�����-��(X�3��TX���`X�I@���X�E�A�G _
AABQ
AAEh
KAL��q��P(P��X��E�M�I0�
AAE����( ���Y�Q�T
�Kg��q��U���Y���Z���Z�FA�s
LA�4Z�T$�@Z�F�E�B �B(�A0�A8�D`^hIp\hA`]
8A0A(B BBBH|��]�$H[�����((���]�E�A�D0c
AAAh����(��<_��A�A�D@�
AAB�����(��a�OH u
CN���(\��a�{E�q|���(,��Hb�zF�O�D �D
DBMH���b�}B�B�E �B(�D0�A8�DP�
8D0A(B BBBN�����
��d�3H jH4��d�6B�P�E �B(�A0�A8�D@�
8D0A(B BBBLp�>��D���e�LB�B�B �A(�A0�D�J
0A(A BBBB0����( ��g�zE�R U
ACT����(L(��g�F�B�A �A(�J��
(A ABBB��Q�F�A� zRx������(w��\(���k�yE�A�D0�
AAK��l�FE�D {AH��m�ZB�Q�B �G(�A0�A8�DP(
8A0A(B BBBA��'��-4\�n��F�H�D ��
ABIQGB0���n�xE�A�D0N
AAFUAA,��n�^E�D �
AIA
FA8����(8�p�}F�A�A ��
ABAH
ABE��|���0\�Hq��F�A�A �D0D
 AABD\���(@��r�F�B�B �A(�A0�GP�
0A(A BBBK,����@���t�SF�B�B �A(�A0�GP'
0A(A BBBF����P`T��v�
F�B�B �B(�A0�A8�G�g�J�M�I�N�6
8A0A(B BBBF������؃�/H W
AN(����E�A�G0
AAH�����(,�x��(@����E�A�G 	AAl����+AAbP��\��"B�E�A �G0K
 AABBk
 CABGZ
 FABEH�8��B�E�B �B(�D0�C8�DP^
8A0A(B BBBA@(�|��4U�I�I �A(�A0��
�(C� B�B�B�M\����-4��d��E�A�D G
CAKM
FADD�����Y�D�G m
AAEQA�A�U ��K
FAF�4���0��4(�,��iE�A�D _
AAE
AAF�����^(t�P��E�A�D0Q
AAC4�	��x@�����4F�B�E �A(�A0�D@
0A(A BBBA0�)��}0����{F�D�A �D0b
 AABA4@���&Q�A�G L
AAIB
AADx�܎�1O�WJ�����Q��L��(��H��zE�A�D@\
AAH�����P(�����jF�O�A �
ABHH(�̐�ZF�B�B �E(�D0�A8�D`�
8A0A(B BBBI��z��P��̖�h��(��BQ�p��\��F<����E�A�G0R
AAGk
AAKLAAH��uF�B�A �A(�D0M
(A ABBGD(C ABBHX<��@F�P�B �B(�A0�D8�D@�
8D0A(B BBBK��0��J�D�B �B(�D0�C8�GP�XR`HXDPE
8A0A(B BBBGD8D�0A�(B� B�B�B�OP������((\��E�A�D0�
AAJ�����(Xh,��F�N�B �G(�A0�D8�DP0
8A0A(B BBBH�Xs`HXAPd����H����F�B�A �A(�D@�HAPAXA`o@e
(A ABBE($��=F�A�C �oAB�P$��B�B�A �D(�D0b
(A ABBKv
(D ABBIe
(L HDIJl
(D ABBKO
(D ABBH(�0��A�C�D@e
AAA8����K�A�D �y
ABDQ�D�B�p<x��6
F�B�B �B(�A0�A8�K��
8A0A(B BBBJ��d�H�B���K�Z�A������c�0���<��!L�QC��P��WDRD����x, ���B�A�A �G0q AABP��Td��B�B�B �B(�A0�A8�D@u
8A0A(B BBBC_HJP\HA@����(L����4F�P�B �E(�A0�A8�D�u
8A0A(B BBBF�N��P4���+AAb Pd��A�D _
AK��u��(4����E�D�G e
AAIn
AAHH�4��B�E�G �B(�A0�C8�D`�
8A0A(B BBBA$���Ud ���jB�D�B �B(�A0�A8�D`PhKpWhA`G
8A0A(B BBBD�hMpUhA`�����@�����F�E�B �D(�A0�D@f
0A(A BBBD�&��,�0���F�O�D ��
AFJx����8̼�	LLȼ�F�B�B �A(�A0��
(A BBBMa
(A BBBH����(0�$���B�A�D �K@t
 AABFH���rF�B�B �L(�A0�A8�DP	
8C0A(B BBBO0��8D ���F�E�A �D(�D0e
(A ABBA@����P�����
F�E�E �E(�A0�A8�G���m�L�D�I�6
8I0F(B BBBF�
8G0A(B BBBND
8A0A(B BBBB�
8M0M(B BBBLt
8D0A(B BBBO�<��(l	���p@�	T��\F�M�D �I0
 AABDx
 AABE�����(P�	\��WF�B�B �A(�A0�GP�
0A(A BBBGXJ`\XAPT,
h���F�B�B �B(�A0�A8�D@�HLPWHA@D
8D0A(B BBBF�
���90�
��AE�C�G W
CAFLCA�
(���
4��aE�[<�
���6B�B�B �A(�A0��
(A BBBB,	���PdPt��@R�E�B �A(�A0��
�(F� I�D�B�FA
(A BBBHT�(A� B�B�B�<�L���B�Q�B �A(�F0��
(D BBBEH�����F�B�B �A(�A0�w
(A BBBFh(A BBB8D`���B�P�A �A(�D0j
(A ABBH@����((����I�I�D �wAB@�d���F�B�B �A(�A0�D@s
0A(A BBBE<�X��(
���xE�R @
AHVAD
P��?E�o
D8`
t���F�B�A �D(�DPb
(A ABBG�
��E�O0�
���F�A�A �Jpt
 AABF�
���0����F�A�A �D`s
 AABEzRx�`���$��xHh<��mF�B�A �A(�D0D
(A ABBHD(C ABB$�`��8E�A�D kAA�x��9D00����(8���F�L�A �A(�D@�
(A ABBAd����(\��� p���E�D p
AF �p��mE�G k
AH����f,���F�A�D ��
ABH���	<���F�B�B �D(�A0��
(A BBBH@���(d���(x����E�A�D@�
AAAd����P�\��$HW$�t��E�D�D xAA0����F�A�A �D@�
 AABD��~��((@���M�A�A �|AB@l��F�B�B �A(�A0�D@r
0A(A BBBF��"��(0�p��F�A�A �D@Q
 AABG����PH��K�y
D(���E�LD���JH |
A`���7Hn�����P0����F�O�A �G0�
 AABH����(,����F�O�A �o
ABHX���(0��E�A�D J
DAGaDA�����P`T��1QY�����(0�h��F�A�A �D0t
 AABD����P����IQ^
ID,����(���1QYX����(4��e}Hl��1QY�����(t���AT`
DD�����(����2He�����P����E\d$����P���	8���$F�B�A �A(�D0(A ABB����(0d���vE�O�G t
DALLDA(����E�A�D W
DAJ(�V��(�L���H��	@��$E�Z T��9Dpp�
��(4Lh���F�O�D ��
EBOQAB����(0���xE�O�G z
AAIUAA4�X���F�D�A �x
DGJj
ABK������PH B
A84 ��bF�B�A �A(�D0�
(N CBBE0�"��x8�@��vF�B�A �A(�D@;
(D ABBF��J��(�p��-E�g�B��(p��HUT�>��(80d��
F�B�A �A(�D0n
(A ABBF,���0�$���F�A�A �D0R
 AABF�n��4����F�B�A �A(�D0v(D ABB�����8���B�E�D �A(�GP
(A ABBI����P(d���}F�D�A �k
JBN(���OE�D�DPz
AAA0���vE�O�G q
DAOLDA�d��E�T8h��F�L�K �A(�G0I
(D ABBI(H���E�O�G P
AAK0t ��F�A�F �D0J
 AABA ����~E�D [
AK����x���WH I
A����($��RH D
A0,h��F�A�A �G0�
 AABD,���aLt0��F�B�B �B(�A0�A8�N��
8A0A(B BBBE�T�����	�"HY(�Z��(�	�"HYT�V��(00�	��F�D�D �G@n
 AABI4dP
�B�B�D �A(�D0�(D ABB\����(��
�1A�o��
�10�$�FE�A�K \
AAAOAA@�
((<�A�D�G��
AAJT �
h�
|�E�T��5Dp���P�0�AQb�6��(�T�N��E�r, ���F�F�K ��
HBGP�
�HU�����(8|�
�F�A�A �q
ABD�
ABG���(@���F�B�B �A(�A0�GP�
0A(A BBBIT�z��($��3Hjt�v��(8P���F�P�D �A(�D0�
(D ABBH�x�8���5F�B�A �A(�D@�
(A ABBE���E�M���tH [
E�����(( ��< ��	P ��$d ��JE�K�D sAA� ��#� �TDL� \�!HX�2��(� `�HHk
EK<�&��(L!|��F�B�A �A(�G0l8H@a(A ABBD0D(D ABB(h!��rE�O�G B
AAI@�!P��F�B�B �A(�A0�DP~
0A(A BBBJ�z��(�!��d"��F�F�A �i
ABGA
ABDu
ABHt
ABIS
FBMbAE(h"�-F�D�H �SAB0�"��F�D�C �J��
 AABA$�"��NE�K�D pDA0�"��\F�G�D �DP}
 AABA$$#�KE�P�G eDA4L#(��F�B�A �A(�D0�(A ABBD����(�#��QQo
HD����(<�#��E�D y
AE�
ADZ
AEX
AGL���(` $$��F�B�B �B(�A0�C8�G@b
8I0A(B BBBED
8A0A(B BBBBt#n��(L�$��F�B�B �A(�A0�W
(I BBBNy
(A BBBH�"2��(�$8�@%D��F�B�B �A(�D0�DP
0A(A BBBB�����(8h%��rF�E�D �D(�J@I
(A ABBA8�% �F�J�E �A(�D0�r(A BBB(�%t �2E�K�I IJA(&� �A�D�G��
AAG(8&l!�A�A�J��
AAH8d&`"�B�N�D �D(�D@c
(A ABBK�&�#�2�&$��&$�	<�&$��A�A�G }
DAEh
DAKMDA'�$�Ja�h8'�$�L'�$�`'�$�!t'%�!�'%�1�'H%��'D%�Ra�i
�FA8�'�%�F�A�A �
ABH�
DBF`^�� (4'�H4(@'��F�B�B �B(�A0�A8�D`x
8A0A(B BBBD�s��(�(�)�$H[�o��((�(�)�dE�A�D0!
AAC�W��6)�*�NH @
A)+�"E�X8),+�1H hP)T+�KH a
GZ@p)�+�F�A�A �D0d
 AABDw
 AABE$�)`,�HE�G [
AHVA8�)�,�B�B�A �A(�G@�
(A ABBA4a��(8,*X0�F�B�G �A(�GPh
(A ABBK�%9��(X|*�2�nA�A�D0h
CAFx
CADn
CAFC
CAIP
CAD0�*�3�B�A�A �D@B
 AABBL+(5��F�B�B �B(�A0�A8�D�.
8A0A(B BBBF�)m���(p+�=�E�D�G@�
AAA4�+>��F�A�A �P
ABE�AB�+�>��+�>�,���+AAb0,�>�A�C�G T
ADLDHA@P,?�F�E�E �G(�D0�D@�
0A(A BBBA8�,�?�DF�A�A ��
DBMA
ABD�,�@��,�@�,Hc4���(-�@�	H$-�@�F�B�B �B(�D0�A8�G��
8A0A(B BBBF�*���-@�- B�rF�B�B �A(�A0�D`�
0A(A BBBD��h��-(�-HC�E�A�D@u
AAG�U��(.D�
,4.D�F�A�D �`
ABB8d.�E��F�B�A �A(�D@�
(A ABBA����(�.F�+E�e�.$F�9[�WF�$�.HF�E�D y
AE/�F�(/�F�0</�F�B�D�D �DPR
 AABDp/�F�%H\�	%��($�/�F�VA�L�K xDA4�/0G�ZB�F�D �@
ABAFAB�/XG�"0tG�>H f
B,0�G�D�LD0 H�~B�E�A �A(�D0C
(D ABBGD
(C DBBA�0PH�$H[�
)��(�0TH��0PH�	�0LH� �0XH�$1tH�$1pH�YQ�GD,���(@T1�H�$F�B�B �A(�D0�D@�
0A(A BBBG����68�1xI�F�E�D �A(�G0m
(A ABBF�1�I�3NR
HF02�I�F�A�A �D0�
 AABA"��^HP2TJ�(F�B�B �B(�A0�A8�DP
8A0A(B BBBA<%��^�2$K� �20K�aT�U
GhH�0�2|K��B�A�A �D0�
 AABH�"���03$L�KA�IP.Q��`3DL�0t3PL�F�A�A �DPq
 AABAL����^L�3�M�kF�E�E �B(�D0�A8�G��
8A0A(B BBBHDm���8 4�P�^F�E�E �K(�H0�o(A BBB\4�P�	`p4�P�B�E�B �E(�H0�A8�GP�
8A0A(B BBBK�
8A0A(B BBBHt'���x�4|S�	�4xS�	5tS�6($5�S�E�D�G0�
AAA���� d5 T�E�D �
AA�����5�T�(�5�T��E�G�J��
AAA �5XU�E�D 

AA@��� 6@V��E�D �
AHx��6(L6�V��E�A�G S
AAF$x6�W�=E�A�G fDA���P(�6�W�TF�D�D �~AB�6�W�(�6�W�E�A�D0�
AAA����^847PX�F�B�D �A(�Gp*
(A ABBDzRx�p����$���^ �7�Z�E�G ]
AF���0�7�Z�zF�D�C �N0U
 AABA�'{�� $8[�uE�D e
AA�Q��(\8X[�E�A�N0�
AAH��(�8�[�E�A�D0�
AAA\���6(�8X\�E�A�D0�
AAA����6@9�\�F�E�E �D(�D0�D`
0A(A BBBD����6t9^��9^�
�9^�	(�9^�E�A�D0�
AAFp{���9�^�0:�^��F�D�D �I��
 AABAzRx�����$
��(0l:_�(F�A�D �G0�
 AABCl*����:�_�(�:�_�fE�D�G0N
AAA �:0`�XE�L @
AAX���4,;X`�E�A�G c
AAND
IAE� E��P(x;a�E�A�G0�
AAD8U��(�;�a��E�A�J��
AACzRx����$��0<lb�F�D�A �J��
 AABIzRx�����$���(�<$c�E�A�D0�
AAJ@w��60�<�c�F�A�A �D@
 AABG�e��(=Le��E�D�J��
AAAzRx����$��(h=�e�8|=�e�F�B�A �A(�DP�
(A ABBB9���(0�=�f�F�D�D �G0�
 AABH�-���8>`g�F�B�A �A(�G@u
(A ABBDlu��(0d>h��F�D�D �G0�
 AABDd.U��P�>�h�F�A�A �`
FBHY
FBGc
ABJe
ABHT4���(8?@j�F�E�A �C(�DP�
(A ABBA(P?�j�E�D�F@t
AAA|?k��?k��? k��?k�
�?k�
(�?k�rE�H�D0t
AAI@dk�YH0@
H(,@�k�E�G�D@p
AAAX@l�2H) t@0m�E�K@p
AA0�@�m��F�A�A �DPx
 AABHp�W��P�@dn�5E�d@�@�n�|F�E�E �A(�I0�J`�
0A(A BBBF @A�o��A�D@t
AF(dA�p�jE�O�U w
AAA(�A�p�xE�A�G y
DAE�Aq�GE�}�<���(�A8q�:E�j
IA=���(8 BDq�ZF�B�A �C(�N�~
(A ABBB\Bhs�"HYtB�s�0E�j�B�s�!�B�s�-8�B�s��F�B�A �D(�GP�
(A ABBDL>���(Chu��H�0(Cw�eF�D�A �G0O
 AABK(3���PpCDx�TE�v
ES�C�x�*E�`$�C�x�rE�A�G aAA<�C�x�F�B�E �D(�C0�V
(A BBBOD`y�!E�[<0Dty�F�B�E �A(�A0�i
(C BBBG4pD�y�B�B�A �D(�D0r(I ABB0�DLz�F�A�C �G`�
 AABF�6_��4�D�|�tF�A�A �N
ABGPAB|:���(<E�|�|E�s
H{`@���(pE4}�) �EP}��E�G ^
AE0�E�}�F�A�D �D0�
 AABK�5O���Ed~�)F�~�,F�~�"HY4F�~�!HF�~�SW�pI�dF��H��F���EAM$�F���JE�A�G yAA4�FЀ�FF�E�D �D(�J0b(A ABB�F��LG���F�B�B �B(�A0�I8�J�9
8A0A(B BBBE(`Gt��PA�C�H P
AAB0�G���OA�C�G V
CAK\AA(�G���JB�D�D �t
ABA0�G؄�LE�I�G Y
ICFDFA H��7E�c
HF0@H��TE�D�O Z
ICJDFA0tH@��lE�D�O a
IAMTFA0�H|��LE�I�G Y
ICFDFA�H���7E�c
HF4�H���RF�D�I �d
CBLAFB(4I��YF�D�D �}
ABB4`I��JF�D�H �c
CBFAFB4�I,��JF�N�C �\
CBHAFB(�ID��E�A�K0z
AACH�I���qB�E�A �D(�M0P
(D ABBFo(D ABB&	��( \JȆ�bE�G O
AA �J��E�G0U
AF8�J���F�A�H �I
ABEe
ABA �J��E�D f
AHD'u��(0K\��JE�N�G U
AAGHDALKx��"HYdK���"HY$|K���E�A�G |AA�K��(�K��E�A�G ~
CAA �K���E�f
Ea
O,L��B�H�A ��
ABA8L���?E�n(TL���a�A�I W
AAD(�L$��-E�A�D �
AAF2���(H�L��%F�B�B �E(�D0�D8�G`�
8A0A(B BBBGHM���F�B�B �E(�A0�D8�G`
8A0A(B BBBB$XM���E�p
Kk
A_ �M��E�J�L
ADL�M���F�B�B �B(�A0�A8�G�
8A0A(B BBBE���@NL��B�E�E �H(�A0�J��
0A(A BBBI(LN���A�D�O0�
AAILxNܓ�F�B�G �A(�G0�
(F ABBAQ
(C ABBG8�N���RB�B�A �A(�G`.
(A ABBGHO�B�B�B �B(�A0�A8�D`w
8A0A(B BBBAh>���^(dO���E�A�D 
DAJ�4���P@�O����F�D�D �D0f
 DABIU
 CABE�?���(,�O(��sF�D�A �h
ABJH,Px��F�B�D �A(�G0_
(C ABBEb(F ABB@xPܜ�F�H�A �G��
 AABG^�O�M�A��PH��=Dh
DI+Ѿ�P(�PT���E�D�G0c
AAK(Q���F�D�D �z
ABE(HQ���F�D�D �l
ABC@tQ���E�A�K0^
DALI
AAEq
AAE�Q���"HY�Q���"HY�Q̠�H�RP��RL��,RH��@RD��	TR@��hRL��|RH���RT��!$�Rp��=E�D�D kCAH�R���@F�B�B �B(�D0�A8�D`�
8D0A(B BBBF$S|��QE�A�G }AA<@S���qE�C�K n
FAHD
FAELCA$�S��VE�A�G EAA�S,��2E�_
LA(�SL��_F�D�C �NAB(�S����E�F�D �DA T$��&H]p.�(LT(��FHX
HhT\��He
C�T��3E�m�O���(<�T��E�A�D c
DAFD
FAMDFAX:Y��(0UL��qE�I�N 
AACDGA <U���WH]
KT
DN0`Uԧ�nJ�D�G eAAD��P ���U��"HY�U(��"HY$�U@��KQ�I�G bFA�Uh��AHx<0q��((V���WE�D�D 
DAA�;Y��((XV����E�A�G �
AAI$�Vp��FE�h
CN
AFL�V���"F�F�B �B(�A0�A8�L�"
8A0A(B BBBF�ɹ�W`��!(W|��H� DW��nE�N T
AA�3p��(|WH��7A�C�J��
AAF@�W\��B�B�B �A(�A0�G@�
0A(A BBBC0�W8���F�A�A �D0�
 AABE�GƸ�4Xе�*E�`$PX��E�A�N �AA@xX\��F�E�B �D(�C0�GP�
0A(A BBBK<�X���F�B�E �A(�A0�e
(A BBBE(�X(��/E�A�G0�
AAG�5̷�$<Y��E�C
Hj
FUhT���(xY|��"HY<�Y���F�E�E �D(�I0�F
(A BBBF$�Y��E�J�H
AH$�Y���KE�A�G zAA$Z���H� @ZD��nE�N T
AA�6ƶ�0xZ|��B�A�D �D0�
 AABE �Zh��E�G d
AG7h��$�Z���JE�A�G yAA<[��F�J�E �D(�G0�l
(A BBBE L[X��E�G C
AH�7ֵ��[���gE�h
Kj�V���(H�[���wF�E�B �D(�D0�v
(A BBBFL(F DBB\0��"HY\H��0\D��
D\@��
X\<��
l\8���\4��
�\0��
�\,��
�\(��
�\$��
�\ ��
�\��"E�\Xh��((]��<mN@]D��
T]P��Eh],��
|](��
�]$��
�] ��(�]<���]H��
�]D��"HY�]\��E�M^`��6E�p(0^���mE�H�D0t
AAI(\^��E�A�N0K
AAG�^L��!E�W$�^`���E�I�G �DA�^��XE�G JA,�^H��M�I�D �sCB_���T 0_��=E�K �
AF�;f��(Dh_��F�A�A ��
ABJH
ABEi
ABLU2��P4�_����F�E�I �D(�D0�(I CBB0�_���F�A�D �G0T
 AABF<0`���F�D�D �G0M
 AABJV AAB8p`4��xF�J�D �D(�D0I(I ABB4�`x��QO�C�N N
AAHKA�A�H�`����F�B�B �B(�A0�A8�D`�
8A0A(B BBBH<0a$��F�E�E �A(�D0�i
(A BBBA(pa���nM�I�D �JCB�a����a���H�a���hB�E�A �A(�D0{
(D ABBGD(C DBB b����A�D [
AGx>���((Lb���*A�G O
YHD
DHLxb���GB�B�D �C(�G0e
(L HDIHC
(D ABBL�b���E�U�bv��+AAb$c���?A�P�D dDA(c���n~\x=E��( Tc���E�D D
AB�?5�� �c8���H�
FK
EL�c���F�B�E �E(�D0�A8�D�`
8A0A(B BBBKha���(d���H r
A3���(Dd���dE�D�D E
CAJpd4���d@��1O�W�$�dd��gE�D�G SAAH�d���F�E�B �E(�D0�D8�G`�
8A0A(B BBBE,Tr��(H(el��F�E�E �E(�D0�A8�J��
8A0A(B BBBD�b:��-4�e���E�D�G y
AAEW
CAE$K��((�e ��bE�D�G0v
AAHfd��
f`��	(f\��<fX��	PfT��!4dfp���F�A�A ��
ABHuAB�[g��x0�f��F�K�I �D@[
 AABCp?���-<�fl��tF�J�L �D(�A0�
(A BBBG(ep��-Lg���
8`g���F�E�A �D(�G@�
(A ABBG�?9��60�gd��F�A�D �G0�
 AABI�W'��68�g,��F�E�A �D(�G@�
(A ABBGP@
��6THh���T�B�A �A(�G0r
(A ABBIz
(D� A�B�B�Mi����T�h���Q�B�A �A(�G0`
(D ABBK�
(D� A�B�B�K[����$�h|��EE�H�G nAA< i���F�B�B �A(�A0��
(A BBBEPg��P0ti`��9F�D�D �D@�
 AABF�il��JE�D4�i���UE�A�G �
AAFl
AAB(�i���E�O�G b
AAA (j,��mE�I
BD
LPe{��(0`jd���F�A�A �DP�
 AABF8[��(�j���	H@�
BzRx�@;��($�j���cA�A�D YAADk��I�E�B �K(�A0��8K@M8A0A(A BBBdk���E��@�kD��@B�J�E �D(�F0�Dp�
0A(A BBBD`�k@��uB�B�B �B(�A0�A8�DP}
8D0A(B BBBHr
8A0A(B BBBLL(l\��F�E�B �B(�A0�A8�K�I
8A0A(B BBBA$xl���?E�S
HM
CN �l���jA�D ^
AAI{��(0�l��lA�A�D R
CADDFApR[��P0 m4��_A�A�D J
AAFDAA�Rc��(hmL�����s�4�m��F�D�A �A(�G0�(D ABB|I#��(X�md��HB�B�A �A(�D0S8M@g8D0Q
(C ABBBF
(C ABBA ,nX��A�J@s
AA�����(dn���a���i���P@�n@��FF�I�O �D(�D0�DP�
0A(A BBBF���(@�n8��EF�B�E �A(�D0�DP�
0A(A BBBFtw��P<Do0��B�D�E �D(�A0��
(I BBBEtms��(�o���DH�o8���B�E�E �E(�A0�A8�DpH
8A0A(B BBBGX<'��(8p���B�B�A �D(�NP�
(A ABBE�k���(L\px��F�D�B �A(�A0�D@HGPdHA@f
0A(A BBBBH�p8��;F�F�B �B(�D0�A8�G��
8A0A(B BBBBX�p,��rF�B�B �B(�A0�A8�Dp�
8A0A(B BBBA�xI�KxAp�=��(lhq<��F�E�B �D(�D0�D@K
0D(A BBBI�
0A(A BBBFp
0A(A BBBHI���P0�q��E�H�G �
AAFDHA�WǦ�P4r���E�PPr���WL�J(lr��{B�D�D �mAB@�r<��>B�B�B �A(�A0�DPo
0A(A BBBE�r8��?E�r$�r\��EE�D�J eGA s���5E�h(<s���LF�D�A �vAE hs���E�D s
AC$�sx�FE�A�G lGA@�s��F�E�E �D(�H0�G@�
0A(A BBBA@�s��F�B�B �A(�A0�G@s
0A(A BBBB8<t��F�E�D �A(�Gp�
(A ABBH8xt<�F�J�E �D(�H0�g(A BBB0�t��B�A�A �G��
 AABI(�tl�LF�D�C �{ABHu���F�B�E �B(�A0�A8�Dp�
8A0A(B BBBH$`u4�E�U�U �AAH�u���F�B�E �B(�I0�D8�DPy
8A0A(B BBBE<�up	�B�E�B �A(�D0�q
(A BBBA8v�	��B�D�A �Q
ABEc
CBH(Pv�
�.A�I�J�
AAK(|v��4A�A�G0J
AAK@�v��BB�E�E �D(�I0�K�g
0A(A BBBE@�v�
��B�E�J �D(�H0�J�z
0A(A BBBA\0w4�
F�F�B �B(�D0�A8�G��
8A0A(B BBBG�U�R�A�$zRx��������,��H�wH�~F�E�H �D(�D0�z
(A IEBJA(F BBB(x|�FF�P�A �kABLDx���F�E�J �E(�K0�A8�DP�
8A0A(B BBBH(�xP�E�R�G _
AAI4�x��E�A�G j
AAGD
AAJ�x<�:E�j
IALy\�GF�E�B �B(�I0�D8�N�B
8A0A(B BBBJ�v��P0|yH�E�A�N W
AACDHA0�y��2F�A�A �G0�
 AABDH�y� �F�B�B �B(�A0�D8�G`�
8D0A(B BBBGHiv��@Dz$�B�B�B �D(�A0�DP�
0A(A BBBA�z�$�DE�w,�z %��B�D�A ��
ABA(p��P8�z�%�B�B�D �A(�G@�
(A ABBB(${�(�A�A�G@�
AAAI���P0d{�)�B�A�A �D0�
 CABFdk���(�{�*�E�C�G0�
AAElX��4�{�+�E�A�G \
AAED
AAJ$|0,�E�LH@|4,�0F�B�B �B(�D0�A8�Gp1
8A0A(B BBBE�H���L�|0�\B�G�L �A(�G0�`
(A BBBD�
(D DDBI�z/��H}1�B�B�A �C(�D0N
(C ABBFU
(G ABBGHP}D1�[F�E�B �B(�A0�D8�G�}
8A0A(B BBBF8����6(�}D5�E�A�G0{
AAF(�}�5�FF�P�A �kABH~�5�!F�E�E �E(�G0�D8�GP�
8A0A(B BBBA(T~�6�A�A�D0~
AAA(�~D7�A�A�D0�
AAA@[���(�~8�%4�~ 8�E�A�G j
AAGD
AAJ0�8�
E�C�G �
AAGDHA�dN��(LT`9�#F�E�B �B(�A0�A8�G�B
8A0A(B BBBDܸ��(�,?��A�A�D0N
AAJH�@�B�B�B �B(�A0�A8�DP�
8A0A(B BBBAL0�d@�EB�G�L �A(�G0�`
(A BBBD�
(D DDBNp~G��H��PA�8F�B�B �E(�D0�A8�GP�
8A0A(B BBBA0�DB��F�D�A �G0�
 AABAH��B�(F�B�E �B(�D0�A8�GP�
8A0A(B BBBEH`��C�{B�B�A �A(�D0Q
(A ABBOD(A ABBl],��(@���C�B�E�B �A(�A0�DP�
0A(A BBBA(��D��E�A�D0�
AAB�^�(D�PE�DE�w`��E�DE�w|��E�E�L@���E��F�B�B �A(�A0�D`�
0A(A BBBF�.L��P(�TG�A�A�G0�
AAAH��G��F�B�E �H(�D0�A8�N`�
8A0A(B BBBI�r��(H|�hJ�7F�B�B �B(�A0�A8�GpC
8A0A(B BBBF(Pؘ�P8܃HN�F�A�A �Y
ABDf
ABGlyؘ�(,��N�@�O�T�O�h�O�|�O���O���O���O�RH0D
AԄPO��LO���HO��DO�
$�@O�8�<O�L�8O�d�0O�4E�n��TO�!4��pO�gF�E�D �A(�G0I(A ABB(̅�O�HF�D�A �yAB8���O�ZF�E�D �D(�D0|(A ABB4��O�0H��O�ZB�M�A �G@�
 AABK|�(Q�(��$Q�E�I�D �
DAI(���Q�E�A�D0�
AAG|c0��((��(R�NA�A�D0�
AAF(�LS�	0<�HS�B�D�A �N`�
 AABBp�$T�HE�k
HK�����(H��@T��F�B�B �E(�A0�A8�DP	
8A0A(B BBBH��U�,O \4��U�`F�A�C �q
ABB\AB4@�V�B�D�D �x
ABK}
ABAHx�|V�B�B�B �B(�A0�A8�D`�
8A0A(B BBBG�w���(؈�X�&HG V8��X�YF�E�E �D(�G0�r(A BBB<0��X�PF�E�D �D(�J0I8H@[(A ABB8p�Y�YF�E�E �D(�G0�r(A BBB��(Y�_E�YȉlY�@Y�QF���Y����Z�p��Z�Xp�B�E �D(�A0��
(Q BBKQV
�(A� B�F�B�OG�����C0�����H����� ��t[��E��
PF
B����(��\�Њ$\��0\���<\��H\�% �d\�4�p\�ul^�el��(`��\�<H n
A|��\�FH x
AhZH����]�FH x
A�Z)��܋(]�FH x
A�Z
���H]�FH x
A�Z��$<�h]�TE�G A
AAd��]�\Hx��]�F�B�B �B(�D0�D8�JP�
8A0A(B BBBD�a�)F�^D�0��a�B�D�D �G0�
 AABJ@��b��B�B�E �A(�D0�G@�
0A(A BBBA�d̐�Hl�c��B�B�B �B(�D0�D8�G��
8A0A(B BBBA �}��"`̍�g�jB�B�B �E(�E0�D8�DP�
8I0H(B BBBKr
8I0A(B BBBEЀ'��P8D��h�NB�B�D �I(�G0�
(D ABBI@j'��(L���i�@B�B�B �B(�D0�A8�D�
8A0A(B BBBDH�pj�B�B�B �B(�A0�A8�D��
8A0A(B BBBJ�����|D��l�F�E�F �E(�D0�A8�G`U
8A0A(B BBBGb
8C0A(B BBBJ�
8C0A(B BBBC�~���L؏Lp�G�E�E �D(�G0@
(F ABBID(C ABBA����L(�|p�F�E�B �E(�A0�D8�G�5
8A0A(B BBBC$zRx��������,��8���x�F�E�D �D(�G`�
(A ABBK�W��6�z�%H \�_a��(00�z�F�D�D �G@�
 AABHd��z��(x��{�:A�I�F 'AAL���|�WF�B�B �D(�D0��
(C BBBFb(f BBB(��}�E�A�D`H
AAD8 �t~�F�B�A �A(�DpR
(A ABBJ\�X��8E�D mA |�x��TE�F B
AA0�����YE�D�D0@
AAADCAHԒ��B�B�A �A(�G0�
(I ABBND(M ABBH �����B�F�B �B(�G0�A8�D�{
8A0A(B BBBC4l�H��F�A�A � 
ABEPABH�����F�E�E �E(�D0�D8�D@m
8C0A(B BBBF8�t��F�E�D �D(�GP�
(A ABBFH,�8��F�B�B �B(�A0�H8�Dp�
8A0A(B BBBH�`-��*,�����F�D�D �p
ABOL��x���F�B�B �B(�A0�A8�D�d
8A0A(B BBBH,����E�C�D p
DNBL<����@B�B�B �B(�A0�D8�D��
8A0A(B BBBDL��x��tB�B�B �B(�A0�D8�D��
8A0A(B BBBHD���F8����B�E�E �A(�C0�}(F BBB���(8@���F�E�D �D(�G@a
(A ABBG�n�����4��MH0
A��h��QR�tJ�(Ȗ���E�D�G0]
AAA�sW��<���P�A�D ^
AAKp��H ��DCAPH�<��nF�B�B �B(�A0�A8�D�
8A0A(B BBBK��X��b�����-A�k@̗Ȗ�1B�B�E �D(�D0�D@�
0A(A BBBGH�ė�B�G�F �E(�D0�
(D ABBED(C DBBt���($p�$��>K�H�D dAA�}������+AAbtȘ���B�B�E �D(�A0��
(A BBBKD
(A BBBEJ
(A BBBGm
(A BBBD0�z��9<T�P��B�E�B �A(�A0��
(D BBBA��_��(4����F�E�I �D(�D0i(D ABB�t��HS0t#��(�h��RE�y
RA0���(@����T����E�p���
����H����!
F�E�B �B(�A0�C8�Dp�
8A0A(B BBBHDg��� ��ܧ�QE�G ~
AA ���E�D �
AA�w���(T����E�D�G0~
AAH0�����F�D�A �D0�
 AABH�����ț���ܛ���(����>B�D�D �iDB( ����E�D�L h
IAIL���a`�t��HM�v!��(0��h��E�A�D U
GAIcGD$���(DԜЪ�B�B�B �L(�G0�A8�G@j8D0D(B BBB(�(��E�D�G0x
AAF�y���|\����dF�B�B �B(�A0�D8�GPK
8A0A(B BBBCq
8I0H(B BBBFf
8I0A(B BBBH|���(@����wB�D�D �l
ABGH
JBDRJB@8����wB�D�D �l
ABGH
JBDRJBL|����=F�B�E �E(�D0�C8�G��
8A0A(B BBBK$zRx��������,+��x,����F�A�I ��
ABE(8�,��EF�G�A �gDGd�P��V8x����F�E�A �A(�DPt
(A ABBE�� ��,E�Z
FFԟ0��3Hc
AL�P��B�B�A �A(�D0�
(A ABBE@
(A ABBJLD���B�B�B �E(�A0�D8�D�
8A0A(B BBBG��P��LH�����B�B�B �B(�A0�D8�Gp�
8A0A(B BBBI�P���L��HRX{w��(44�@��F�A�A �O
ABFoABl���������#HZ�{'��90������F�A�A �D0�
 AABF����H�@��fF�B�D �D(�F0�
(A ABBB�(D ABB@�d��E��4\����F�D�A �A(�D0q(A ABB(��@��QJ�D�G oAAJ��h��t��QN�K�G \
N�C�KD
I�H�KW
G�D�Fr
I�A�La
I�A�Mp����ځ�P@�T���Q�B�B �D(�H0��
(A BBBJ�����A0����������(�����3E�I�D WDA8ԣ��B�E�A �A(�D@r
(A ABBA4�T��F�J�K �A(�D0\(D ABBHH����F�B�B �E(�A0�A8�Dp
8A0A(B BBBI ������E�D �
AF��p��(̤8��(�@��E�C�G0g
AAH(����/B�G�D �^AB<���+AAb X����leP
KT���L�����	B�E�B �B(�A0�A8�G�
8A0A(B BBBFT����H� ���F�E�B �B(�A0�H8�G��
8A0A(B BBBH0T��^8T����F�F�A �A(�DPg
(A ABBA�!�������(�����E�C�G0[
AAD �<��A�D �
AAL�E��(@ ����qG�D�D �GABG���H ���A�A�B�0d����jA�D�G `
AABdIHL��,��yB�E�E �B(�A0�A8�J��
8A0A(B BBBC�a��(H��H��`F�B�B �B(�A0�A8�Kpv
8A0A(B BBBG�tY�P,\�H��E�M�D@�
AAA,����B�D�A �|
ABJ�����dШ!�+AAb@����F�B�B �A(�A0�GP�
0A(A BBBAt?�~�},D���M�D�H ��CBt�������EAH$�����A�D�G xAA̩��E�Z
IY$�X��sA�D�F eAA����FDAd��~�(@���[E�h
S`�z~�($p���A�D�D rCA$��\��gA�F�G VAA$�����VA�D�G CAA0����B�D�D �D@�
 AABB���}�((0�t��2E�G�G0Q
AAJ��}�(Hp�t��
F�B�E �B(�A0�A8�G��
8A0A(B BBBFX)�}�LЫ
��E�D�G F
GAJ_
AAGD
AAJK
FAN$ ��
�la�I�G xAAHH��
�F�D�B �B(�A0�A8�Dp�
8A0A(B BBBG�x�}�P ��,
�EE�G wA0̬X
��F�A�D �D@
 AABK���}�P,���M�I�D �lCB0D�@�F�D�C �G0|
 AABDHx���F�B�B �B(�A0�A8�Np+
8A0A(B BBBG$zB}�0ح��RE�C�G k
AADKAA,���F�M�D ��CB(<���F�D�C �W
ABI0h��F�A�A �G@
 AABA(�
}�P0����RE�C�G k
AADKAA4����F�J�A �D(�D0�(I CBB�h�*H0����B�B�B �B(�A0�A8�D�
8A0A(B BBBI(|�8�AF�I�H �fAB`��\�F�B�B �B(�A0�A8�DPn
8A0A(B BBBFE
8L0A(B BBBF���{�(  ��:E�c
PADD� �*F�B�J �K(�D0�J�x
0A(A BBBE��{�6(����A�D�G j
AAHHаT �B�E�H �K(�F0s
(F ABBBQ
(A CBBGL�� �F�E�F �E(�D0�A8�D�~
8A0A(B BBBI<l��&�
F�B�A �I(�D@�(A ABB(���)�gA�A�G y
CAJ8ر�)�B�B�A �A(�D0�
(C ABBCԍ@z�(8(��*�B�A�A �H
ABIb
FBF��z�(x�,z�+AAbD��`,�WR�F�D �D(�G0�
(I� A�B�B�N`����ܲx-�zA�h
GI���-�`8�$.�B�B�A �A(�G0!
(D ABBI��y�(H`�t0�B�E�B �E(�I0�A8�J��
8A0A(B BBBFH1Ky�8��43�B�E�I �A(�G��
(A ABBF zRx������(�x� 4�P4�E�G@o
AD��x�l��4�>H0p
A8���4�F�E�D �D(�G@a
(A ABBG�Kx�\ش,5�O�B�B �A(�D0��
(A BBBHU
�(M� B�B�B�HH�����(��w�$L�X8�3E�I�D WDAt�p8�qHPc
A���8�$���8�/8��9�JF�H�D �g
CBBAFB(� 9�aJ�D�G ~AAK��P �d9�HF�B�B �B(�A0�E8�D�
8A0A(B BBBA4t�`:�B�D�D �p
AEHBABL���:�F�E�E �B(�D0�K8�G��
8A0A(B BBBH�4�v�68�A��E�D V(b0H8M@CHDPKAG L��v�+AAbHh��A�.m�A�G �AAG��` ��d
AABDD�A�4��pB�F�J�D �A(�D0t(A ABB$��B��E�A�D �AA��C�#((��C�E�A�LP�
AAH���u�h��D�(|��D��E�E�G0�
AAAH���E��F�B�B �B(�D0�D8�G��
8A0A(B BBBH,�/u�@�K��F�B�E �A(�D0�DPZ
0A(A BBBHLP��K�>F�G�E �B(�K0�C8�H�
8A0A(B BBBK�u�P���N�VH0H
AԹ�N�Xa(�u�(H�pO�GF�B�B �B(�A0�A8�Dp�
8A0A(B BBBJ���t�PLd�`R�F�B�B �B(�A0�A8�G�
8A0A(B BBBH�h�t��dȺ�U�F�E�B �B(�A0�C8�G`T
8G0A(B BBBJQ
8A0A(B BBBEH�*u�($D��Y�)E�D�G IJAHl��Y�+F�E�B �B(�A0�A8�DP�
8G0D(B BBBDX��t�(8̻�Z�F�E�E �I(�H0�k(A BBB��Z�	��Z�$0�[�RE�D�D BAALX�<[�~
F�B�B �B(�D0�A8�D��
8A0A(B BBBA�t�P��Xe�0мde�F�D�D �D@t
 AABA���s�(4��e�F�A�D �f
IBLA
ABDHP�f��F�B�D �D(�L0j
(D ABBIs(A ABB\��s����f�;8Ľ�f�F�B�A �A(�D`�
(A ABBB��0s�(0� i��B�A�A �D0�
 AABA�s��D\��i��B�B�B �B(�A0�A8�D@�8A0A(B BBB��|s�($��Lj�A�A�G �AAD�hs�P4��j�B�E�A �D(�D0i(A ABB�ls�(@��s�+AAb`\��j�.B�B�E �B(�A0�A8�D`b
8A0A(B BBBC4
8C0A(B BBBHخ+s�(8Կ�l�F�D�D �V
ABIa
FGBd�s�xL$�`m��F�B�B �B(�A0�D8�G�
8A0A(B BBBHܾs�$���s�iE�A�D XAA��s�($� t�&E�D�G IGA$�(t�.E�D�G WAA(�0t�pE�D�G0L
AAB0@�tt�F�A�D �G0�
 AABF`t�Pu�`B�B�B �B(�A0�A8�D@�
8G0A(B BBBH\
8F0A(B BBBA��r��H�8v��F�B�B �E(�A0�A8�Gp0
8A0A(B BBBF��s�P(L��x�zM�D�I �\AB$x��x�E�J�D uDA<��dy��F�B�E �A(�C0��
(C BBBF��r�P��z�RH D
A��r�:8$�0z�<F�I�A �D(�GP�
(A ABBD���r�x@t� {��F�E�E �D(�A0�G`�
0A(A BBBFpo�r�P8���{�F�E�D �D(�D`m
(A ABBA��r�(��{�
0��{�D�`|�tbP0\��|�E�A�G B
GAIgFA$��$}�?E�D�G hDA0��<}�F�A�A �D0	
 AABG��4r�(@��~�F�E�B �A(�D0�D@f
0A(A BBBDD��	@X��~�F�B�B �A(�D0�D@�
0A(A BBBK0��h��wE�A�G I
AAHOFA0����� F�D�A �G0]
 AABEеDq�((����E�A�D0�
AAAآ,q�P$X���PE�D�G yAA��4��;E�u��$q�(8��@��cG�D�D �n
FBKACBJ�����t��cH U
Aܕ�p� ����XHOp��p�(,L����e�D�G �
AAHG��|��p�+AAbH�����B�B�E �B(�A0�A8�G`W
8A0A(B BBBK��hp�8(��<��F�A�A �i
ABDx�`p�PH8����F�B�A �A(�D0y
(C ABBAM(A CBBD�Pp�(8��L��F�B�D �D(�GP�
(A ABBJH��0��F�E�B �E(�A0�D8�G��
8A0A(B BBBH`��o�;H4���F�B�A �A(�D0}
(D ABBD\(D DBB@��o�(\��P��F�B�B �A(�A0�[
(C BBBHA
(F BBBKA(D BBB��ko�(@�|��F�A�A �W
CBDA
FBGAFI��;o�(Hd����B�B�E �B(�A0�D8�GP@
8A0A(B BBBGP��n�(H����B�B�B �E(�A0�A8�DPm
8A0A(B BBBH�4��<H n
A$,�X��E�KPi
AF<T���A�D�D f
AAGx
MAJLAA8��@��dF�B�B �A(�A0�P(A BBB��n�(��`��BE�l
OA����'E�]H ����hF�F�B �B(�D0�D8�G��
8A0A(B BBBF���m�6�����:H@l
A$��ؖ�7E�D�G ZGA@����wF�E�L �A(�D0�G��
0A(A BBBH\�-m�6�Om�+AAbH8����F�I�E �B(�D0�D8�Fp�
8A0A(B BBBF�m�(H�����F�H�E �B(�A0�D8�Gp0
8A0A(B BBBED��l�U�����H���F�B�B �B(�A0�A8�Dpl
8A0A(B BBBA���l�U(l�X��MB�D�D �rGEL��|��F�F�E �B(�A0�H8�M�	
8A0A(B BBBD 0�l�P@��(���F�A�A �G0�
 DABFf
 AABA�xl�PT����Lh����DF�B�B �B(�A0�A8�D��
8A0A(B BBBD�Pl�),�����M�I�D �sAB(����A�D�G 
AAC��	m�9(<����AF�I�H �fABh���2E�\
OAL��<��F�B�B �E(�A0�A8�D�
8A0A(B BBBF@��l�,�����LE�A�G e
CAJ4����sF�A�A �O
ABFOAB���l�6h���)E�cH����JF�B�B �B(�D0�A8�DP/
8A0A(B BBBBp�Yl�(,�����F�A�A �~
ABGL����tF�B�B �E(�D0�D8�D`�
8A0A(B BBBH(d����?E�D�G a
AAE���k�+AAbL�����eF�F�B �B(�A0�A8�J��
8A0A(B BBBJ<��k�����L(�̸��F�B�A �A(�D0�
(F ABBK
(A DBBH8�	k�(0��X��|E�K�G }
DAGTFA �����j�W
�OQG�@��0���F�A�D ��
ABDQ
FBGAFB|��j�($<�Ȼ�E�w
Lp
HNHd�0��eF�B�A �A(�D0
(F ABBDw(D ABBp�!j�PL��@��@E�D�D �
AAHB
CAJD
CAHL
DAE\�0��F�B�A �A(�D0|
(G ABBJ`
(F ABBEa
(D ABBF4��i�xL��\���F�B�A �D(�G0
(A ABBGT
(F ABBAH����[F�B�B �B(�D0�D8�G@k
8A0A(B BBBH$���@(8�,��LE�D�G _
AAGd�P��%(x�l��U�f
EP
PQA�`�����@@�����\�B�J �D(�A0��(A BBBA�����@�����\�J�D �A(�G0s
(A ABBEm����<@����X�J�D �A(�G0\(A ABBA��������CbYбh�(H��(���E�L�N H
AAGX
FAAL
FAEbFAH������F�E�B �B(�A0�A8�Gp|
8A0A(B BBBBHD�`��sI�B�B �A(�A0�M
(A BBBEA(C BBB�����<H n
A����������|H0n
A ����hE�G U
AA@��f�4�P��F�L�I �A(�D0q(D ABB��f�0`����oE�A�D U
AAGDAAH�����hF�E�E �D(�A0�m
(A BBBGH(A EGB���� ����3R�J
DKE���e�(0,���SR�D�G LAAE��H ��Ŀ�e�Pt� ��dk�����,4�����F�J�D �C(�G0�(D ABB$��H��eE�A�D WAA��������
,���� @����T����h����
$|����IE�D�G vAA��d�(4�����ZF�A�A �D
ABAFAB(�����>F�D�D �cJBp�dd�(4����2A�b
MAHT����F�E�E �L(�A0�A8�LPl
8A0A(B BBBH@�d�6��������������������
����	(����_E�D�G`�
AAJdD����GF�B�B �B(�A0�A8�Dp�
8A0A(B BBBD:
8A0A(B BBBD�2c�$�����E�g
Ds
]D(�����E�P�D0�
AAK����2E�i
BAH4���B�B�B �B(�A0�A8�GP�
8A0A(B BBBF �ob�@��P��MF�B�B �D(�G0�D`�
0A(A BBBF��\��HT(�
b�(�P��(�\��F�P�A ��ABTD����F�B�B �B(�A0�D8�G`�
8A0A(B BBBI�hBpKhA`8������F�N�F �D(�D@
(A ABBE��L��RA�P(�����E�R�G F
KAH< �����E�A�G q
DAMw
DALqGA`����E�p
KA���`�((������E�A�D �
AAE$��`�(�����	8�����F�B�A �A(�D0T
(C ABBF�Q`�P8����0Hg��u`�68d����bF�B�G �D(�D@�
(A ABBG(����E�A�G L
AAE�����ZE�TL�����iF�F�B �A(�D0��
(A BBBBd
(A EBEG$8���3E�D�D aCA(`�$��E�A�G L
AAE����)E�c\��,��F�B�D �D(�G0d
(C ABBE~
(C ABBBt
(C ABBD�\��HTX��^�($4�P��:A�A�D jDA���^�(p�T��4A�r���^�(4��d��A�N�J �
AAEK
HAL��L���A��
Bc��{^�((����A�D�G �
AAD��c^�(L�h��CA�V
Ajl����'A�\
CFH�����F�B�B �E(�D0�A8�G`
8A0A(B BBBD���]�`(��H���M�D�H ��AB(����E�A�D0�
AAAD����X����,l�����F�A�D �H
ABJL��H���F�E�E �E(�D0�D8�G��
8A0A(B BBBDH�����F�I�B �J(�D0�A8�GP@
8A0A(B BBBG���\�&LL�h��F�B�E �E(�D0�D8�G��
8A0A(B BBBD8���F�L�D �A(�GP�
(A ABBH<��|�F�E�J �H(�A0�9
(D BBBG0��	�F�A�A �D03
 AABE��[�0`�D�sF�A�A ��
ABF����!����-E�\P����B�B�B �B(�A0�A8�G� L�@I�A�
8A0A(B BBBD$zRx��A������,[�PLT��
�=F�E�F �E(�D0�D8�G�
8A0A(B BBBA�[�P0����F�D�D �c
ABD0����qE�M�G `
CAClCA@ �D��F�B�E �D(�D0�J@�
0A(A BBBA���Z�(x�������PH B
Ax�wZ�������������H����F�E�E �E(�G0�D8�D`g
8A0A(B BBBKD�`�!X�|�l�x�(��t�GE�D�G j
AAD����HP����(����E�O�K`�
AAH���
0���F�D�A �J��
 AABK4L�h�ZM�D�D �n
DBGAFB��������)(����K�Y�t�D�A�Z
A��<�'HI U��P��\�)�x�0�t�D�p�X�l�l�h���d���`���\���X���d���p���|���� ���4���0H����F�D�D �G0A
 AABFD|�H�F�E�E �B(�D0�C8�O@x8A0A(B BBB(����2F�I�A �^ABL����F�B�B �B(�A0�H8�K�Z
8A0A(B BBBD@��T� �h�,�|�8���@�H0�
A����6OQD�����B�B�E �D(�C0�G�E
0A(A BBBD���$���(8���E�A�D@�
AAAd� �[x�l�E����$H[(����HE�A�D�w
AAEzRx����$@T�(������,���"HX|�T�(X���"HX��T�(����"HX��T�(����"HX�T�(����"HX,�T�(���"HXX�T�(4���"HX���S�(`���"HX���S�(����"HX���S�(����"HX��S�(����"HX4��S�(���"HX`��S�(<���"HX���S�(h���"HX���S�(����%H[���S�(����%H[��S�(����%H[<��S�(���&H\h��S�(D���%H[���S�(p���%H[���S�(����%H[���S�(����%H[��S�(���%H[D��S�( ��%H[p��S�(L��%H[���S�(x��%H[���S�(���%H[���S�(���AH`
HP(��S�(�0�%H[T��S�(0�4�%H[���S�(\�8�%H[���S�(��<�,Hb���S�(��@�%H[��S�(�D�%H[0��S�(�H�%H[\��S�(8�L�%H[���S�(d�P�%H[��|S�(��T�%H[��xS�(��X�%H[�tS�(�\�%H[8�pS�(�`�%H[d�lS�(@�d�%H[��hS�(l�h�%H[��dS�(��l�%H[��`S�(�p�%H[�\S�(�t�%H[@�XS�(�x�%H[l�TS�(H�|�%H[��PS�(t���%H[��LS�(����%H[��HS�(���%H[�DS�(����%H[H�@S�($���%H[t�<S�(P���AH`
HP��0S�(����AH`
HP��$S�(����AH`
HP�S�(���AH`
HPD�S�( ��AH`
HPx�S�(T� �7H`
HF���R�(��,�7H`
HF���R�(��8�5H`
HD��R�(�D�5H`
HDH��R�($�P�7H`
HF|��R�(X�\�7H`
HF���R�(��h�5H`
HD���R�(��t�5H`
HD��R�(���AHe
CPL��R�((���AHe
CP���R�(@\���F�E�E �A(�A0�Gp�
0A(A BBBA,�XR�((��p��B�A�A ��AB4�@R�(�0�E��
O���<(���P�A�A �V
ABEa
ABDh���h�,�VE�h
S���Q�($��\�gA�F�G VAA,����[E�C
P�����B
F$zRx�������,XQ�P0,��;��E�D�G a
AAE�AA��`Q�$t�@<�la�I�G xAA���<����<�$��<�2E�D�D [HA(��<�E�D�D0^
AAC$�=�7E�A�D jAA���P�(T�=�E��p��=�`vW
CK��iP�(0���=�fA�D�G |
CADLHA0�>��F�A�A �G0N
 AABG��P�(T �?�7F�B�B �B(�A0�A8�G� L�@L�At
8A0A(B BBBE$zRx��A������,�O�,�@C�RE�C
B�E�L��K�n
D��O�60�\S�F�I�D �D0�
 AABI8,8T�F�B�A �C(�G0B
(E ABBE(��O�|�T�QE�b
I`��T�BE�o
LA0�U�F�F�I �L@�
 AABA|�#O�0�U�WE�D�G p
DAKDAA8V� E�WT V�0h,V�BE�C�N N
AAJKAA(�HV�ZA�M�G l
CAK,�|V�9E�C
D��E�E�G�h
K)N�(xX�HQ\�%N�((8lX�}E�I�D \IAd�X�dDz
JP@�Y�B�B�B �A(�A0�D@v
0A(A BBBA��M�@�HY�B�B�B �A(�A0�D@�
0A(A BBBAX�_M�4�Y�WDG
E��=M�(d�Y�x�Y�>Hu��Y�nL�q
K��	M�(0�4Z��B�D�K �G0�
 AABD���L�0�Z�F�D�D �G@q
 AABF <8[��F�D�D �G@���L�(t�[�AHx8�\�F�L�D �I(�N0}
(A ABBH<��\�F�L�E �D(�I0�e
(A IBBI<L]�F�L�E �D(�I0�e
(A IBBIHH�]�F�B�E �E(�D0�A8�D@�
8A0A(B BBBJ�@_��<_�H`
H��OK�(��_�{D0c
IzRx�0/K�' �_�4�_�-Hd��K�(`�_�t�_�!HX���J�(��_�jHa�<`�@L�l�``�)H`$��J�(d`�E�Q$h`�+E�D�G TAA@Dp`�F�B�B �D(�A0�G@�
0A(A BBBA��RJ�@��`��F�B�E �D(�A0�G@�
0A(A BBBA�J��`a�E��	�a�L�,	Hb�!@	db�#LT	�b�F�B�B �A(�A0�Y
(C BBBBQ
(A BBBH�RI�P�	<d�AAD(�	@d�M�D�I �uAB
�d�E�L
�d�GB4
�d�GBL
(e�_Zd
pe�4x
|e�U�F�D f
AAIDAD�� �
�e��E�N p
AD�
�f�!E�W�
�f�Wn�h�f�Y[V_Dd�H�(H@g�NF�E�B �B(�D0�C8�DP�
8D0A(B BBBJ�h�L��$��h�ME�D�D }AA��h�bL�i�$i�SA�A�D HA(Li�<Xi�$H[��G�(h\i�$A�^�G�(8�\i�Q�E�D Z
A�A�JDAAJ����i�(��i�iE�A�D {
CAGH
 j��F�B�B �E(�I0�D8�DP�
8A0A(B BBBA^F�Ht
�k��F�F�B �B(�A0�A8�D`�
8A0A(B BBBG�F�P�
0q��
,q�E�T	F�q�E�J4 q�$H[���E�(8`$q�kM�D�A �A(�G0E
(A ABBA\��E��Dq�aE�A
J ��r�YHA
GD��r�2HfD�WE�( �r�4�r�H�r�$\s�UE�K�F |AA�@s�;p�ls�k�B�G �B(�A0�A8�DPr8C0A(B BBBF������hP������D8F0A(B BBB�D�(p �s�k�B�B �G(�A0�A8�DPw8C0A(B BBBA������hP������D8F0A(B BBB4D�(H�\t��F�D�B �B(�D0�A8�DP�
8A0A(B BBBA4��t�LF�C�A �S
ABHVGBD,�t�F�B�B �G(�A0�A8�DPd8D0A(B BBBLt@u�F�E�E �G(�D0�A8�DPU
8D0A(B BBBF�C�+AAb$�du�KE�F�G sDAl��B�(xu�)<0�u�F�B�E �A(�A0��
(A BBBH`�B�x�`v��lv�@�xv�4E�C�G �
AAHa
AAES
AACT��B�`w�8Xw��B�B�A �D(�L��
(A ABBD��B�(l�x�YE�D�DpD
AAA(�y�3E�I�D WDAL�0y�<F�G�B �B(�A0�A8�J�
8A0A(B BBBB, z�GE�I�D f
AAFHD@z��B�B�B �B(�A0�A8�Dp�
8A0A(B BBBD���A�H��|��B�E�B �E(�A0�D8�D`1
8A0A(B BBBF�d�� p�� |��,���(@���GF�A�D �xAB(l���GF�A�D �xAB�܀���� ���Df
FX
D �}@�(�X���U�XP�u@�x,,���F�D�D �k
ABT��@�(pd��H�
B���@�PL�4��F�B�B �B(�A0�A8�D�Y
8A0A(B BBBKX�@��`��/F�B�B �B(�A0�A8�D@�
8A0A(B BBBGV
8C0A(B BBBFX�B�@�|���F�B�B �B(�A0�A8�Dp�
8A0A(B BBBI�
8C0A(B BBBGP
8F0A(B BBBIg
8F0A(B BBBJt�yC��(���UHw
AM
A��
D�PH\����F�B�E �E(�D0�A8�G��
8D0A(B BBBA �\��lE�J0V
AA<����TF�E�E �D(�D0�t(A BBBȕ�BRo\��C�(\<��F�B�B �B(�A0�A8�DPq
8C0A(B BBBAL8F0A(B BBB<1C�(�$��*�1C�+AAb,�$��B�A�D �`
ABFdC�u$���48���,4Lؖ�KF�E�D �I(�D0e(D ABB������VE�z
AP�,��"E�\�@��	L�<��6F�B�E �D(�A0��
(A BBBDY
(D HBBO(]B�JHL��LK�B�E �A(�D0�d�(J� B�B�B�M0������GB�MH���.F�B�D �A(�G0^
(A ABBHy
(A ABBA��4B�O8ؙ�F�E�D �A(�D0�
(I ABBH�3B�G(\���E�A�G �
AAH�:B�M`�x��vF�B�B �B(�A0�A8�D@�
8A0A(B BBBN\
8A0A(B BBBJ�B�8���XR�L�G �D(�N0M(J� A�B�B�(P���HR�K�D �_�A�B�|Ȝ�,�Ԝ�F�D�A ��
ABK�A�G��������2dM8��A�(���)H`d��A�(8@���aR�D�D �F
�G�B�G`�G�B�\|���F�B�B �E(�A0�A8�D@Z
8G0A(B BBBIl8G0A(B BBB�X��	�T��	P��0HdT�$A�(0T��9^TH|��lo�p
AhA�<(x����E�A�D0�
AABH�����F�E�E �E(�A0�A8�G`�
8A0A(B BBBG�@�P8  ��F�E�I �D(�J@]
(A ABBK\��@�(0T ����F�A�A �D@G
 AABI��@�� ��9H`,� 0��SF�I�D �F0u AAB� `��YHn
JT<�&@�0!����F�A�A �D@q
 AABGL!(��`!4��U[c(x!|���E�A�D@�
AAHd��?�(�!(��	�!$��	�! ���!,��4"8��_E�J i
AGJ
GG\
FF��?�(4X"L���A�A�D m
AAKL(Q0W(A ��>�(,�"��ZB�D�I ��
ABN�" ��BA�u
JA8�"P��B�A�A ��
ABB�
DBL��>��HD#���'F�B�B �B(�A0�A8�D@R
8A0A(B BBBA�"?�((�#���'E�A�D0�
AAF�#���E�Q�#���8$���F�A�A ��
ABHO
ABF8<$���F�B�A �A(�GP
(A ABBC�P>�P@�$���mA�A�D �
DAD\
IAJD
AAJ4
H>�($�$���HE�A�K pAA%��1W�L�h(%��$F�B�A �A(�D0�8H@q8D0H
(C ABBF�
(C ABBFc(C ABBT�=�PX�%����E�A�G T
AAED
CAHW
CAET
CAHW
FAA8&P��F�B�A �A(�GPk
(A ABBF�!P=�4T&����Hs
EO
IK
ET
LW
aK�#=�,�&��jR�A�A �E
ABD(�&T���E�A�D �
AAB`�<�( '���H{
ec
ec44'��E�D�G �
AACD
FAE�|<�(�'���,�'���UB�D�D ��
ABEL<�(�'ܺ�`�'��F�E�E �E(�D0�F8�G@�
8D0A(B BBBLD
8A0A(B BBBB@'�;�(d(���0x(|��_E�A�D B
DAGDAA�;�(4�(���F�A�A �z
ABKiABL�;�()��A, )D��F�A�A �|
ABI�`;�(\d)���F�B�E �H(�D0�D8�G@�
8I0A(B BBBFD8A0A(B BBB�(;��0�)L��wE�D�G P
DAKDAA*���( *����E�D�G �
AAE�|;�P$`*T��dE�A�D VAA��;�(�*����*�;�+AAb�*x��D@r
J(��;�-X�*��B�B�A �A(�D0n
(A DBBGo
(D ABBHD(D DBB X+L�� A�I��
AEzRx��� ;�!0�+��oF�D�F �G�N
 AABAzRx�����$�:�0, ��WF�A�A �G��
 AABHl:�l \,8��mE�|
OA
G�'�:�(,�,p��E�A�G@y
AAH�,���C�,,���,8��C-t��,-p��I�A�D �B
ABE�":�=8X-����F�B�B �A(�H0��(A BBB�+:��-ܳ�4E�a
JC�-<��HO
I�9��-���)H`H�9�($$.���Qx
GTLI
A��9�P4`.$��oF�A�D �U
DBJ{AB�.\��1Hh�|9�(�.p��5Hl	x9�(�.���$H[/���T}X /$��B�B�B �B(�A0�A8�Dp�
8A0A(B BBBG2xa�MxAp�9��/d���/`��!E�[�/t��&E�Y0�/���PE�A�G P
DAF_GA0���BHu`
s8�x<0���E�h
C`+�8�(p0Ա�HI�0|��!�0��� HW�0���JH}o8��0���WfZH�0��B�B�E �E(�D0�A8�Q��
8A0A(B BBBI8H1���B�E�A �D(�I��
(A ABBDL�1P��DB�E�B �B(�A0�A8�J�A
8A0A(B BBBF`�u7�)�1<���18��H24��F�E�E �B(�D0�A8�DP�8D0A(B BBB$\2���BE�I�G jAA��6�<@�2��F�B�B �D(�A0�D@�
0A(A BBBA
�6�6�2t��E�Q.�6� 3d��HQp
�6�@L3X��@F�B�B �K(�A0�DP
0A(A BBBA��s6��3@��E�M�3D��!�3`��H�3\��F�B�B �B(�A0�A8�D@�
8D0A(B BBBF$3�5�8 L4��VA�a
Ff
Bp4T��^X�4���K�E�D �A(�G0P
(A ABBFF(C� D�E�B�T0����8�4��|F�I�B �A(�A0�a(A BBBl5H���K�E�B �B(�A0�C8�GPM
8A�0A�(B� B�B�B�Ju8A0A(B BBBA������,(�4�(@�5���9B�E�E �D(�D0�D`p
0A(A BBBH���4�"�5�4�+AAb$6`��nA�D�I ZDA,<6���lDg
EK
EK
EK
EK�R4�"�6`4�+AAb(�6���|B�I�D �iAB4�6���B�A�A ��
ABHCDBH7���B�B�B �B(�A0�A8�D`�
8A0A(B BBBHd&�3�`7d��'HWx7|���7x��HU�u3�( �7l��Tk
ID
DXe3�(8�7���JF�F�D �D(�D��
(A ABBH�[=3�PH@8���{F�E�O �H(�D0�p
(A BKBJA(C BBB�8��wab�3�`�8l���K�D�D ��
�A�B�HY
ABD{
�A�B�JZ
�D�B�HP���p.�2�09���kMYH9<��
\98��4p94��{F�I�A �D(�D0\(A ABB�9|��(��9���3F�E�E �E(�H0�D8�G@t
8A0A(B BBBJ}
8A0A(B BBBIj
8D0A(B BBBI@
8A0A(B BBBF@9�1�3\d:0���F�B�B �B(�A0�A8�DP�
8A0A(B BBBDR8C0A(B BBBd-J1�-�:���#,�:���YF�A�A �D
ABAp01�(<0;���F�K�B �A(�A0�F
(A BBBF`9�0��; ��)�;<���;8��@�;0��L�B�B �B(�A0�E8��0A(B BBB<���y8<(��`B�E�B �A(�D0�J(A BBBX<L��l<H��#�<d��#�<���	�<|��	�<x���<t���<p���<l��.HeHX/�$=p��.HetA/�P=t��	d=p��	x=l���=h���=d���=`���=\�� E�Z�8�.�4�=L��pF�J�D �F(�D0H(D ABB�x.�$D>p���E��
BQ
GQ0l>��/F�A�D �J��
 AABJ�>��E�R�9.�<�>��A�A�G [
AAJD
AAJuAAt$�-�,$?p��F�A�D �\
ABF(T?����E�G�G �
AAGH�?���F�B�A �A(�D0t
(D ABBED(F ABB�-�4�?���F�E�A �G(�Q0[(A ABB��,�*$,@(��(E�D�G IIA,T@0���N�G�G �
AAJP����@��	F�B�E �B(�A0�A8�D�N
8F0A(B BBBAD
8F0A(B BBBAD
8F0A(B BBBAZ
8F0A(B BBBA_
8A0A(B BBBAs
8C0A(B BBBAn
8A0A(B BBBA@
8A0A(B BBBA�>�+�|�A���0�A���qJ�A�D g
G�A�Jh���A���R��D��A`���E��
AB ��H(B����B�B�B �B(�A0�A8�DpV
8A0A(B BBBBtB@��E�VP�BD��F�O�B �E(�G0�A8�G��
8A0A(B BBBA@�B����B�E�B �A(�A0�DP�
0A(A BBBBH(C<��gB�E�E �B(�D0�A8�D`-
8C0A(B BBBHHtC`��(B�I�E �B(�A0�D8�G��
8A0A(B BBBF���)�-0�C0���F�E�A �DPg
 AABE0D���F�D�D �GP`
 AABAH<D8���F�E�B �B(�A0�A8�G`�
8A0A(B BBBD,�D���)E�D�J�
AAAzRx����$�(�,�D���)E�D�J�
AAAh�(�,0Et	��)E�D�J�
AAA��(�(tE`
��E�D�J��
AAA�Z(�,�E@��E�D�J�
AAA0$(��E���K��
AF��� (F���<F���PF���#HZhF���(E�b�F����F���#HZ�F
��(E�b�F
���F
��#HZ�F,
��(E�b<G@
��zH�B�A �A(�F0T(D ABBA����TG�
��=E�lG�
��=E��G�
��H�G�
���B�B�B �B(�D0�D8�Gp�
8A0A(B BBBBD2&�(�Gl��PE�D�D o
AAJ$H���@H�pH@H���MF�E�E �E(�D0�A8�D@�
8D0A(B BBBJ�H���&TQ�"w%�0�H���B�A�A �G��
 AABA\�H���.F�B�B �A(�D0��
(J BBBNA
(C BBBFA(F BBBLIx��`I�$�:EAD |I�$�EAF�I�$�EAF�I ��&�I<���K��
A�I�$��E�J�8J����B�E�A �A(�G0j
(G DBBG�%%�(4PJD��cF�E�D �I(�D0}(D ABB8�J|���F�E�D �I(�D0
(D ABBD8�J����B�B�A �A(�DP�
(A ABBHTF|$�$K���6A�A�G iAA<K���PK���dK���!xK$��E�J��K�$��E�C�J��K�%�>EAA4�Kt���B�A�D �p
ABF\
FDJ\Ay%� 0L�%��F�D�A �G�� AABPL����A�A�G0)
&�#�L���'EAK�L���'EAK�L���'EAK0�L����F�D�A �G��
 AABA0Mx���F�D�A �G��
 AABA0@M$���F�D�A �G��
 AABAtM����M���'E�W�M����M����M���-�M���6E�l �M���E�J��
AA N����E��
KDI`$�2TN���NHElN���@�N���cE�E�G0d
AAI
AAGW
AAG�N ��KH~�NX��!�Nt��Op��RHEO���LHw
A08O����E�D�D �
AAESAAlOh��;HY
GN�O���'�O����O����Q�
D�O�"�EAA�O����E�C
HK�"�$$PP��OE�G�K uAA�5�"� L`Pd��jF�B�B �B(�A0�A8�G�*
8A0A(B BBBG$zRx��������,E"�3$�PH ��WE�A�D JAAx6<"�HH(Ql ���F�B�B �B(�A0�A8�D`X
8A0A(B BBBD$�@$"�rOhNpNhA`S
hNpM0�Q� ���F�A�D �D@�
 AABA\*:"�$�Q !���E�F �
AAR�!���H�v
BzRx�� �!�( XR"���E�D��
AHzRx��� �!�(4�R�"��\F�E�I �A(�D0y(D ABB�R�"��$�R�"��oE�A�D aAA�8H!�,4S#���F�D�A �^
ABD�H!�LxSl#��zF�B�B �E(�A0�A8�G�#
8A0A(B BBBK<�S!��S�&��H�S�&���F�B�A �A(�D@�
(A ABBC�(A ABBX,�!�PPT�'��`dT�'��JF�E�E �E(�A0�A8�G@�
8A0A(B BBBHD
8J0A(B BBBI�S^!�PT�T�(���B�E�E �D(�K0�J�E�H�W�A�\
0A(A BBBBL4U0*���F�B�B �E(�A0�A8�J�h
8A0A(B BBBC@�Up/���F�B�E �K(�D0�G��
0A(A BBBA zRx�������(� �,V�1��.J�A�A ��
ABG84V�2���B�B�A �A(�D0a
(A ABBG02!��VP3��	(�VL3���A�C�G��
AAJ8�V 4���B�B�D �D(�J�p
(A ABBD�_� �4W�4��{A�M�G \
CAKo
CAA8LW5���B�E�D �J(�D0B
(A ABBGH34 �L�WH5���
B�B�E �G(�D0�C8�G�
8A0A(B BBBE$zRx��������,��,(X�?��mI�I�D �D
ABC8XX�?��aF�E�D �A(�G��
(A ABBG zRx������(% �o(�X�@���E�D�F@u
AAA�&T �YXA��)Q�W4(YlA���B�D�F �n
MFSYEE0`Y�A��F�A�A �G��
 AABCzRx�����$��#H�Y|C��6B�K�B �E(�F0�A8�D`�
8A0A(B BBBBZpD��HDB I4ZpD��!HDB R TZ�D���E�I@�
AF��'(�Z�D��E�A�J�z
AADzRx����$��0 �Z�E���E�I k
AFP7��A0$[PF��=A�D�F P
CAAXCAX[\F��sI�P
GK|V��O(�[�F���A�A�G@M
AAH<�[|G���E�K�G Y
AAF^
FACbFA�[�G��BqL\H���F�B�B �B(�A0�A8�I�Y
8A0A(B BBBF,��p\�J���\�J��$�\�J��qE�I�D \AA�\�J��	(�\�J��QN�D�G pAAE��]$K��&HYP7Z�((,](K���E�A�D@�
AAE+B�(Hl]�K��PB�E�E �G(�A0�D8�F��
8A0A(B BBBA \
�9D�]�O��F�E�E �E(�D0�C8�D@T8A0A(B BBB^P��HB O(0^P��fE�F�L0G
AAA \^XP��UA�R {
AA�:{�(�^�P���A�A�J��
AAHzRx����$2�J4�^�Q���E�A�D k
AAILAA,_HR��gH K
E.�(\_�R��Lt_�R���F�B�B �A(�A0�G� L�@L�AD
0A(A BBBA zRx��A�����(��T�_�S��FMY
JQ`�S���H@
Hp:��(L`XT��VE�D�G@~
AAAx`�T��^L��
C�[N��`�U��+�`�U��(�`�U��|E�F�GpY
AACa4V��a0V��(a,V��@<a(V���QLL E(E0E8E@EHEPEXE`EhEp\IWVH�a�V��UF�B�B �B(�K0�A8�D`�
8A0A(B BBBK�P(��a�W���a�W��
,b�W��fI�D�D �PABA���8<b�W���B�A�A �w
ABBY
ABF�W��(H�b8X���B�B�B �B(�A0�A8�D@�
8D0A(B BBBG�aR�(H�b�Y��!B�B�B �B(�A0�A8�DP9
8A0A(B BBBG�U��DLch[���F�E�E �B(�G0�D8�DPm8A0A(B BBB�c�[��0�c�[���E�A�D d
AAH|AA@I>�((�cD\���E�A�D @
AAD�I&�(40d�\��\F�D�G �v
ABFHABHhd�\��}F�E�E �D(�G0�q
(C BBBKL(A FGB�d�\���d�\��H�d�\���F�B�D �G(�D0z
(A ABBI[
(F ABBJ(el]��<eh]���Pe$^��	de ^��/E�i(�e4^��oE�A�D a
AACK��(�ed^��:E�b
QA0�e�^���F�A�D �G@
 AABAf�^��C0(f,_��YE�A�D C
AAADCA\fX_��Kpf�_��SL�f�_���F�B�B �B(�K0�A8�D�:
8A0A(B BBBH<d��(�fc��>F�A�A �rABg c��7E�qL0gDc���F�B�B �B(�D0�A8�G��
8A0A(B BBBD��0��g�e��2E�a
JA�g�e��!�g�e���g�e���g�e��P(h�e��DM�A�A �qAB 4h f��E�C
E��
HzRx���$��(4�h�f��`F�B�A �A(�D0H(D ABB�D��(�h�f��BH�r�h��+AAbHig��LB�J�B �B(�A0�D8�F`!
8A0A(B BBBAxXS�Dti�g���F�J�E �E(�D0�C8�D@X8D0A(B BBB�i8h��BE�q�ilh��6E�pH�i�h���F�E�B �G(�A0�i
(D BBBHD(A EBB0hx�Tj�h���Tc
IR�DI�8�j|i���F�B�I �A(�G0Z
(A ABBG�j�i��E�M4�j�i���F�E�G �A(�D0~(A ABB�F��$,k8j��vE�F�G aAA�P|�hk|j��|kxj��c(�k�j��dE�A�G n
DAA(�kk��gE�A�G q
DAA$�k\k��/E�H�G IGF8ldk���P�D�G �
CAHDFAA��Ll�k��7`l$l���,tl�l��iE�C
B�E�E�J��
A(�l�n��IF�A�D �rDBH�lo��PF�B�B �B(�A0�A8�G��
8A0A(B BBBJ$zRx��������,��(Xm�o��4lm�o��@F�E�D �G(�G0I(G JBB,�m�o���E�C
F���M��#
B�o2�P�mxs��tn�t��	@n�v��DF�B�B �A(�C0�Dp�
0A(A BBBB�^��ln�w��!H X�n�w��G4�n(x��}B�I�D �V
ABHIAB(d��4�n\x��jF�B�A �A(�D0R(D ABB�JZ�(4o�x���Y��IV�P`oDy��!,to`y��BE�A�G�
AAEzRx����$.��oLz��NE�H�o�z��aY�Z
Mp�z��9HodJ��@p�z��`Ht
TN�J��tp{���p{���p({���p4{���p@{��*H]KQ�(�pD{���K��
Aq�{��, q|��IE�A�J�1
AAAzRx����$��D4�q�|��zA�A�D Z
AAFv
AAH4�q8}��zA�A�D Z
AAFv
AAH�q�}��NE�H8r�}���F�E�D �A(�D@�
(A ABBA8Lr(~���F�E�D �A(�D@w
(A ABBA8�r�~���F�E�D �A(�D@w
(A ABBA<�r�~���F�E�D �A(�D@w
(A ABBAsP��sL��,sH��O@s���HS�MA
�(lsx��/E�i�n9
�((�sx���F�A�D �zAF�s����s���(�s���tF�D�D �k
ABDt(���xHg
EpN��$Ltx���?E�A�M iAAtt�����K��
A@�t4����F�A�D �s
ABGX
DKIXHB�t����	�t����\�t����KF�A�A ��
ABFW
ABFj
ABCS
ABJW
ABF�j��aLput����E�A�G n
CAAR
CAJR
CAJL
CAH(�u��E�A�D M
AAGP[o�( vT����E�
Lc
M(q_�x8v����HQ�P��(dv����HQ�P��(�v����HU�P��(�v����%H\Q��P�v����)E�_r��(w����iE�n
Ee<r��PLw؃��xH j
A8F��(|w(���	$�w$���NE�A�D zDA]��(�w8����w@���0Hf4R��xD���3Hi`Rt�8<xX����F�B�B �A(�A0��(A BBBhv5�(�x����.E�d�s-�P�x����HUSQ�(�x����MHZ
NG
E@SE�(yȄ��MHZ
NG
EtS9�(Py��'H^�S5�(|y��aJ�c
C\��t)�(�y$���#E�Y�t!�(�y$���0_�y@���#E�Yu�(8$z@����B�E�D �D(�GPq
(A ABBA0`z�����B�I�D �D��
 AABA8�z0���B�E�I �A(�KPr
(A ABBD�z���.X�U�z(���E�Qd{,���MO�B�A �A(�G0�
(A ABBD�����H0�����
(D� A�B�B�I@p{���F�H�E �K(�A0�DP�
0A(A BBBA��	�i0�{̉��%F�I�D �T�N
 AABGH�{Ȋ���F�Q�D �G(�D0c
(C ABBGu(C ABBX^	�4\|����F�D�A �G@~
 AABD�|����$�|�����E�P�\ ^AA�|���H S0�|����B�D�A �G0�
 AABA�l��(0}Ԍ��YE�D�G@P
AAFKq�(8p}��F�D�D �I
ABF_
ABAsI�(8�}d���aF�A�A �G� L�@I�@�
 AABAzRx��@���$�(H0~d���"B�B�B �B(�A0�D8�DPU
8A0A(B BBBAq��(H�~4����F�E�E �B(�A0�A8�G`�
8A0A(B BBBA�m��(H�~t���1F�J�E �E(�A0�D8�D@�
8D0A(B BBBB<h���Pd���Ld`���gF�E�I �B(�D0�A8�Dp`
8A0A(B BBBGH������B�E�B �B(�A0�A8�D@�
8D0A(B BBBHH����B�F�B �B(�A0�A8�H��
8A0A(B BBBDL�ؚ��CHPu
Ah����=H o
A(��0����E�CQ UAA
H ������8E�D mAԀ���������!��ț��"$���AE�H�G hCA,8����KB�A�D ��
ABGh�,���-,|�H����B�D�A ��
ABEw��($��ԝ��PE�D�G }AA�����8D��(����F�A�D �e
ABED
AEFQ
ABL�wy�(X�����
l�����
������
������$������TE�D�J ~AA4h�P���_���������1J�dB�(�<���<�H���P�D���
d�@���!x�\���/��x���"������7(������jF�P�E �KAB$����bE�d
Gd
LA4�L����Q�D�D e
AAHHAAF���i��"0T�����GE�A�D l
DAEDAA��������Ƞ��iE�p
K�����E�PԄ ����$������E�m
FC
EE`�T���IP�B�B �A(�D0�4
(D BBBI{
(A BBBFq
(A BBBAd���@(��,���gE�D�D0O
AAB8��p����F�A�A �g
ABF@
ABA����YO�@
AH�T���YO�
BH80�����`P�H�A �A(�D0p
(D ABBA l�����A^�R
HEC�����(<�����yE�A�D z
GALD
DAODCA�@�����L����4���TF�H�D �F(�G0l(C ABB0D�����F�A�A �D0�
 AABFDw�(��X���>H p
A��|���(E�b���5E�V
EQ4������F�A�A �i
ABDEAB0�����F�A�A �G0�
 AABFxo�(d�����J�x������F�E�E �E(�D0�D8�D@@
8A0A(B BBBEm
8A0A(B BBBIL
8D0A(E BDBBT
8A0A(B BBBA����PH ����|F�B�H �D(�D0�^
(A BBBCt(A BBB\���(��4���pE�X
C�����(0��p����E�A�G Z
AAGSGALo���(8������OF�A�A ��
ABCh
ABE�w��xHL�����kF�E�D �A(�G0k
(J ABBOD(A ABB8��ܬ���F�B�A �D(�G@C
(A ABBC�bS��(�<���IO�qH�0�p���F�D�A �J0`
 AABA8�����MXp�e���(d���DTY
KK$�����IE�D�G vAA��8���0��D���bE�D�D r
AAGWAAXq���($�l���SE�D�D CAA�qo��($D������E�]
FP
HPl�H���`(������E�C�J 
HAD$������sE�H�D \DA,Ԍ���E�D�G��
AAA(������F�D�C �W
ABIL0�����F�E�B �B(�A0�A8�G��
8A0A(B BBBAp;G��x(��p����I�D�I ��CB�����ԍ ���(�(����E�E�G0�
AAA(������F�D�C �W
ABILD�����	F�E�B �B(�A0�A8�G��
8A0A(B BBBA8{����8��L���
B�B�B �A(�A0��(C BBBԌ#��(���������4$� ���KS�A�G �
AAHh��O ���t��xp�$���4�� ����F�B�A �A(�D0z(A ABB|k��(Џd���$�p���,E�G�G IGD�x��� �t���$4�����AE�A�D tAA\�����Da
K��jS��PH������cF�B�B �B(�A0�A8�GpV
8A0A(B BBBK<]C��@4�����\F�E�A �A(�D0}(D ABBX(������F�B�A �A(�G0`
(D ABBFR
(A ABBHT(D DBBDm��($����AE�C�G oAA8��D���B�D�D �\
IBOA
ABD�����	����$$�����E�I�G qFAHL�h���B�B�B �B(�A0�A8�D`�
8A0A(B BBBA(�����$E�D �
AHzAo��P(ؒ����A�A�D R
DAKhx��PH�\���F�B�B �B(�A0�A8�Dpt
8A0A(B BBBH�_��(x�����E�A�D@�
AAAda{��((��<��mF�A�A �aAB8�c��($��l���E�A�D �DA�yO��((4����E�A�D g
AAE�y7��(Ht� ��F�B�B �B(�A0�A8�DP�
8A0A(B BBBI`����8 Ԕ����A�G �
AA8q���PH�X��F�B�B �E(�A0�A8�D`2
8A0A(B BBBGp���Hl����F�B�B �E(�A0�A8�D`�
8A0A(B BBBFЄ/��(̕h���I�I�D �lCB���������$����8����L����!(`�����M�D�I �uAB,��h��cZ�A�G �}AB�����1E�k(ؖ���E�A�G �
DAGh|���(8�����M�E�J �D(�A0��(I DBBT�P��l�X��/��t��bE�b
I�����WHN�q���0ȗ����F�F�A �G02
 AABFȇ����8�����F�B�H �A(�J0y
(C ABBD0L�8���F�A�C �J��
 AABF�l-��($�����EE�A�D gIF ~��($���PE�A�D CAA\~��($����VE�D�L {DA$4�0��VE�D�G CAA0\�h���F�A�A �N0�
 AABE\����P4�� ���F�E�I �D(�D0�(I CBB0ܙ����B�D�A �G0�
 AABAL�����F�B�B �B(�D0�A8�G�.
8A0A(B BBBH����$t����E�I�D `IC ��H��E�K �
AA��$�10ԚP��F�A�A �G0�
 AABAԊ]��((����E�D�D0y
AAH(H�L��M�I�D ��CB$t���%E�A�G UAA����Y4��D��E�F�G q
AAKi
AAE���0����B�I�D �D0�
 AABK0���AD|�vE��(4\��tB�I�D �A(�D0Y(A ABB��P�9H��|��B�B�B �B(�A0�A8�Gpj
8A0A(B BBBKTi���P$���=E�A�J dCA����(4D����F�J�A �D(�D0b(F ABB|�����10��,�BE�C�N N
AAJKAA0ܝH�sF�A�A �G0�
 AABD܍��(4$����F�J�D �D(�D0�(I CBB8\�8��F�D�D �A(�D@]
(A ABBJ�v���P����8(����cF�D�D �QAB$����E�D�F �AA���0(����F�I�A �G0�
 AABA\�x�6Lp���+B�A�A �g
ABBF
ABGU
ABHDDB8�����B�B�A �D(�GP�
(A ABBEP����8�$�~F�B�A �A(�Gpp
(A ABBI�h���:@`�T����F�B�B �A(�A0�G@@
0A(A BBBE�w��(H������@F�B�B �B(�A0�A8�D`�
8A0A(B BBBC����8����YH{
MDp{���(0L�����E�A�D G
DAJlAA����P��P���: ��|����E�I �
AA̡H���1(�t���qB�A�D �fAB8����2F�B�A �A(�Gp
(A ABBD�j��((\�����I�I�D ��AB��L��+Hb$��d��%E�A�G UAAȢl��HT�t��HT(��|��.E�D�G [AA $�����E�K �
AAH�,��(\�8��A�D�G0�
AAA����P����YA�S���L��<E�o؞���(�\���E�A�G b
AAGx���((����8<�����F�B�A �A(�G@�
(A ABBB�|����0��x��eE�F�G i
DAHWDA(�����E�I�D0�
DAA����(����dB�D�D �NIB40����kE�A�G c
HAG�
AAD$h���kE�D�D IOAH��d��|F�E�B �B(�A0�A8�D`0
8A0A(B BBBE0ܥ�	��BE�C�N N
AAJKAA8��	��Q�A�N �
A�A�GA
AAE\L��
���F�B�A �A(�N0i
(D ABBFI
(D ABBF�(D ABB�����1O�ZG�(Ȧ����M�I�D ��CB$����IE�Q�] IGA ����CE�G �
AC�����$T��
��nE�A�D aAA���(�����������
��̧���A��
GL����OB�E�D �D(�G0�
(A ABBKp
(A ABBJ�����xP�t��0d����nB�D�A �G@�
 AABH$����(�����`HN
JN̨�������(����B�D�A ��AB ����+Hbp�%��(L����	`����	t����BE�q
JA�����(�����LE�M
Fĩ��ة�����������(����#E�]D���	HX����F�B�B �B(�A0�A8�DP�
8A0A(B BBBAD�	��(��l���E�A�D �
DAI�0����<��zH f
B����cHN
Ih����D����zH f
B`�D��cHN
I��P��(�����ZF�I�H �AB�����HS�	��(H�����B�B�B �B(�A0�A8�DP�
8D0A(B BBBCԞ���PH�L��"HLD I�����(|�H��+HI YP��\��yF�E�E �E(�D0�D8�J@IHHP]HA@U8D0A(B BBB����!D����sB�J�E �E(�D0�D8�D@C8D0A(B BBB H�����E�Q `
AIl�h�� ��t��	��p��	$��l��GE�I�J iDA���!����bE�F
UA�y��P(����/A�A�D0�
AAH؊���PX����l����1PR�����(�����+A�^ �����E��
LA
Aخ���\H@N
A4�����F�E�D �F(�G0](A ABB���0@���!F�A�A �D0
 AABA@����^0������F�A�A �D@�
 AABAH����^L���lF�B�B �B(�A0�A8�N��
8A0A(B BBBJ�����(4�����E�A�G0�
AAA�H��bHt����F�B�B �B(�A0�A8�D@�
8A0A(B BBBA��J���԰@ ��xE�P
K�����(�� ��BE�r
IA(�� ��	4<�� ���F�A�A �`(R0M(A x
ABEȦ���(��!��(��!���E�A�D0�
AAG\�Z��(ܱ�!����!��
��!��?H0q
A0 ��!��ME�C�D K
CAEhCAT�"��	h�"��5Jj�����((�� "��PM�I�C �sAB��D"��ԲP"��p��"�����"��hH�#��F�B�B �B(�A0�A8�DP�
8A0A(B BBBA����p��%��	���%��!���%���H`
HV�R��-г4&��94�`&��nF�E�D �H(�G0I(A ABB��&��E0��&��((D��&���A�A�D`i
AAGLp�d'��&B�B�B �A(�A0�H��Q
D��^
0A(A BBBE zRx��������(W��I��(��E�Yx�(���F�E�E �E(�D0�D8�DPu
8A0A(B BBBHp
8F0A(B BBBID
8F0A(B BBBE0����)0��@)��nE�D�D e
AADkEA<����0�h)���F�A�A �D0�
 AABA( ��)��tE�A�D I
AAA��t��d�0*��;4x�\*���F�J�A �D(�D0�(H ABBp�%��&4�*���F�F�A �D(�D0�(A ABB�����0�4+��;F�A�A �G@�
 AABIЏ���R@X�,,��IF�E�B �A(�A0�GPj
0A(A BBBH�M���'H��$-���F�B�B �B(�A0�A8�Dp�
8A0A(B BBBK\���� �p.���A�D j
AH8��.��Dg
ENX�</��*A�d$t�P/���A�a
FI
GK��q��($���/���D�
HT
DV
A(ظl0��,A�A�G0�
AAD��1��x�\1��	,�X2�� HW|�i��(X�L2��FK�tA�\t��2���B�H�E �A(�D0�h
(A BBBEA
(F BBBKi(A BBBHԹ�2���B�B�B �B(�A0�A8�D`*
8A0A(B BBBF4 �D6���F�L�I �A(�D0z(D ABBX��6��,l��6���F�A�D �P
DBG|��h7��8F�B�B �B(�A0�A8�DPT
8F0A(B BBBK�
8A0A(B BBBEd
8F0A(B BBBA�����P0�>��oH~
A�����P`�T>��~HF
B�����PL���>��zF�B�A �A(�D0�
(C ABBJd
(F CBBA�����P��?��5��?��
H��?���F�B�B �B(�A0�A8�D`�
8A0A(B BBBA(h�l@��,E�G�G IGDH��p@��wB�J�D �A(�G0|
(A ABBFP(A ABB��@��<��@���A�A�G0[
AAJD
FAEFAA(4�A��bF�P�A �GAB`�DA��!Lt�`A��FX�E�D �G
ABEF
AEDH
ABEs���Ľ`B��	$ؽ\B��GE�A�D wDAd���(4�pB��zF�A�A �`
ABEFAB�����(d��B��	x��B��*O(���B��%F�D�D �SAB����(̾�B��6F�D�D �bCBL������B��4 ��B���E�C�G x
AAGL
AAB��K��(l�HC��(��DC��aO�O�D nH�A����C�����C��E�ؿ�C���L�������D�D���D���H�l����(HL�hD���B�E�E �E(�A0�A8�Dp�
8A0A(B BBBA��������D���G��
A<��E���A�A�D V
AABd
FAEDCA,��E���B�D�C �O
ABE8�\F��DV�����d�PF��GD{
AF�����(�����+AAb��PF��(H_����0�TF���B�D�G �G0W
 AABAH��F���B�B�B �B(�A0�A8�D`t
8A0A(B BBBDx�K��-G
hGpQ4|�8H��zF�A�D �^
CBBAFB���H��!HX���(8���H��B�J�E �K(�A0��(A BBB�hI��E�X8�lI���W��C�X����4h�,J��ME�A�D �
AALD
AAJ�n��P��0K����,K���E�@
K�v��(���K���E�U
Fe �j��x0��K��D��K��JE�p
SAh����(Dx��K��"F�B�B �B(�A0�A8�D@�8D0A(B BBB��f�����L�����L�����L��,HcL����(��L��<��L��,Hc��`��h��L��4|��L��hF�E�D �C(�G0H(A ABB��M����M��1Hh����P$�� M��PE�D�G zDA�HM��,Hcl����8H�LM��hF�E�D �D(�G0g
(D ABBF���M��4HkԠr�����M�����M��)H`�7�����M����M��H��M���F�E�B �E(�A0�D8�D@E
8D0A(B BBBC8d� N��XO�A�D �q
ABHACBA���H��DN��pF�E�A �A(�D0
(D ABBGD(C DBB��hN��%@��N��$F�B�B �D(�D0�D@�
0A(A BBBDD�pO��,Hc�����p�tO��GH0y
A���O��,Hcܢy��4���O��jF�D�A �Q
ABAFAB8���O��vR�F�G �{
CBAAFBG���H,�(P��	B�B�B �B(�A0�A8�D`�
8A0A(B BBBAHx��P���B�E�D �A(�G0h
(D ABBDJ
(D ABBE0���Q��yE�D�G e
AAItCA0���Q��1F�A�D �G@�
 AABH(,��R��@F�A�A �tABX�S��2Hi�����0�� S���F�F�D �D0�
 AABE4���S��mF�E�I �D(�D0G(D ABB��T��2Hi@���4�(T��eF�E�D �D(�L0|(D ABBT�`T��4Hk�����(��tT��LF�D�F �xAB����($���T��/E�I�G TDA���T��2Hi8�Y����T��(��T��2Hix���@T��T��fF�D�D �m
ABBJ
ABKJAB���T��2Hi����$��U��4E�I�G YDAD��U��V�B�B �D(�A0�s
(A BBBG`�����4��U��2Hi����(`��U��xF�D�D �fAB��HV��,Hcܧ�����LV����HV��,Hc������LV��	�HV�� �DV��4�PV��Ga�eT�'��(d�pV��7x��V��70���V��xF�G�A �D0\
 AABA$��W��6A�D�G ]GA(��,W���P�A�G }AAI����W��WH {
EN@4�X��F�B�E �D(�D0�Q�|
0A(A BBBFx��X���K��
AH��`Y��$F�D�B �E(�A0�A8�N@�
8A0A(B BBBBL��D\���F�B�B �E(�A0�D8�G�X
8A0A(B BBBC$0��a��,E�D�J IJA0X��a���F�A�A �G0�
 AABAL��b��XF�E�A �H(�D0�
(D ABBE|
(A ABBN��(c��*H a��@c��cHN
IH����$��c��*H a<��c��cHN
I��X��l��c�����c���O��4��xd���F�B�A �H(�D0�(H ABB��@e�� ��<e���A�c
DB
V����( ��e��2A�\
SA@��e��:E�t0\��e���B�D�A �I�z
 AABA��Y��0��@f���B�D�C �G�p
 AABD��0��@���f���A�A�D i
DADn(P0`(C x
AAA�����(D�0g��9A�e
JH(d�Pg���B�A�H �oAI���g��cA�M
B�����(P���g���F�B�B �B(�A0�A8�G� L�@L�C�
8A0A(B BBBE$zRx��C������,6���T�Pk��Yh��k��=fI���k���(���l��^F�A�H �KAB���l��1H���l��	F�B�B �B(�A0�A8�D@q
8D0A(B BBBH�.��K4��m��3Hf��M��=$`��m��eE�D�K NAA4���m���E�K�H M
DAEK
DAE$�����@n��eRx
AU,�����|n��^RGX����f,4��n��E�C
F���J���
DHd��o���F�B�B �B(�A0�D8�DPK
8A0A(B BBBF$���p��]E�O�F @AA(���p���E�H�F _
AAAh�^��v�hq��BE�a
JQ(<��q��nF�A�A �bAB��p��P|��q��:E�c
PA,���q���Y�E�G l
AAE@��Xr��sB�E�B �E(�A0�A8�R0A(F EBB��x��7$��x��	L8��x���F�F�D �D(�G0�
(A ABBHL
(D ABBK��lz��	,��hz��SF�J�D �
ABJ���|��	8���|��wF�E�D �D(�G�Q
(A ABBA@��|��2B�B�B �B(�D0�D8�0I(B BBB`�Ԋ��bt�0���	L��,����F�F�D �D(�G0�
(A ABBHL
(D ABBK��܌��	,��،��SF�J�D �
ABJ����	80����wF�E�D �D(�G�Q
(A ABBA4l�H���YF�B�A �A(�D0D(A ABBd����(��\���+Hb����(��`���HU4�|��(�T���RE�
LA4�p��PD�����HO�����(p�t���BE�k
PA�����(������������	������H������gF�B�A �A(�D0x
(A ABBDP(A ABB���PD�����X�����l������Dy
C�����0�����PE�A�G R
DALVDA�����+AAb<������F�B�E �D(�I0�c
(A BBBD�W��@�T���HU��F��($l�H���UE�D�D EAA��2��($��l���hE�c
HR
NS����((������mF�E�G �WABd���$�А��:Hqt����P���HMh���	|����������	����
����Si�i��(���3A�L
KV$�H���nE�A�G ^AA4�����CE�X
C^4T������B�B�A �A(�D0�(A ABBL����f(�����_E�D�L l
AAE(��H����w�D�J WAAB�� �������E�H@�
AA�4���(0�$���HMH�,���=Ht��w��(t�@���>Huĺs��(��P�����L�����H���	��D���HV0�/���8���&HY\���8�<���#HZ�����d�@���3Hj�����64��T���{M�A�A �]
ABAd
ABI����������8Ho����������������0�e��EAHL����� E�Zl�B��|�x���4��t���sF�D�D �n
ABAU
ABH����>����������������������0�����	D�����4X�����kF�D�A �I
ABIj
ABC���������H������9B�B�E �E(�A0�D8�F��
8A0A(B BBBK@���H�����B�B�E �E(�D0�C8�G`u
8A0A(B BBBE��F��|�H�����D�����P�����L�����X���P��T����F�E�D �H(�G0S
(C ABBGH
(F ABBE4�����!H�̗��\�ȗ��	0t������F�D�F �N�s
 AABK̹��(��8�����4�����0���)H`��H���1TR�p���V(�����DA�r
EG(H����A�A�G m
AAH��p��$��L���'E�D�G MDA4��T���>F�D�D �Q
ABFRAB<���H��H����F�H�B �D(�A0�W
(C BBBKA(D BBB(H������E�A�D0~
AAA����@��ܙ��F�B�B �A(�A0�D@�
0A(A BBBA�Y��$������@E�D�D pAA������E�i
JTL(�,����F�B�E �B(�A0�A8�J�
8A0A(B BBBG�,���B ��ȧ��XE�G0E
AA!���"���������
������AL�t����@����@F�E�B �A(�A0�G��
0A(A BBBA$`����DE�A�D uCA0��<����F�H�L �J�^
 AABJt����������Z��̪��HN�Ԫ��T0� ���F�L�D �D`�
 AABH����\�����3HM
KR��e��J�����
0�����8F�F�D �J��
 AABDzRx�����$���@�ج���F�E�E �A(�A0�D`�
0A(A BBBAP�T���TH F
Al�����TH F
A��ܭ��TH F
A�� ���oH K
E��t���oH K
E8��Ȯ��[F�G�A �C(�M��
(A ABBE 8���<@,�د���F�E�E �A(�D0�D@�
0A(A BBBB(p�����qE�A�D`�
AAHzRx�`�� ���(�������E�r
I�����P@�������F�H�A �G�Q�E�X�A�l
 AABK(@�����;E�A�D`�
AAF�N��((������;E�A�D`�
AAF6��((�������E�L�G�w
AAG ��H���qE�Q0T
AAl&���$$�����GE�I�D oDALL������B�E�E �H(�D0�A8�D�T
8A0A(B BBBA�'�����$�����0�����<���L��H���DF�F�B �E(�D0�D8�G�a
8A0A(B BBBC�����P�4���IH {
AHl�h����F�B�F �B(�A0�D8�Gp
8A0A(B BBBF����<��ȼ���F�E�D �A(�G�w
(A ABBD �X���dE�G F
AE 0�����\E�G A
AB@T���F�E�E �D(�A0�G@a
0A(A BBBK<������~T�M�I �H(�D0�u(A BBBF���������J��(���nH M
K�|���HLX�@��(4�p����Hp�
IP�4���d�@���(L[0|�X���QE�A�D r
FAEDCA4������wF�D�D �K
ABDPDB@������F�B�E �I(�D0�D@�
0A(A BBBF8,�X��iF�E�A �C(�GP0
(A ABBA�� ��(|�x��E�Q��|������� ������A�R�V
AF H���6(�����A�F�G0f
AAJ�����08�l���F�A�D �J�g
 AABH l����E�I |
AE�����	�������|��	8��x��TB�E�E �D(�A0�y(C BBB����]H H
A�����(8����L����`����8t�����F�B�D �A(�F`{
(A ABBD��l��$��p��KE�D�G oFA������ �4��\E�G B
AA$�p��8�|��XL�����Q�J�E �F(�F0]
(A ABBAl(C ABBD����C0����h����x$����PE�D�G }AA�0��8��\���X��H ����4����
(H����kE�A�D r
AABt���������
�����
�����(����5F�D�D �cAB��������
$����/E�D�G \AA@����T����1h���)|�(����4��)��P��!��l���h��/E�W�|�����������aO�_
B0�~��(@����rH0~
J\�(��HH0z
A$x�\��,E�G�G IGD ��d���E�D `
AF����HH0z
A$���,E�G�G IGD���$�(��!0�D��,(D�`���E�A�G r
CAE��b��((�����sA�C�G A
AAB�J��(���WH I
A�T���`�� �l��rA�c
�LA0,����BE�C�N N
AAJKAA`����;E�P
KZ����$`�� ��}P�B�B �A(�D0��
(D BBBJL
(D BBBJL
(D BBBJ�*��h@�(���F�A�A �t
ABA}
ABHWAB��:��9(d�����O�A�G @
CAE��3��P�����@������F�E�B �A(�A0�G`�
0A(A BBBE����(�d��$$�`��.E�D�D WGAL�h��`�t��t����XH{
EK�����(�����3E�\
AP4����wE�D�D `
CAGg
CAE$���nE�G l
AGlAh�;��(<�H��(P�T���E�A�G R
HAH|����\L�O(��,���E�D�G��
AAA$����@E�F�G _GC������������'K[H,����F�B�B �B(�A0�A8�D@�
8D0A(B BBBJx�����L�x����<E�rH��$���F�D�B �E(�D0�A8�G@
8D0A(B BBBK�����t��MY�s4,�����F�J�D �D(�D0Y(I ABB,d���kM�I�D �GCB��@��1E�k��d��rA�u
J����	,�����A�A�G O(N0aAA4$���B�A�A �D
ABEqAB H����A�J�
AEl8��3�d��X�p���B�E�B �E(�A0�A8�G@
8D0A(B BBBKDHMP_HA@(�����A�C�D |
CAAp(��ZF�B�B �D(�A0�R
(A BBBA�
(L BBBAA
(A BBBES
(A FBBA����(���Qa�_
HH@�@��~B�E�B �D(�C0�DP'
0A(A BBBEL����P h��
A�G@�
AE�Vӹ�PT@�	<h<��F�A�A �N0�
 AABD�8M@_8A0H���F�B�E �B(�D0�D8�G`]
8A0A(B BBBK�o��(@L��h�A�C ��ABG���H ����(M0`(A ��?��(H`���F�E�E �B(�D0�A8�DP�
8D0A(B BBBDL���xH�4�_F�B�B �B(�A0�D8�G�X
8A0A(B BBBFt��)( 4�pi�D�G gAAC��Lx�1O�ZG�$h���E�F�J �AA8�t��B�J�D �C(�DP}
(A ABBF����E�V8���F�E�D �D(�D0o
(A ABBD8��E�V$T��sE�J O
AAH|���F�B�B �B(�D0�D8�FP}
8A0A(B BBBA8�\�jF�J�D �D(�D0{(I ABB��4��+E�A�N �
AACR
AAL����(d��IE�CL���9B�B�B �B(�A0�F8�G��
8A0A(B BBBA@���(H���F�B�B �A(�A0��
(A BBBAQ(C BBB00�E�D�D u
AADCFA dp�OE�G r
AA���Y���$E�ZH���VF�B�B �E(�D0�H8�GP�
8D0A(B BBBA8���8B�J�A �D(�D@
(A ABBA@����HV
E��H��(4pt����F�J�A �D(�D0w(F ABB��������L����bL�U0�h���BE�C�N N
AAJKAAH 	�����F�B�B �B(�D0�D8�DP�
8A0A(B BBBA4l	���F�J�D �D(�D0P(I ABB8�	`����F�D�D �A(�D@]
(A ABBJ����PX�	�����U�B�A �A(�D0n
(D ABBDD(D DBBH����H0�����̴�($d
���IE�Q�] IGA(�
8���iF�A�A �]AB���(�
h���0Hg����(�
h���ME�G����0E�j4����BE�r
IAT��qE�gpD����P���RH�I�����$�����NE�D�G {AA����+AAb�����ED@H����P$���JA�e
JYLD����B�B�A �A(�D0|
(D ABBAD
(D DBBAT�{��} �\���qf�U
EoA�����(�����ty�hG������A�n
A4
�����A�A�G `
AAE�
CAH��`��-(h
����B�C�A �y
ABFl�
@���~T�B�A �A(�G0n
(A ABBEb(D� A�B�B�U0����D
(F� A�B�B�IHP����B�B�B �B(�A0�A8�GP�
8A0A(B BBBI�����@d����B�B�B �A(�A0�DP�
0A(A BBBH����8�����B�B�A �A(�GPC
(A ABBJL
���(0(��jF�A�A �G0y
 AABD����E(TP	��UM�A�G uCAB��\��	��Y�B�A �C(�G0Z(A ABBJ����H0����u
(C� A�B�B�K��&��(H�0
���F�B�B �E(�D0�A8�Gp
8D0A(B BBBK�����T����L��@p���=F�B�B �A(�A0�G@�
0A(A BBBJ��j��P�l��E�S�p��]t�h���AVfP�V��( ,���vH A
GD
DV �F��xd ��3E�m�D��Qa�j��r��(�t��1H�����B�E�J �D(�A0�M
(G BBBHO(A EGBL���B�B�B �B(�A0�A8�G�
8A0A(B BBBF$zRx��������,�������0����qE�A�D C
JAHDGAH���x����0���qE�A�D C
JAHDGA��.��xT��HHf
RG��r��P �,��|E�D e
AA�����P0�t���F�A�A �D@~
 AABB�����x<����F�B�B �A(�A0�p
(A BBBA8���(D\8���F�B�B �A(�F0�D@`
0A(A BBBC,�� ��A�C
P������
A,��#���E�C
B�Z����U
G"��8%��64`%��]LH�%��MB�G�B �E(�D0�A8�G�
8A0A(B BBBA���(��(��0F�D�D �^AB(��(��YE�D�D0D
AAA�(��:H l
AH$�(��TB�D�B �B(�F0�D8�D@P
8C0A(B BBBD8p*���B�E�D �G(�J@I
(A ABBEL�h+���B�B�B �B(�E0�D8�J�
>
8A0A(B BBBEH��-��=B�B�B �B(�D0�D8�M��
8A0A(B BBBB4H�.���B�D�A �G�w
 AABG�$0��74�P0��uF�I�A �J�"
 AABHH��1��'B�B�B �E(�A0�A8�G`�
8D0A(B BBBH0ɴ�;H,h2��pF�B�E �B(�A0�A8�DPP8A0A(B BBB���(8�x3��LF�B�A �A(�D@

(A ABBB��|��6�x4���t4��p4��UE�O$�4��@Fyt�>��PPz��+AAb`l�4���B�D�B �E(�A0�E8�D@k
8C0A(B BBBBD
8C0A(B BBBA�%��(H��4��7B�D�B �B(�F0�D8�DPM
8A0A(B BBBA���(4D�5��bF�E�A �A(�K0@(D ABB|�5��:E�c
PA�6���$6��HE�I xA�T6��E�Q�X6��;`S<�A��$l6��4E�D�D aDA@�6��;`P����l�6��3Dj��˲�&�ݲ�(AAAH��6��gF�B�B �B(�A0�A8�DP@
8A0A(B BBBD����c�8���H 
I0$9��ID`9��EH w
A$`�9��6E�A�D eCA�x��(L��9��vK�E�K �D(�G0p
(A ABBDD(F ABBA����T��9��|K�E�L �D(�D0�u
(A BBBHA(F BBBA�����0D�9��|B�A�A �F``
 AABB0x<:��|B�A�A �FP`
 AABB��:��1(��:��NF�H�A �xDB@<��\�:���F�B�B �B(�A0�A8�J�K
8A0A(B BBBC��O�I�E�ְ� tC��E��
D{
M(��C��CE�A�G 3AA(r��U0�E���F�D�C �Dp�
 AABA�E�� �E��,Hcp�S��JL�E��ZH L
A8�2��|�E��*E�W
LA��E��7L�j����>��E��3T^����F�� F��DT_($ @F��oE�A�G@Z
AAA����" d pF��UE�G0B
AA�X��� � �F��UE�G0B
AAYq�� � �F��UE�L0}
AATYO�� !�F��UE�L0}
AA�Y-�� D!G��UE�L0}
AA�Y�� |!8G��UE�L0}
AA�Y��$�!`G��EE�A�D0xAAL�!�G��jF�B�E �H(�I0�C8�G��
8A0A(B BBBDls��LD"�I���B�E�I �B(�A0�A8�J�2
8A0A(B BBBA�"L���"�K��P�"L���F�B�E �D(�J0�G@x
0A(A BBBF]0A(A BBBP#DL���F�B�E �D(�J0�G@x
0A(A BBBF]0A(A BBB d#�L���E�D i
AA�Į�(�#�L��mD[
AL����(@�#M���B�E�B �D(�C0�GP�
0A(A BBBBX����(($���+AAbHD$PO���F�D�B �B(�D0�A8�G`�
8A0A(B BBBG�_��x0�$�Q��bE�C�G J
FAHsAA�$�Q���$�Q��@H r
A4%�Q��wF�C�D �B
ABFKHG�'��(HT%R���F�B�B �A(�A0�C
(A BBBJ[(A BBB8�%TR���F�B�D �A(�D@�
(A ABBH�����(H�%�S���F�B�E �E(�A0�D8�D`T
8A0A(B BBBGT{��U4P&4U��iF�B�A �C(�D0P(C ABBH���(X�&XU���F�D�A �A(�D0u
(D ABBBd
(D ABBAD(K ABB�<��P'�U��<H n
A,('�U���F�C�A �v
ABEX'LV���Z^D���-H�'�V���F�B�E �E(�A0�C8�DP
8A0A(B BBBAtݬ��'X�� �'X���E��
Dl
A$#1��(<4(�X���F�B�A �A(�D`h
(A ABBDt( Y��9L�l(�(DY���E�C�G t
AAK ���(8�(�Y���F�B�D �C(�GP�
(A ABBA)HZ��JE�r
AL,)xZ��B�F�B �B(�A0�A8�G�Z
8A0A(B BBBA|)�]��Q�)�]��	$�)�]���E�o
DL
LL�)Xa���O�H�E �E(�D0�D8�D@f8A0A(B BBBC������*�a��	$0*�a���E�D�G �AAX*Lb��	<l*Hb��kF�E�D �D(�D�H
(A ABBAL�*xb���B�B�B �B(�A0�A8�G�}
8A0A(B BBBAL�*�d�� B�B�B �B(�A0�A8�G��
8A0A(B BBBALL+�g�� B�B�B �B(�A0�A8�G��
8A0A(B BBBA�+hj��X�+�j��	L�+�j��`F�B�E �I(�D0�l
(E BBBG_
(A BBBB,�k��	H(,�k���F�B�B �B(�A0�A8�G��8A0A(B BBBt,@m��	8�,<m��wF�E�D �D(�G�Q
(A ABBA�,�m����,n��	L�,n��8F�E�B �I(�A0�p
(A BBBB]
(A BBBD<-�n��	HP-�n��F�B�B �B(�A0�A8�G��8A0A(B BBB�-�p��	8�-�p��wF�E�D �D(�G�Q
(A ABBA�-q���.�q��	L.�q��8F�E�B �I(�A0�p
(A BBBB]
(A BBBDd.�r��	Hx.|r��F�B�B �B(�A0�A8�G��8A0A(B BBB�.Pt��	8�.Lt��wF�E�D �D(�G�Q
(A ABBAL/�t��5B�H�F �I(�A0�H8�K��
8A0A(B BBBAd/�v��Kx/�v��@�/�v��	�/�v��@�/w��	H�/w��sF�B�B �B(�A0�A8�GP�
8A0A(B BBBC�"����(0,y��	$<0(y��.E�D�G [AAd00y��	$x0,y��?E�D�G lAA�0Dy��	8�0@y��wF�E�D �D(�G�Q
(A ABBA8�0�y��wF�E�D �D(�G�Q
(A ABBA(,1�y��yA�C�D@[
AAK�9��l1z��jR0R
A�1\z��bH0T
A�1�z��IH0{
A�1�z��mH0_
A�18{��eH0W
A�1�{��LH0~
A2�{��(2�{��<2�{��P2�{��"E�\p-3��(�2�{���2�{��)E�c�2�{��0�2�{���E�D�G m
AAAAA�2<|��38|��	 34|��	430|��	H3,|��e\3�|��[L�`
Dh�|3�|���Y�G �A$�3X}���P�G c
AEH��3~��0�3~��WA�A�G r
GAMDAA44~��4$4@~��[F�A�A �w
ABFOAB�)k��(p4T~��E�L$�4X~��)E�D�G IJA�4`~���4l~��E�O�4p~��E�L5t~��E�N5x~��3RT(45�~��:F�D�F �bABH`5�~��EF�B�B �B(�G0�A8�Gp�
8A0A(B BBBIC��P�5����K��
A�5H���<Q�X
GG�<�5h���nF�B�E �A(�G0�C
(A BBBA,4��PP6����SE�H`l6Ȃ��jF�B�B �A(�A0�
(C BBBCc
(A BBBA�
(A BBBA�4���P�6����	�6����H7�����F�B�B �B(�D0�A8�D`w
8A0A(B BBBJp&���(Hl7���jF�B�B �B(�A0�A8�Dp&
8A0A(B BBBFO��(@�7(����F�B�B �A(�D0�D@�
0A(A BBBAH��(H$8�����F�B�B �B(�A0�A8�GP�
8A0A(B BBBA+��($�8P���IE�F�D tDA8�8x����F�B�A �A(�DP�
(A ABBA�8����HQ(9����E�D�G@\
AAB�S��((@9T����E�D�G@�
AAD,;��GH�9����B�E�E �A(�D0��
(A BBBBX(D BBB`�9�����B�B�B �B(�A0�A8�DPM
8D0A(B BBBHH8A0A(B BBB�,���;HH:܋���F�B�D �E(�D0�
(A ABBH^(D ABB(�:����4F�H�D �ZABH�:�����F�E�D �F(�D0c
(G GBBJW
(A ABBK;���L ;t����F�B�B �A(�A0�X
(F BBBHm
(A BBBAHp;�F�B�B �E(�A0�D8�GP�
8A0A(B BBBHH�;����F�B�B �E(�H0�D8�F`�
8A0A(B BBBA +!��4<h���`F�H�A �Q
ABEmDBTT<����O�E�D �F(�D0b
(G� G�B�B�J`
(A ABBJ������<X���-E�Y
JD0�<h���JE�I�D \
HAIDDA=����=����E�L0=����HIHL=�����B�E�E �E(�D0�A8�G@�
8A0A(B BBBA(�=����E�D�J��
AAA�v��P,�=̑��^K�A�D �}ABH���\3���d>��KB�B�B �B(�A0�A8�D`:
8A0A(B BBBF�
8D0A(B BBBI�-���$�>����EO�A�K gAA$$���`�>��GB�B�B �B(�D0�D8�Dp�
8D0A(B BBBDD
8J0A(B BBBI8?����$L?ȕ��NE�A�D AAA�$���6(�?ܕ��oF�A�A �cAB5��^@�?����F�B�E �A(�A0�G`�
0A(A BBBF�����P( @�����E�A�M0C
AAH�
��`@$����K��
AH|@ȗ���F�B�B �B(�A0�A8�DP�
8D0A(B BBBGh3���P(�@X���1E�A�M��
AAG�����6(AX���FJ�A�G cAAI��HA|���	\Ax���$pA����>E�A�D qAA�&T��(�A����*H]�P��(�A�����K��
A�A@��� BL����E�G��
AAzRx��� ��(\Bؚ��=8pB����F�I�D �D(�D0X
(A ABBGp�BX���_F�I�B �A(�A0��
(D BBBK_
(D BBBOD
(A BBBEO
(D BBBG CD���R$4C����>E�D�D kDA$\C����>E�D�D kDA�C����"HR�Ș�(�CĜ��"HRĘ�((�CȜ��DM�D�G hAAA��D��aH0S
A $D@���oE�R0Q
AAHD����YH0K
AdDН��HI|D؝��E�R�Dܝ��aH0S
A �D0���oE�R0Q
AA�D|���.�D����.,E����RK�D�D �xABA���0E��DE��XEܞ��SlE(���[�Et���<<�E�����F�E�E �D(�D0�J
(A BBBA`�E ����F�B�E �E(�D0�D8�D@[
8D0D(B BBBGD
8D0A(B BBBA8F����LFȠ��`FԠ��tFР��$�F̠��;E�D�G gAA�F��9$�F���2E�D�G [AA0�F(����E�A�G d
FAHDCA0 G����QE�A�G o
FAEDCA0TG����QE�A�G o
FAEDCAH�Gܡ��F�B�E �E(�A0�A8�DP�
8A0A(B BBBIt:��9�G����pHg8"��(HТ��E�Q0HԢ��KtR�"͔�(\H����CpH4���g�H����n �H��\E�G B
AA�H(��� �H$���SE�G y
AA�H`��� I\���SE�G y
AA ,I����lE�G0I
AJ PI��\E�G B
AAtI ��� �I���SE�G y
AA�IX��� �IT���SE�G y
AA �I����NE�G {
AA$J�����n�mE�`�^B� 0J����\E�G B
AATJ���� hJ����SE�G y
AA�J���� �J�SE�G y
AA �J0���lE�G0I
AJ �J|���\E�G B
AAK����  K����SE�G y
AADK� XK��SE�G y
AA|K(���V �Kt���\E�G B
AA�K���� �K����SE�G y
AA�K�� L��SE�G y
AA $L ���lE�G0I
AJ HLl���\E�G B
AAlL���� �L����SE�G y
AA�L�� �Lܩ��SE�G y
AA �L����E�G C
AH M����lE�G J
AI$MЪ�� 8M̪��SE�G y
AA\M��� pM���SE�G y
AA �M@���lE�G0I
AJ �M����lE�G J
AI�Mث�� �Mԫ��SE�G y
AAN��� (N���SE�G y
AA LNH���\E�G A
ABpN���� �N����\E�G A
AB �N����\E�G ~
AE�N����	�N�	�N�	 O��THd
Dc4,O(���xB�E�D �A(�D0^(D ABB$+ٍ�(xO\���HS�)Ս��OP���QH0C
A�H����O����.�O����^\8*���(P����+(P����0HI@P�����H`�
AzRx�`5��(�P����	�P����,E�G ^A�P���,E�G ^A@�P���,F�B�B �D(�D0�DP�
0A(A BBBGd����@4Q��F�K�B �D(�C0�I@Y
0A(A BBBD�(g��0�Q�����B�A�D �J��
 AABA�8��L�Q0����B�B�E �J(�A0�A8�G��
8A0A(B BBBCH$R��F�B�B �E(�D0�D8�D`�
8A0A(B BBBG�A���L�R0���eF�B�E �L(�A0�A8�G��
8A0A(B BBBJ$zRx��������,(��US���Q(SQ��+AAbDS@���8XSl���,lSx����H�
BK
EF
JL
D�-��P�SĹ��@�Sй���B�B�B �A(�A0�D@x
0A(A BBBD0T,����F�A�A �D0r
 AABA8<T�����F�B�A �A(�D@x
(A ABBA8xT���F�D�A ��
ABCa
CEG,�T����?K�D�D �gABA����T����L�Tܻ��:H l
AU���E�L0U����H t
DHLUȼ���F�B�B �B(�A0�A8�D`E
8A0A(B BBBG@�U\���F�B�B �D(�D0�GP}
0A(A BBBB �U8���OE�G |
AAVd���?H q
AV����Xt4V����B�B�B �B(�A0�A8�DPy
8C0A(B BBBED
8F0A(B BBBEL8F0A(B BBB0�V(����A�G�`��
Ek
E`�V���8�V����B�B�A �A(�D@|
(A ABBDH0WD��B�B�B �B(�A0�A8�Dp�
8A0A(B BBBA�#x��(8�W���]�K�D �K
ABFyFBG���@�Wh���F�B�B �A(�A0�D@x
0A(A BBBHLX���F�E�B �A(�A0��
(D BBBEm
(D BBBA@`X���F�I�E �D(�A0�D@�
0A(A BBBFL�X����F�E�B �B(�D0�A8�D��
8A0A(B BBBI\V(��(@Y,��0F�B�E �A(�A0�D@�
0A(A BBBA@LY��F�B�B �D(�A0�D@�
0A(A BBBA�Y���#(�Y��.F�D�G �OGB0�Y��qF�F�D �D`L
 AABA$Z`��>E�T
GO
AMH,Zx��<F�E�B �B(�A0�A8�G`]
8A0A(B BBBA4xZl��^F�A�A �y
ABDMAD4�Z���^F�A�A �y
ABDMADL�Z���B�B�E �B(�A0�D8�D��
8A0A(B BBBI8[|��8L[x��KB�F�D �D(�D@�
(A ABBH�[����[���6�[����[����[���(�[���E�C�G0�
AAB�8,��P(,\���hE�D�G0g
AAG�8<��(@l\����F�I�E �A(�D0�Gpm
0A(A BBBA(�\��)F�D�C �TAB\�\���F�E�E �E(�H0�D8�D`�
8A0A(B BBBKD8J0A(B BBB$<]���9E�D�J WIAd]���x]��� E�V�]���4�]����F�A�D �W
ABKODB4S܁�P<�] ��_E�A�D Q
DAHO
GDNDEA4^@��!H^\��\^h��0p^t��CE�I�G O
AAJDIA�^����^���0�^���CE�I�G O
AAJDIA_���0_���CE�I�G O
AAJDIAH_���\_���t_���(L�_����F�B�B �B(�A0�A8�D��
8A0A(B BBBK�_���/$�_���QE�D�D wGA(`���\E�D�D@G
AAA8D` ���F�J�D �A(�DP�
(A ABBA(�`����F�A�D �zAB$�`H��IE�A�G yAA�`p��ZH L
A�`���E�La���	 a���	(4a����E�A�L0~
AAAH`a$���F�B�B �E(�D0�D8�D��
8A0A(B BBBIL�a����F�F�B �E(�A0�A8�G��
8A0A(B BBBF~�(`bd�:F�B�E �B(�A0�A8�J��
8A0A(B BBBF��N�E�E�R�tb@� �bL�SE�D C
AA�b��	H�b���F�B�B �E(�A0�A8�D@r
8D0A(B BBBD�a(}�( c$�,4c �M�P�A ��
ABE(dc�bM�A�D LAAA���H�|�(L�c@��P�B�B �B(�D0�A8�D@�8A0A(B BBBA�������b�|�PHd��!F�B�B �B(�D0�D8�G`�
8A0A(B BBBATd�|�+AAbLpd���F�B�B �B(�A0�A8�T�4
8A0A(B BBBHdR?|�}t�d ���R�E�B �E(�A0�A8�D`e8C0A(B BBBK������X`������V
8E0A(B BBBDLe����HPde����HS\|e����O�E�K �D(�G0h
(C ABBFD
(F ABBAO(F ABBA����d�e�����O�E�L �D(�D0�n
(C BBBAA
(F BBBCQ(A BBBA�����Df ���GNU�D�C �<-�2�;�F�K�_� h�@q��|���������A��6���
8x6D�.�ЛP�������c��pV�Y�7���2�-��7�7�!��=`�< �<��������0���������n�����=�=��=�=�=�= 	>(�_�_ ���������`	p	�	�_�<`�<�����������������pR	E{V{I$i����g{���������}w{���{�{�{�{�{ �{(�{0y8y@!yH�{P�{X�{`|h|p-|q>|rP|xi|��y �<��<��������0���������Q=������������Ȃтق�� �(1���<`�<��������p���������y	
������������������"�����	1�-�4�G�Y� i�(x�0��8��@��H��P҃X�h��i�j)�k5�lO�`�	��	S�`��������������������
���%�,�5�9�=�A�E�I�M�Q�U�Y�]�a�e�i�m�q�u�y�}���
�
��
д �N�H`>"��΀[ip���`Y@U�XPU�^Y`X`UpU�U�U@] ^�U�\`\�W�^�U�]�[�_�``[�^�W@VV��� �p�@�@	
�
�
 )
�
�.
g<k<�����������������8
7
�<
Q�U�Y�]�a�e�i�m�q�u�y�}�9`"�{&�`'��<�`>�`��`�DU��`��`��`��`��`�Va�[��`��`��`��`��`��`��`��`��`��`�Ba��`�a�a�ga�a�a�a�a�%a�,a�3a�:a�Aa�Ha�Na�Ua�Za�`a�fa�ma�ta�{a��a��a��a��a��a��a��a��a��a��a��a��a�����a��a��a��a��a��a��a��a��a�b�b�b�b�b�#b�)b�0b�7b�>b�Db�Ib�Pb�Wb�]b�bb�fb�mb�tb�{b��b��b��b��b��b��b��b��b��b��b��b��bR�bS�b`�ba�bx�b�Ia�Oa��b��b��b��b�c�	c�c�c�c�c�#c�*c�-c�0c�3c�;c�>c�Bc�Hc�Lc�Tc�Xc�\c�`c�fc�lc�qc�wc�}c��c��b��c��c��c��c��c��c��c��c��c��c��c��c��c��c��c��c��c��c��c��c��c��c �c d	 	d d
 d d d  d &d ,d 2d 8d >d Dd Jd  Qd! Xd" ]d& dd0 kd2 qd3 wd9 ~d: �d> �dD �d� �d!�d!�d!�d"!�d5!�d�!�d�!�d�!�d�!�d�!�d�!�d�!�d�!�d�!�d�!�d�!�d"@m"g"��"�d"�d"�d	"e"e"	e"
e"e"e" e"%e"�e "o�'"�e("+e)"/e*"3e+"7e4">e<"BeE"GeH"K�`"Mea"tpd"�de"Xe�"Se�"We�"\e�"ae�"fe�"le�"se�"xe�"}e#�e	#�e
#�e#�e�'�e�'�e�%�e`&�ec&�ee&�ef&Q�U�Y�]�a�e�i�m�q�u�y�}�5�9�=�A�E�I�M��g�g7v�g�g�g�g�g�g�g�g5�9�=�A�E�I�M�Q�U�Y�]�a�e�i�m�q�u�y�}��8�P�E�8���:�8������H������p��H������p��7�7�@���������'  #���_�_ �p/P20/�-0+@X@UUW�[�[�[�[yw�ߋ��s�`� ��H�s�V�f�l�-��s���G�w��f{�P�����d�;M���7�.�.�."\@�б�P��@@�����������p���������p����������@�����@hp�������P@����P0� �P���@� P���������@�@
�
��@� `@
�
@�L��U��E��X0�R�HP�NP�M�DМT��_�q�h���K�;�F�2�����n.P
p0��@�@�P����`�.`�`�%�0�0p%@%�#�##�p@q`&�(�%�(�4�(0(`0`40�2�/�3 3�0%o`//�.@..�42&1�-X�S�:5�5pS�9�8�7�QQ0P0KPJ`R@N�7�>�=@C�ML@SP6 ?�5L�fPq`f�s�o o�nn@sr@h]�v�zpv }�|�zz0|�{pxVa�)��
d��<�<���o`Ȁ�X
JH=��$��8v	���o���oȭ���o�o����o�8	=�� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p������������������� �0�@�P�`�p���������������� �0�@�P�`�p���������������� �0�@�P�`�p���������������� �0�@�P�`�p���������������� �0�@�P�`�p���������������� �0�@�P�`�p���������������� �0�@�P�`�p���������������� �0�@�P�`�p���������������� �0�@�P�`�p���������������� �0�@�P�`�p���������������� �0�@�P�`�p�������������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p��������		 	0	@	P	`	p	�	�	�	�	�	�	�	�	

 
0
@
P
`
p
�
�
�
�
�
�
�
�
 0@P`p�������� 0@P`p��������

 
0
@
P
`
p
�
�
�
�
�
�
�
�
 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p��������    0 @ P ` p � � � � � � � � !! !0!@!P!`!p!�!�!�!�!�!�!�!�!"" "0"@"P"`"p"�"�"�"�"�"�"�"�"## #0#@#P#`#p#�#�#�#�#�#�#�#�#$$ $0$@$P$`$p$�$�$�$�$�$�$�$�$%% %0%@%P%`%p%�%�%�%�%�%�%�%�%&& &0&@&P&`&p&�&�&�&�&�&�&�&�&'' '0'@'P'`'p'�'�'�'�'�'�'�'�'(( (0(@(P(`(p(�(�(�(�(�(�(�(�()) )0)@)P)`)p)�)�)�)�)�)�)�)�)** *0*@*P*`*p*�*�*�*�*�*�*�*�*++ +0+@+P+`+p+�+�+�+�+�+�+�+�+,, ,0,@,P,`,p,�,�,�,�,�,�,�,�,-- -0-@-P-`-p-�-�-�-�-�-�-�-�-.. .0.@.P.`.p.�.�.�.�.�.�.�.�.// /0/@/P/`/p/�/�/�/�/�/�/�/�/00 000@0P0`0p0�0�0�0�0�0�0�0�011 101@1P1`1p1�1�1�1�1�1�1�1�122 202@2P2`2p2�2�2�2�2�2�2�2�233 303@3P3`3p3�3�3�3�3�3�3�3�344 404@4P4`4p4�4�4�4�4�4�4�4�455 505@5P5`5p5�5�5�5�5�5�5�5�566 606@6P6`6p6�6�6�6�6�6�6�6�677 707@7P7`7p7�7�7�7�7�7�7�7�788 808@8P8`8p8�8�8�8�8�8�8�8�899 909@9P9`9p9�9�9�9�9�9�9�9�9:: :0:@:P:`:p:�:�:�:�:�:�:�:�:;; ;0;@;P;`;p;�;�;�;�;�;�;�;�;<< <0<@<P<`<p<�<�<�<�<�<�<�<�<== =0=@=P=`=p=�=�=�=�=�=�=�=�=>> >0>@>P>`>p>�>�>�>�>�>�>�>�>?? ?0?@?P?`?p?�?�?�?�?�?�?�?�?@@ @0@@@P@`@p@�@�@�@�@�@�@�@�@AA A0A@APA`ApA�A�A�A�A�A�A�A�ABB B0B@BPB`BpB�B�B�B�B�B�B�B�BCC C0C@CPC`CpC�C�C�C�C�C�C�C�CDD D0D@DPD`DpD�D�D�D�D�D�D�D�DEE E0E@EPE`EpE�E�E�E�E�E�E�E�EFF F0F@FPF`FpF�F�F�F�F�F�F�F�FGG G0G@GPG`GpG�G�G�G�G�G�G�G�GHH H0H@HPH`HpH�H�H�H�H�H�H�H�HII I0I@IPI`IpI�I�I�I�I�I�I�I�IJJ J0J@JPJ`JpJ�J�J�J�J�J�J�J�JKK K0K@KPK`KpK�K�K�K�K�K�K�K�KLL L0L@LPL`LpL�L�L�L�L�L�L�L�LMM M0M@MPM`MpM�M�M�M�M�M�M�M�MNN N0N@NPN`NpN�N�N�N�N�N�N�N�NOO O0O@OPO`OpO�O�O�O�O�O�O�O�OPP P0P@PPP`PpP�P�P�P�P�P�P�P�PQQ Q0Q@QPQ`QpQ�Q�Q�Q�Q�Q�Q�Q�QRR R0R@RPR`RpR�R�R�R�R�R�R�R�RSS S0S@SPS`SpS�S�S�S�S�S�S�S�STT T0T@TPT`TpT�T�T�T�T�T�T�T�TUU U0U@UPU`UpU�U�U�U�U�U�U�U�UVV V0V@VPV`VpV�V�V�V�V�V�V�V�VWW W0W@WPW`WpW�W�W�W�W�W�W�W�WXX X0X@XPX`XpX�X�X�X�X�X�X�X�XYY Y0Y@YPY`YpY�Y�Y�Y�Y�Y�Y�Y�YZZ Z0Z@ZPZ`ZpZ�Z�Z�Z�Z�Z�Z�Z�Z[[ [0[@[P[`[p[�[�[�[�[�[�[�[�[\\ \0\@\P\`\p\�\�\�\�\�\�\�\�\]] ]0]@]P]`]p]�]�]�]�]�]�]�]�]^^ ^0^@^P^`^p^�^�^�^�^�^�^�^�^__ _0_@_P_`_p_�_�_�_�_�_�_�_�_`` `0`@`P```p`�`�`�`�`�`�`�`�`aa a0a@aPa`apa�a�a�a�a�a�a�a�abb b0b@bPb`bpb�b�b�b�b�b�b�b�bcc c0c��LE I�H�JD@L�F������������������=�=�` ȆP6cHц؆X܆�0���8$i(�@������������������ ��~y�yA����v�!�D�.����������������������n.Rp�������������� �����@�@� ����x<�@��������@���P�s1����`�n5`	
�
�
�
�
�7�
�
�
�+
3
@)
�'
�$
$
�"
w4
04
`5
@4
`4
p4
�4
�4
�4
p5
5
 5
05
@5
P5
g<���u�g�g7v�g�g�g4v@v7�ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_���������������������������������������������>��456789:;<=�������	

����?� !"#$%&'()*+,-./0123�������������������������������������������������������������������������������������������������������������������������������������ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/�������������������������������������������>���?456789:;<=�������	

������ !"#$%&'()*+,-./0123�������������������������������������������������������������������������������������������������������������������������������������Q@`=���W������F�@�P���/�0�w�ߋ��s�`����"���������<����2.3.21.1 (d492236fa0)�rsPt�t@u�x y��P~`����p������h����������`���0�����������p��������c=pc=�c=����P�������@�����������������GCC: (GNU) 8.5.0 20210514 (Red Hat 8.5.0-20)GA$3a1��q�GA$3p1113��L�GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: annobinGA$running gcc 8.5.0 20210514GA*GA*GA!
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GOW*�GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA$3p1113 Nb�GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: annobinGA$running gcc 8.5.0 20210514GA*GA*GA!
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA*GOW*� N,�GA*GOW*P�b�
GA*FORTIFY���GA*��BCGA*GA!GA*GOW*�GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA+GLIBCXX_ASSERTIONS���
GA*FORTIFY NL�GA+GLIBCXX_ASSERTIONSGA*��BCDN+hBBhB]��yj��hB�hB�hB�hBD-EQD�hE�BE�E2�BE��F�PEs��(�FR~Hz�F�����~H�I��H���x.P�<IZ�Jv I��P� ��8���J�8L��J�8L+�LQ@LFj�L�N��L�� N�O�hBhB!j�Cj�ihB�hB�hB�hB� N�N��d=G�NvO�O�9P�hB�hB�j���5hBOhBmhB�hB�O��O�j�P���O79PW@Pq!]�hB�hB����2�	hB;	hBa	hB�	hB�	@P�	jP�	@P*�	jP$
mRK
��(m
��{
mR�
�R�
pR+�
��(�
��
�R0�RQ�RSe�R�KT�SK�PT��KTV-
�(M��[V�X�V���X�XY�XY&
�ZN
�Z{
�[�
�[�
]�
]!]<0]R~nlhB�hB�2�����hBhB&hBAhB`0]yd])�0]4�d]�B^�p]��B^�^P^�+�^O�bq_���b�~n�2�a�P��@��n!�rAhBahB�������hB�hBhB@hBe�n��n��n�Oo%Oo^�o��o��o	�oB�py�p��q��q�rM��v�r�p}�hB�hB�����&hBEhBhhB�hB��r� s��r� s:YsXYs��t��t�yyyy5{b{��{��{��{��{!p}Fp}]��xhB�hB������hBhB8hBThBtp}�=~�=~�����P
���<��[��{@��@����������#��M��u���C��C������B�m�������(�p�����G�hB-hBM�n���hB�hB�hB�hB��;6�_6��ԋ�@����(���ԋ�'� A�(8 ��F '�m h�� h�� ��� ��� �$!�K!�p!��!W��!W��!��"��/"�V"��d"��"O��"O��"֑#֑2#�R#i�Ql#��#��#��#��$��(8$��F$��m$���$���$���$��	%��*%��V%t��%t��%ܝ�%ܝ�%-�&-�K&��z&���&a��&���&a�'!�*'p�8'!�X'��v'���'G��'P��'R��'hB
(hB,(��L(��p(hB�(hB�(hB�(hB�(P�)��D)��i)R��)`��)���)hB�)hB�)��*��<*hB[*hB~*hB�*hB�*`��*v��*v�+S�6+S�Y+�z+��+���+���+Q�,Q�,,5�J,��X,5��,���,@�y�,���,�
-�2-��X-��y-G��-G��-ѫ�-ѫ
.�2.�X.��|.���.���.���.��(/��N/��r/��a�/p��/���/���/��0��I0��v0��0C��0��0��1��91��a1���1Խ�1Խ�1�2�.2��W2���2F��2F��2:��2T�P3P� 30�.3:�X3M��3M��3`��3`��3�"4�O4��z4��P�4��$�4�%�4���4��4hB5hB$5��C5��f5hB�5hB�5hB�5hB�5��6�N6��aw6��6O��6O��6��6�7K�?7K�t7���7���7`��7��P�70�8`�48��[8D�P|8��8���8i��8i��8��9��-9��J9��j9��9��9��9���9��:hB3:hBX:��~:���:hB�:hB�:hB;hB>;��e;c��;����;���;���;��+<��<c�H<��t<���<���<��	�<��a�<��<���<��=*�B=*�j=���=���=���=��>��.> �UL>0�Z>��>���>u�U�>���>���>\�?hB3?hBZ?���?���?hB�?hB@hB$@hBL@��u@���@����@���@��A��/A��QA$�qA��d�Ap��A����A���A���A$��A��B��@BJ�hBJ��B���B���B�� C��GC��lC��zCS�(�C���C���C{�("D@�"0D��`D:��D��(�D�!�D:��D\�"E��!0E��(XE`�wE��EhB�EhB�E��F��8FhB_FhB�FhB�FhB�F`�G8�@G`��gG8��G^��G@��G^�Hw�GH`�hH���H��H��+<(��Hw�I�6I���ZI��I���I ���I��JS�AJ��cgJ�P�J�&�JS��J���J`��K��7K�\Kn�(|K��K��K)��K)��K
�&L��xHL��VL
��L���L���L��M��*M��RM���M��M��M'�N��N�x2N'�`N���N��P�N���N���N��!O��PKO�!YO���O)��O)��O �P&�(+P�� 9P �mP��PN�(�P@�%�P�Q��<Q��rQ��Q��Q���Q�(R��)Ra�IR�a\Ra��R���R���R� S�� .Sv�PVS��S�S��Q�S���S@� �S��!�S`�T��TJT�xT�(�T��!�T��T��T�U}3U��@U?�(UU��
cU}�U��U��U�
V�6V�]Vg�(V���V��V\�V\W	3W	aW
�W��(�W`��W
�W}X��PFX@� TX}�X��X��X�X�r
Y �Y)Y�(GY��UYvY�Y�Y��Y/�(�Y��
�Y�#ZVZ�Z!�Z!�Zz[zI[�v[��[��[�
\:\o\B�\W��\B�\o,]oa]R�]\��]R�]^S^n�^a�(�^�&�^n�^�_�A_�Ih_hB�_hB�_���_��`hBA`hBp`hB�`hB�`��`0$a��Fa0za��a0q�a0q�a�-ba_b���ba�b"�bp�c��(/c �"=c"tco�c0?�cod1/dp�Pd1�d|�d@<�d|e1e��#?eqe��e`�#�e��(�e�f�Sf��(�f�/�f��f� �f� +g!Wg!�g)!�g)!�g_"h�P(h��6h_"ch�%�hQ�(�h���h�%�hv''i�%�Liy�(xi��%�iv'�im+�i�'�j��P�T@� *j�&8jm+fjz,�jp+
�j��P�j0��jz,k�,Bk�,fbk�,�k�/�k�,��kA�Pl��&l� "l�/Ql�0~l�0�lR4�l��Pm`�#mR4Em�4om�4�m7�m�4e�m��Pn�� !n7Rn�7�n1�(�n �"�n�7�n�7o Iv=oY�(io�$wo�7�o�9�o�9-�o���pp�'p�9Zp�?�p!�h�p�"�p`�#�p`�'�p�?qa@;q�?�Zqa@�q2A�q��x�S��!�q2ArsAEr�(qr@�$rsA�r�B�r)�xs�!s�BIs�C|s��x�s��&�s�C�sAEt��3t��AtAEnt:F�t���tp��t:Fu]F5u]Fnu�G�u�G�u�Gv��(Pv@�-^v�G�v�G�v�G�v�Gw�GTw$H�w��(�w�'�w$HxI=x�(sx��.�xI�x�I�x�Iy�IEy�IgyL��yhB�yhB�y��z�7zhBazhB�zhB�zhB�z�I{�IG{�Il{�I�{ZJ�{JZ|ZJE|Ky|`J��|K�|&L�| K} ~hC}&Lx}�L�}0L��}����}�L%~	MU~�L9x~	M�~TM�~MDTMGmNw`M
���(�`#�mN��NA�pNTj�Xg���Nπ�O��N0��z�W�P����!�(���"ā�O���Q.��O�U��Q��>R���Q�݂>R��R?�@RAb�Џ���I�(�� #���R�WU��R�5�`U7[�WU���VÄ�V	��WM��V��q�xÅ�
/<�
х�W�XI��WGw�X��wY�wY+�UZi��Y���UZ߇�Z"�`ZpX��Z���[���Z��P�
"� 
&0��[h�w\���[�lj9�(���)�w\9��]j��\r���}���a�(� $���]+��cY�^�z���(���
!���c��c��cW��c���c͌�d	���(@�/N��d��*e*e�Qe�QeF�ket�ke��Of���>��Of7��gn��g��kҏ�(���$�kA�Akt�Ak��qΐ�`���$�q3�7qa�`�<`�@H��7qˑJs��Js'�:tR�:t��u��u��u��u<��ud�a�(���
���u��x���(��
�xO��x~�x����x˔�z���P��&��4��zj�i{��i{ɕ�|�p{.��(2��@��|z�}��}ߖ{}
�{}L�~��)�(Ǘ`3՗~���9���X���{�Q�(���
$����������E���q�y�(��P
����י�����(0� ">���i�Ώ��Ώ��������H�@����]������
��H���J��P���O�(8�`!F�J��������͛�͛@�Y�l�Л���Y�Ý������-�S�_�S���	�ɞ	��=�7�w�(h�`
)v�=���L����P� 
( �P�7���R�hBm�hB������РhB�hB�hB.�hBN�P�n�e����P=��e�ɡΣ�Σ���9���a�����������ˢhB�hB��@���m�hB��hB��hB�hB���,��G���HU��w����������(Ĥ�Ҥ���ۦ2�`�<�E��Pn��"|�ۦ����ޥ�����,���E�g�(e��s�����������ݦ������#�ɭK�hBs�hB����̧���hB)�hBY�hB��hB����ШϪ����@�����P/�=�Ϫ_�<��Ъl���(�����<�ީެ��<��P0��>�ެa�������ɭЪW�(�0��Э��B�hBf�hB��������hB�hB8�hB]�hB��Э������Э�Ϭ�PM����	��+���Q@��^���z������P�������ϭ����[��P��*��N�A�p�A�����Ʈ�����*�o�(U��$c� �������hB˯hB�����I�hBq�hB��hB°hB� �
���-� ��@���xZ� h����������jñ��g�� �G�g�D���t�(���#����в���7x�@<���<�U�`�hB��hB���ճ��hB*�hBV�hB{�hB����Ĵ�����������5����H��xb��p�����o������˵o��ü	�p�S�üE��n����(�ж'(��@#�(�,�U�N�Oxj���hx�`�������hB�hB��1��^�hB��hB��hB׸hB�`�(��N�`�g���������Q¹��F���f#��xA��O�F�o�����P���?(���ź���&����V�g(-��;�&�]�y�}�0�I���P��@��y������(=�� K�����������ܼ�������x3�A���_���{����������½��?н�0�����:���O��Pl�`z�����������þ�(ھx������.���d�����Pǿ�'տ��
���=�_(k��&y������������9��hB'�hBO��x����hB�hB��hB�hBG���i�������W���(��� ������?�&��(P�` #^�?���9����(��� ��@������hB6�hB^����O��hB��hB�hB-�hBV�@�������(��@!#������6�'(R�p!`�����q���hB��hB��O�wF�hBn�hB��hB��hB�����q�.�O(J��!X���x�����hB��hB��w��>�hBf�hB��hB��hB�������B�w(�� "#l����������(R�P"���������hB?�hBj�������hB��hB �hBH�hBt�����?�����O���(���#��?� ���A�@��U���|������������hB�hB%��K��u�hB��hB��hB��hB��4���[���u�����_���������P��0*�P*�_�D�\�r�`����?����(!��\���M�2�`��X��3t�)��M�������P������+�|�U���z��*p�* ��|����������D�8��	P_�p*m�D���`���`���9��
PB�*!P�9�v�������������_
(��)���K�v�w��
P���)��v���b���
x-�p);�b�c����Ox��P)����������E� )#S���y����������(���������1���P��(j��(x��������������� ���I���p��(���(�������������F�4�F�Z���~�������������0��V���z�
���P(�����������
("�0(0���^�g����
(��(��g��������A�z�i��
P���'��z������-P!��'!/��`�����}P���'"�������+��`���������$���$�%�T�Q�T������������3���b�������$���$�"�T�O�T����������(��hB�hB=��e�+��hB��hB��hB�hB/��Z����������������4���c� ��������P������hH��H��H�+<�/�P�-���T�P��n�����l���l�������D���p��������������F�m���������
��4�	PY��0g����u���0 ��u�/�b�3��YP��@0$��3�X1��(]�0$k�X��������v'��N�v��������W?��(e��/s�W�����(�`/(��P�+��+��+�����0-��.*��X����������>B�>t�������)	
�)	3��Z�]9|��0�����j
���(��0�j
>��j����J��J���(��}Q��/!_����������[�[3��]�;����.�����(���P��.&%� /!3�0T��$y�hB��hB�+��hBH�hBu�hB��hB�0��G'�0J�Gv�������+(�3�Q�5��5����SP���2	��;��k����/�/��R%��(M��2![�R������(�P2����7��j�������(�02 ��N��z�(��2����9 �CP/��1=�9 n�� ���1"��� �;"	�;"4��#]��9���2���#���#��#�o$A��Ph��2v�o$���$��$��l2"hBIhBt���hB�hB*hBRhB~�$��&��&�(.�(i~)�(�5,�~)*A*q5*�5*�c*c*5�*g�*��*��*�x,D(B�4Px,��.�lP��4!��.V/DV/~l2��(<�4�p2kj1hBWhB����hBhB3hBZhB�p2�3�p2�	3F	[3z	 3;�	X��	[3�	�4#
`3LG
�4|
c5�
�4��
�(@=&c5M�5�p57��5��=�5'%`<$4�=d>�>�)>�)>%
�>V
�>�
�>�
�>�
�>�>N)?�(�=%�)?��?4(I�<#X�?��?��?�q@&q@Z/A�p`*�/A��A0Aa>\l�A��A��A
�AF�AqB�B��B�B2�B`�<`~Q=H��B��B��BLDImrLD�E�PD��E�GA�Gs/I�{�/I�J8�g�J�
L��6��;�
L%yLW�(��;%�yL��L��L'N?'Ny�O��P� <+��O �OK�OwP�P�PP7:Pe:P�Q�Q�+Q5+Qg-R�-R��T�0R��TEbVoE(��;�bV��V�pVE�VH%Wr%W�XW�XW�W<�Wh�W��W��Y��Yr_@�Y�]ma��<�r_�j`��6 @;!' j`Z �`� �`� Ua� (!p;!UaA!�ak!�a�!b�!b"�cK",�";,�"�c�"�c�"�c%#�cX#�c�#�c�#�c�#d$dT$�d�$�d�$e�$e-%%ed%%e�%�e�%�e&Wh4&Whn&)i�&�(�&�:+�&)i"'�iZ'�(�'�:+�'�i�'.j(.j5(kjf(pj}(sn�(hB�(hB�(�()hB5)hBX)hBt)hB�)pj�)�j�)PQ=�)�j*Qm7*QmY*�my*�m�*�m�*�m�*sn+�n7+�n[+hB+hB�+�+�+hB%,hBQ,hBv,hB�,�n�,�n�,�nC-`�<�(- �<0E-�n\-�|w-hB�-hB�-�-4�-hB.hB7.hBS.hBs.�n�.�n�.�n�.�n�.o/�n72/oV/ppx/ oP�/pp�/�p�/pp0�p70�rZ0�pEp0�r3�0@tv���s��0�r�0s�0(!1@@/1s\1is�1 sI�1is�1�s�1ps@�1D(2`@2�s<2>tW2>tw2�t�2�t�2�u�2pQ=�2�u(3vP3vp3�v�3�v�3�v�3�v�3�w4�w@4Axb4�@p4l(�4Ax�4�x�4�P�4�@�4�x5|:5�PX5@f5 @t5|�5�|�5}�5��5hB6hB(64K6<r6hB�6hB�6hB�6hB�6}(7�~R7}�o7PE}7 E$�7�~�7�~�7�~�7�~+8&Y8&z8&�8��80��8�9��E9��c94(�9�C�9���9���9��:G�9:G�\:�}:��:���:��;��z";\PN;�D$\;���;:��;:��;U�<@�7<`��S<�x~<�D#�<U��<D��<$(=PD=D�8=‰\=P�rs=‰�=B��=Љr�=B�>��:>L([>�Di>���>��>��>W��>W�$?��K?��}?��?��?�@t(:@ D#H@�s@&��@�(�@D�@&��@M�AM�CA��lA�(�A�C�A���AǓ�A�(B�CBǓAB��kB���B"��B"��B�C("C�C0C�RC�rC��Cc��ChB�ChBD<+DXDhB�DhB�DhB�DhB�D�%EU�NE�ejEU��E��E`���E<(
F@KF�JFU�zF �5�FU��FΜ�F`�nGΜ?G�iGМ"�G��G��G���GdPH�K H�OHB�|H�R�;��;��;�+�H K�HB��H�
IP��,I�XIz��I���I�9�I`K_�0K�Iz��Ic�&Jp�GJ �lJhB�JhB�J�J�KhB;KhBhKhB�KhB�Kp��K��Lp�B@L��pLݯ�L���Lݯ�LűM��/M���OMб	mMű�Mٱ�Mٱ�M�N�>N�iNϲ�N���N�N-OOϲMOf�zOв��Op�O�O��7�Of�
P��:P��WP��xP����P-9�P`O �P��Q��4Q��fQ��Q��Q�O#�Q�Rͼ9R��dRͼ�R��Rм�Rfxo7�O�R�'S��US���Sz��S O#�Sz��S��TO)T��XT���T���Tu��Tu�Ur�'Ur�TU �U�N�U��U ��U<��UhBVhB"V�CVhVhB�VhB�VhB�VhB�V �W��>W �mZW���W���W��C�W���We��We�!X��BX�(]X@QkX���X���Xp�C�X��v�X>�X Q�X��Yf�3Yf�NY��gYUC{Y���Y���Y���Y�G�YQZ��"Z��AZ���SZ��uZ���Z���Z��Z�6[�P[�2[)�P[)�y[<��[@��[1��[hB�[hB\'\�J\hBh\hB�\hB�\hB�\@��\��"]@�cC]��p]���]��&�]���];�^��[^4^;�T^K�r^@��^+$�^K��^���^���^��_��5_h�Q_ODg_h��_1��_@��_���_hB�_hB`�4`� W`hBu`hB�`hB�`hB�`@��`��a@��&a@��7a�`Qa0S_a���a8��a�8�a��a8�b��4b
 3Lb��jbN��b��^�b= (�bS�bN��b���b��cG�5ce (NcS\cG�xc|��c|��c���c���c��d��2d��Ld� (`d�R
nd��d���dhB�dhB�d� �dk!ehB=ehB`ehB|ehB�e��e���e��f�  7f��Qf��if��-tf���f���f����f��g��Ag��*`g���gk��gk��g$��g$�h�.h� �1e VNh�qh���h���h���h[!i�ii�=ihB\ihBik!�i�"�ihB�ihBjhB5jhBYj��jb��j�b�jb�k$�9kp��ckk!�k$��k7��k0�l�!Y-l�W;l7�gl��l@���l�!%�l��l��%m �w@mX0Lm"?om�W}m���m��m��~n�:n��an���n���n���n��	o��4o��]o���og��oC"(R�`W"�og�p��?pk"(ep�Wsp���p���p��q3�3q�"(]q@Wkq3��qi��qp��q1	rhBrhB?r�"`r�$�rhB�rhB�rhB�rhB7fp�Qfa�ifp��sa�5s��asp�/�s�"�s���s��t��T4t��[t���t���t�"Po7_�t���t��u��
u#;>u@^Lu��wu���u����uY#;�u`^�u��v��Gv��%fv���v��v���v�^�v0�#�v�w��3w�#PLw@_Zw��}wu��w�#P�w _�wu��wE�xE�'x��Fx��nx/��x����x4$(�x�^�x/�yS	.y`	�Ky�^Yy\$P|y�^�yS	�y1	�y@	�y	zhB?zhBdz�$�zh%�zhB�zhB{hB${hBJ{@	i{�	�{@	k�{�	�{�	�	�	2�{�	�{/	|�	?-|/	b|�	�|0	o�|�	�|�	}�	�:}�	l}<	�}�	��}<	�}�	~@	O>~@		xX~�$(�~@d!�~�	�~@		�~�	��$7@		`�
	��$��
	��	��
	�(��	O�h	t��	����$(�� d��h	�V	�p	�-�V	V��	}�`	����	��	�	�%(#�d1�	W�U	{���<`��@�<H��U	ւk	�k	(��	N��	{��	���	σ�	��@%(��c&��	U�	��	��z?	��hB؄hB��h%�,*D�hBf�hB��hB��hB΅	�	�	�&�	I��	j�	�~��	���	؆�	.��h%��	A��	b��	���	��	���~%2҇�	��	���	���	*�N	L��%6i�m"w�N	���	�P	a��%?��	k��	���	��;	�;	�Q!	K�Q!	r��!	���!	NJ�!	���!	%�l"	S��%|�l"	���"	ދ�"	
��"	:��"	n��"	���"	ˌ�$	�&��$	5�%	P�!&(f�Pot�%	���&	ԍI&6�� o��&	4�r'	Z�&{�r'	���'	׎�&(��o 
��'	<��'	i��'	���'	Ǐ�'	���'	-��'	^��'	���'	��/(	��&(��n!"�/(	E�z/	f�`7	f��d=�� d=���&�Ց`o�z/	��/	A��/	p��/	���/	˒�/	��y'P��n,��/	f��/	���/	̓�/	���/	)�	0	X�	0	�0	��0	֔)0	�)0	(�T0	H�T0	p�o0	��o0	ƕ�0	��0	�1	D��'Bf�pnt�1	��81	�((�@n)!�81	X�L1	��L1	��z1	��m��z1	$� 2	Q�09	�g� 2	��4	���7	�͘�4	ߘ3(D�0o�4	B��4	r� 4	����4	���4	ՙ�4	��5	G�w(�z��m+���5	��w6	Ԛ�5	��)P�0m�w6	L��6	|��6	��T7	�T7	
��7	8��7	[�Y8	|�Y8	���8	�g);�n))��8	b�*9	��*9	���;	��)n��pm
�Pm��;	Q�1<	��1<	��b=	מ*��b=	��=	B��=	~��=	���=	��>	
��=	6%�*H��>	m�-?	��-?	��N?	�N?	 �z?	X��?	z��Q	��hBơhB�,*��*J�hBt�hB��hBɢhB��?	$�2@	R��?	�s�2@	���@	ף@@	����@	)�+A	U�A	+t�+A	���A	Ȥ0A	x��A	��M	8��A	AT�@d=�]��xk�,*����x���M	ȥ�N	�N	���N	9��P	a��*���P	���Q	٦�x��Q	
�j	1�hBX�hB���*��F+ߧhB
�hB9�hBa�hB���Q	Ϩ�Q	��Q	B��Q	m�eR	���Q	���eR	ߩ�S	
�pR	(��*S�+|��*+<(~���S	���X	ު�S	�+��X	:��Z	b��X	}��Z	��*[	�*[	�W]	I�~$W� +��W]	���g	٬�}�%+��g	?�Hh	p�Hh	���h	ʭ�h	���h	��h	W��h	���h	���h	��h	"��h	R��h	t�i	��i	ʯj	��8+-��<�L�`�<�l� j	��v	°hB�hB �F+R�_,��hB��hB�hB�hBN� j	h��k	�� j	w���k	��l	�l	&��m	]�F+���m	³�n	�a+P � �%.��n	`�v	���+����#ȴ��
ִ v	�y	�hB8�hB^�_,���,��hBֵhB�hB#�hBJ� v	q�w	��_,(��`�öw	�0w	�0w	F��x	o��,H��@����x	ͷy	��y	��|	J�hBu�hB���,Ը�,�hB7�hBj�hB��hBƹy	��y	H�y	�{��y	��{	ۺ�y	-��{	8�6{	q�6{	��P{	ͻP{	�z{	7��,(e� �'s�z{	���{	���{	7��|	w� �<�����<0̽�Q=����<`�`�<pB��|	Z�R�	v�hB��hB���,Ӿ�-��hB�hB<�hBY�hBz��|	���	���|	=̿�,P�����	���	9� �	jN���	u��	����	S���	�Ƃ	���	�
���	$�Ƃ	E���	d�Ђ	�v�G-(��p�����	��	���	_��	9�m�	`��	]z�0e=��m�	���	��p�	���(e=��o-(�����	I���	s��	�����	����	��І	�����	�݇	5�݇	V�t�	u�@�<`����<H��t�	��R�	��`�	��ۉ	�hB+�hBJ��-j��-��hB��hB��hB��hB�`�	0�ۉ	R��	f��	~�hB��hB���-���-��hB�hB,�hBE�hBb��	��M�	��M�	���	���-P�����	*���	I�hBh�hB���-��I5��hB��hB!�hBA�hBe��	����	���	�����	����	����	���	.�ל	T���	m�Г{��-(hH.�H:.�H.+<����ל	��l�	���	���:.U����
�l�	.��	X�p�	xu��.6������	����	���	����.���	?��	h���	����.���	��¥	�� �	��0���.�2�¥	X��	|��	��?�	���/(�����?�	���	8���	c���	���/(�������	����	���	7�	�	^�	�	��	���	��1�	��1�	�6�	*�6�	V�I�	��I�	���	��P�	����/���	���	6���	a���	����	��Z�	��0�Z�	.�z�	O�z�	v�
�	��
�	��>�	���	.
�0()���7�>�	S�K�	m�K�	��k�	��P�	��=0�����������k�	�~�	;�~�	f���	���0\��p�����	����	�9106���	[�j�	~�j�	���	��i1`��P����	��	D��1Pj��x��	����	����	����	���	A7�2�\� �j���	��T�	���2D��@���T�	���	0���	\�\�	����	����2��\�	��^�	�`�	��3(0���>�^�	Y���	r�`�	'~�`�X��������	��P�	��P�	Y��C3����)���7�P�	\���	��3(��`�����	����	����	%���	I��3Ph�@�v���	��i�	��i�	����	���	C���	p�� ~�D4(����	���	��	'���	H�l4d���	��Q�	��z4��Q�	����	���	?�}�	`�}�	����	�� ���S=0���4�����	����	"�;5A���	R���	g�hB|�hB��I5���5��hB��hB�hB�hB3���	Q���	m�@e=}�Pe=��De=��I5����	����	����	���	,���	G��	`�W5s��	��/�	��/�	��h�	��h�	���	#�h5;���	\�f�	{�y5��f�	����	����	��U�	��U�	���	8���	T�C�	n�C�	����	���5(��x�
����	����	���	���	4���	P�V�	p�hB��hB���5��K6�hB&�hBN�hBo�hB����	��-�	����	M���5�-�	6�y�	[�y�	���	����	���	�������5(��	<�V�	_�`e=p��5V������`�	��b�	��hB��hB�K6,�K6Q�hBq�hB��hB��hB��`�	���	��	3���	Q���	s�b�	��p�	���	��hB��hB��K6�K67�hBT�hBu�hB��hB��p�	����	�p�	-���	<���	Y��<8l�@�<8z���<`����	��:�	��:�	����	���	,��	J��	^��

v�hB��hB��K6���6��hB�hB$�hB=�hBZ��	}��	���	>���	����	��	����	C�1�	k���	���1�	��_
��@�	��K6P������К
�_
+�k
G��U�k
���
���
��M
�M
*��
O��
w��
���
��N
��N
��
)��
G��
c��
��	
��	
���	
���	
��	
;��	
d�/

��/

��h

��h

���

��

@��

c��

z��
��hB��hB���6���6�hB2�hBU�hBq�hB���

���

���

��
	�
/��
S��
s��
���
��I
�I
�l
1�l
\��
���
��
��hB�hB��6��65�hBT�hBw�hB��hB���
��
���
��
=��6Z��
��
��
�(
�(
�z
<�z
a��
���
��
� 
���
�hB>�hBd��6��
7��hB�hB�hB)�hBP� 
w��
���
�
�
�C
:�C
f��
���6a��������
��)
�hB;�hBd�
7���8��hB�hB�hB8�hBb��
��=
���
��=
�g
I�@
'o�g
��/
�p
���
7("�+0/
c�
�0
`�27(�@�$��
$
U�
pyZ7x���$�
�Q(

Q
7�7�a��(op�}Q(
��(
��(
�)
I�)
^n6
whB�hB��8�s9�hB
hB+hBEhBc�)
�:*
��)
���8x����:*
+
E@*
�_+
��,
� +
���,
�!.
�,
q$!.
Q�.
|0.
���.
��0
��0
�1
@�1
j]2
�]2
��2
��2
M3
<M3
d�3
��3
��3
��3
	K4
,	K4
W	�4
�	�4
�	D5
�	D5


n6
8
#9Pa
`�!o
p6
�
�D
�
hB�
hB�
s9#c:OhBvhB�hB�hB�p6
�6
Ap6
J]s9P�����6
�;7
�;7

}7
/
}7
Z
,8
�
�9(�
��
,8
�
[8
[8
59
]9
�L:
��9(�Ч�L:
�A
G�A
n�D
�:P<�������D
�}E
�hBhB1c:Rc:whB�hB�hB�hB��D
+CE
[CE
�}E
��E
��T
�hBhB?c:g�:�hB�hB�hB	hB1c:pw:�c:��E
G
+G
UJG
}JG
�kG
�kG
�G
A��Kw:t�G
��T
�|:>�����T
}U
#hB@hBa�:��:�hB�hB�hB
hB/�T
Q�T
q�T
�CU
�CU
}U
/�U
O�^
shB�hB��:�;hB=hBihB�hB��U
��V
�U
;�:(6��D�V
mW
�W
�ZW
�ZW
lW
NlW
v�^
��:9�����^
�2�
hB/hBV;~�D�hB�hB�hB hBH�^
u<b
��^
��;(���<b
"ab
Q@b
!sab
��c
�pb
R�C;x�!(�c
Q.d
x�c
^�.d
��d
�0d
���;(" �0 �d
l �e
� �d
�� �e
!�h
7!�e
�[!��$i!�;x�!�h
�!Kj
�!�h
�&"[<xU"@�'c"Kj
�"Ek
�"Pj
��"de=�"Ek
#�k
'#�k
W#\l
�#�k
��#\l
�#�l
�#�l
$Jm
6$Jm
a$�m
�$�m
�$�m
�$�<(%p�%�m
F%vn
q%vn
�%�n
�%�<(�P��%�n
&qp
-&#=PO&0�]&qp
�&%r
�&%r
�&dr
's=(,'�:'dr
e'�r
�'�=(�'о�'�r
�'�r
(�=(A(��O(�r
�(�r
�(�r
�(�r
!)�r
W)s
�)s
�)�s
�)@�"�)�s
**8t
Y*8t
�*bt
�*�=(�* ��*bt
+_u
>+>xf+� t+_u
�+v
�+�>,v
<,v
o,v
�,Cv
�,�>(-��&-Cv
B-�v
o-�>(�-�� �-�v
�-�v
.�>(S.`�.a.�v
�.�v
�.?(�. �%/�v
7/	w
j/	w
�/Hw
�/Hw
�/�w
.0<?(X0�"f0�w
�0�w
�0d?(�0��%1�w
61�w
c1�w
�1x
�1x
�1�x
2�x
F2y
{2�?(�2`�(�2y
�2y
3y
A3)y
m3)y
�39y
�39y
�3Ky
'4Ky
W4[y
�4[y
�4�z
�4�?�50�5�z
F5�|
y5�|
�59}
�59}
	6~
16T@(T6�b6~
�6�~
�6�~
�6��
7|@P47йB7��
l7��
�7�@x�7���7��
�7Ă
8DA(@8p�N8Ă
z8�
�8�
�8 �
�8 �
9lA(D9P�R9 �
�9��
�9��"�9�A(�9��
:z�
P:�
zu:�Ax�:��%�:z�
�:�
;4BP7;��!E;�
w;g�
�;�B(��#�;g�
�;�
"<�BPD<0�R<�
}<T�
�<T�
�<B�
�<�B�$=к2=B�
Z=_�
�=�C��=���=_�
�=��
>[Dx*>��8>��
e>f�
�>f�
�>��
�>��
?Ӝ
N?Ӝ
~?2�
�?�D(�?@�!�?@�
@��
+@hBQ@hB{@�D�@�M�@hB�@hB-AhBTAhBA@�
�A�
�A@�
�B�DPCB��(QB�
�B�
�B �
��B�
C[�
=C�
k^C[�
�CA�
�C`�
��C �#�CA�
"D3�
QDP�
�sD�
}�D3�
�D!�
�D@�
�E��
z7EKE�aE`�*oE!�
�E��
�E0�
o�E��
3Fg�
gF��
��F�E�FF�F�E+�F0�GFAGAFzGF+�G@�%�GAF�GlF&HAF+QH`�#_Hg�
�Hj�
�Hp�
��H��
�H��
F!Ij�
ZIȫ
�Ip�
X�IlF-�I@�*�Iȫ
/J�
aJ�
�J!�
�J!�
�Jy�
Ky�
JK�
yK�FP�)��"�K�
�K�
L�F(-L��";L�
wL��
�L��
3�LGU/�`�-
M��
IMɮ
�Mɮ
�M�
�M�
#N&�
MN�
FjN&�
�NG�
�N��<`�N��HOG�
.ON�
YO0�
y|ON�
�Ot�
�OfG(�O���Ot�
+P�
UP�GzPp��P�
�P�
�P�
�Q�H�HQ��'VQ�
�Q?�
�QPI(f���!�Q?�
R��
ARxI(mR�${R��
�R:�
�R:�
S��
=S@�
}eS�I
�S��
�S�
�S�
2T6�
cT�
6�T�I�T6�
�T��
	U@�
L&U�I(f���KU��
~U
�
�U�I(�U �$�U
�
V!�
GV�
hV�I\�V�� �V!�
�V��
W��
=W��
wW��
�WZ�
�W�
Z#X[J-[X��#iXZ�
�X'�
�X'�
�X��
/Y��
aY�
�Y�J(�Y��#�Y�
�Y��
"Z��
/HZ�J�nZ�|Z��
�Z��
�Z}K([��))[��
\[��
�[�K��[ �$�[��
�[��
\JLPE\@�(S\p�a\��
�\��
�\��
�
�\�L�\��]��
<]��
o]��
�]��
�]��
��]�M(^��^��
H^��
q^��
�^��
�^��
�^!_hB3_hBW_�M|_�P�_hB�_hB�_hB`hB7`�M_`
N�`�M+�`���`��
�`��
.a��
"aap�
�a��
�a��
�a�
� b��
Kb��
tb��
4�b
N-�bP��b��
�bU�
cU�
=c�
dc�
�c.�
�c.�
�c8�
d8�
5d��
`d7N^�d���d��
�dL�
�d�Nx3t��eL�
7e��
`e
O}�e���e��
�e�
�e�
f6�
Bf6�
wfq�
�fq�
�f��
g��
:g��
\g��
�gj�
�g�OP�gp��gj�
�g��
h��
Ah:�
ch�qh�OPH0��h:�
�h��
�h��
i�
Ti�6
ui�
�iF�
�iF�
�i��
j��
Kju�
wju�
�j��
�j��
kp�
/k��
�Kkp�
�kw�
�k*P(�k��(�kw�
(l}YlRP�l}�l�lm]Gm]lm��m`��m��m��m��n�Bn�mn��n��nWPc�np�o��&o�Do�vo��o!�o0�oa9phB/phBTp�Pzp�S�phB�phB�phBqhB:q0nq��q0W�q�Px�q��%r�1r`r���r�'r�r�r=�r s=Ks[|s@�s`4�s2Q(�s��$�s[-t�\tZQP�t��"�t�Q�t�Q�t�Q+�t��u�Au!tu���u�Q(�u�&�u!v�>v0�dv��v��v���v�QU�v��w�:w
 lw�j�w%��wRR��w��%�w��x
 &x#Ix�Rgx#�x�$�xS�x�$y�$2y�$hy�&�yS(�@�'�y�&�y�'!z�&�>z�'mz")�z")�zC){C)6{?*h{0SP�{`�%�{?*�{M/	| �%|�S(D|M/w|�/�|�/�|3}��}�S(7}3g}w6�}w6�}J8�}J8#~�8S~�8�~�8�~�8�~�8�8Da9qp9�8J�hB�hB��S��T?�hBc�hB��hB��hBрp9��:;�p96b��SP����'���:с�;��:@$�BxI��;��<���;�ڂ�<��=@��<�e��=��o?���=�؃ T(�����o?9�@e�p?���@���AڄHT���A3�xBe�xB���Bͅ�B��E��E8��E[��E���F���F��F��F3��IY�VTxz������I���I܇�I
�8J6�@JM��`h�hB��hB���Tˆ6V�hB�hB(�hBD�hBd�@J��yKȉ@J9��T(�k��$�yKI�1Lx��K����T(Ċ �"Ҋ1L�KL:�KLb��L���L��]M�]M��MB��Ml��P���S=���P֌�P���P"��XG�he=O�U(o���}��X���Xˍ�X��Y�FUP=���K��Yz�$Z��Z$ǎ _�pe=
�$Z>��Zm��Z���\���U(�sp�ʏ�\�_]�_]:�_X��U(q�P��_��3`��UP$���2���+@�3`n��`���`���`ؑ�`��)i�hB=�hBd�6V��.Y��hBߒhB
�hB.�hBV��`��:a���`Jɓ:a��wa'�@a7H�6VPq�`�!�wa��fbӔ�a���V(�0�!�fbJ�
cq�pb����V(�����
c��c�c�=��VPg���"u��c���cۖ�c1�&W(-���%;��ci��d���c���NWPۗ����d#��d[��dI���W(%���+���d�!e��d1;��W(e�@�"s�!e���eϙ0ee� � ���e-��e[��e1|��W(����!���e�!f��eA2�X([� �!i�!f��bfϛ>XP����%
�bf6��f`��XP��p����f���f��f��g;��X(^�P�l��g��vhԝvh
�i>�Y(m���'{�i��i՞i�)i-�0iM���q�hB��hB��.Y��^�hB;�hBg�hB��hB��0i�Ti�0i$:�Tih��i��`i9��.Y(ڡ����i��jH�VY(r� �"���j��k�k��kH��kp��k���k��@l�@l��mD�~Yxl�� z��m��&oΤ�Y(�P��&o2�]ob�Z(����#��]oȥ~o�FZ(���'�~oW��p��nZ���`�!���p�Yq$�[�R� �&`�Yq���q̧�[�����(
��q=��sn��q���@�$��7\P̨�s��mt$�mtW��t���t��6uܩ6u
�^u<�^un��u���uӪrv�rv=�8yr�8y���yҫ�\x����"
��y=�zn��\(���$��zڬrz
�rz8��}d�']a�������}­e���]�����e�H���u�6^(���� ����ޮ†�^^(;�`�$I�†��������دr���hB�hBE��^m�Va��hB��hB�hB�hB7���o�a������α�^(����)
�a�:���e�p�1�������ײ��1���6�I��Ff�6���M���@�
ֳM��_�4�P�U�_���m���`�
ȴm���}�*�p�
M�}�~�������ϵ����Պ-���5N��^Pw��!��Պ��!���A��^(=��%K�!�t�~���~�˷������ ��E�xe=U��|����&_(��0�ϸ������N_(A��O���w���������v_(׹������K��_(x��%������ں���H��q�E���E�ƻc��c�"��P��_(y���!�������Ӽ����	�)�	�Y�������j�ݽj����9���h�����ž!���_(�`�!*�!�^�x���`(�� �%��x��B��B�G�—y�—�����>`(������*���P���|�]���]�������-�^�X�^��������������G�[�x�[���3���f`(��@�&�3�A���r��`(����$������.���`(<��$J�.�w����0�����`(��0������D��^�a(��������1���1�1��b�.a(��`�$�����������0�8�`�8���r����������hB:�hBd�Va���c��hB��hB�hB=�hBh������������������F���c�����R��������@���R�H���v������������ɫD�ɫ�����Ы��������T�P�1x��������� �0�V�0���Q���Q����� ���T�������������#�2�T�2���>���Va���P��>��W�=�@�<`[��S=Hv�W���"����a(��0�"�+�T�S�b(u���T���Ĵ��/b6����Ĵ9��e�дN�����B���B�
���>���n�۵��۵�������:�H�d�H���l���P���eb(��%-�l�Z������b(��������n���n=�n�r����p���������!� ��>��b�c��&q��������������{�C�{�w������������hB�hB9��cb�qd��hB��hB��hB�hB1���Y���������c���c���c+<@���3�B�b������B���F����S=��F�%���L���y��������������c(!��/���]�������������`"���c-!���J��q�d-�� ��������Id(�-��f���� �������hB��hB	�qd)��dM�hBl�hB��hB��hB�� �����	�T=$���F���f�qd(����������������&��N���t��������hB��hB���d��m�hB �hB>�hBU�hBp��������������e=�����������1��e=<���Y�E�t������E���u���P�%���d(���u�B���f���V}�0T=������:�����Z��:�'�b�P�@�"l�b����������������H���H����0�P�~>���T���h��d(w�������������������@�7�@�X�d�w�d���w���w��������d(� ���E��l�e6����������������&���E���b�Ge^z�������������e^]X`�������*���L�A�l�A���3���P����f���
�3�/���R�@�Kh��f�3���������������W���)g^��x		�W� ���5��gE���h�.���.���9���9���D���@����gx��#�D�=�Y�U�Y�r�i���i�����������e��
h�e�6��S�h�k�Py����.���.����#��@�:�[��h�q�8�:���.���'i6��H��.��������@�=�j�]iP�����=������������/���L�d�g��i^}����d������j^������������6���U�ijn��������wj��������j����X�2��jO�X�h����j6���
��������j6�x
���p�;�
k6[�`i�p������������������1���M�m�g�Ck|�m���|���|��U��Qk(��H
�U�/���Q�ykn����������������h�<��k^�h���k���0���kP�k��q���k�q�*�j�A��kS�j�p����l�������l6����	�5%�El<�5^�~�Sl(��0���;�;�Y5�{l(P��^�Yu�U���l��U��\��l(��`�\ �>6��lG�>f�>
������l(��>
��
���
�kC�kf�������������+hBBhB]my�m�hB�hB�hB�hB�-�Q�
h�����
���R��rR0�O`Ya��H
����H
���P
2�p|�05�0@�+:?@xS�GhPZ��j�����"���:�:'-mPF�T'peje��<�Z�v�����:�:���(J_m(f t�J��m(��J�5�W�w�����%�hBhB%�mE%oihB�hB�hB�hB�1%!61Vmt@-�m�Y�p���m(�`�Y	+:	`�L	��]	`!x	�%"�	���	0r�	*�	�T�	0e
p%,
@%),
�#�D
�#)V
#|o
���
+�
��
�mP]X��
�&�L�r*�*����U*UT�|��1�1��
@�?
�n
�"�
'n��
@ �
�"�
##�"t>�n(ao#��#��n(� ��#
�#,�#S�$x�$���$�>%�o�>%i%.i%R�%t�%��%��%�5�hBhB2%oT�ozhB�hB�hB�hB�%"�%B�%!U�%|S&�&S�S&�+(�`&��(�$�(A�4"Z�(Fr0(J�`0J�`4J�0Y��2���/R��3� 3�<�0JO%od`/7y/L��.l�@.T�.7��4"�2b�1��-L-%oQ=os+(�z(�z(��(�(;�(e�(��,���<`��,�-��,P�-%_-L-Of_-��-�`-J��-��-�-<7.^7.��.��.�/�/\/(\/L�/n�/��/��/�Y0�Y0�0F�0h�0��0��1��1�2�1q3=o(O�]2�r2�r2�3�3*�3Y�3�Z4�eo(���Z4�4%�4M�4s�4�5�5�1U�hBhB!�o>�p_hB{hB�hB�hB�5��5	5��5>�5c�5{�5�L6��5��L6��6 P6�+ �6Z �7� 7�� �7� �7� �7?� �7!�87!�7�K!�8o!�9�!�8-�!�o(�S��!�9�!�:"�9%"�:5"�=P"�:�^"�={"|>�"�=��"|>�"?�"�>��"?#5A2# ?E#�o`#5A�#PB�#@A�#PB�#1C$PB�($1CE$SD`$@Cn$SD�$�G�$`DR�$�G�$HJ%�G�%�o^(%�6%�D%HJi%$K�%PJ��%!pP��%$K�%L�%0K�	&qp( &�.&LM&�Mj&Lsz&�M�&>N�&�M��&>N�&�O�&@N�'�O2'-PV'�O=m'�pP�'��'-P�'�P�'0P��'�P(�Q-(Q�;(�Q\(_R{(�Q��(_R�(4S�(`R�)4S#)bSD)@S"X)bS{)�S�)pS"�)�S�)1U�)�S��)@U*&a#*hB:*hBU*�pq*�q�*hB�*hB�*hB�*hB�*@U+GU5+@UB+GUh+[U�+PU�+[U�+lU�+`U�+lU,yU@,pU	V,yU�,�U�,�U�,�U�,�U-�U-�U8-�UV-�Ug-�U�-�U�-�U!�-�U�-=V�-V=.=V).�WH.@V@Z.�W{.�W�.�WQ�.�W�.QX/�Wq/QX?/�X`/`XVt/�X�/�X�/�X2�/�X�/_Y�/Y_	0_Y&00[A0`Y�O0�^"b0@]qw0 ^n�0�\��0`\3�0�^K�0�]W�0�[��0�_��0�`F�0`[F	1�^"10[D1V[j10[&�1�p(�1p�1V[�1�[�1�[2V\"2V\F2�\h2q(�2��2�\�2@]�29q(�2�3@]%3�]G3�]e3^�3^�3�^�3�^�3�^	4�^+4�^K4�^g4;_�4;_�4�_�4aq(�4��4�_�4�_5�q(J,�.5�_J5�`d5�`�5&a�50a�5Rf�5hB�5hB6�q46�qZ6hB{6hB�6hB�6hB�60a�6Rf7�q-7`f?7tU7hBk7hB�7�q�7r�7hB�7hB�7hB8hB)8`fD8�f]8`f!i8�f�8?h�8�f��8Pq��8�s"�8�o��8 o��8�n*9n�
9@s�!9r/<9@hnJ9?hg9�h�9�q�9�h�9�j�9�h7�9�j:n1:�jJ:nf:�n�:�q�:�n�:o�:o�:�o;�o6;OqT;Oqo;
r�;
r�;?s�;�q�;?s<�s@<�q([<i<�s�<t�<t�<mv�<hB�<hB=r?=re=hB�=hB�=hB�=hB�=t>�t+>�tV>mv>pv�>B}�>hB�>hB�>r?hr5?hBU?hBy?hB�?hB�?pv�?�v�?pvK	@�v+@oxK@�v�^@�z�p@ }"�@�|w�@�zJ�@z��@0|g�@�{�ApxnAox=A�x^AryA�x�A�y�A�x�A�y�A�z
B$r$B�zLB�zrB�z�B�{�B�{�B,|C2r8C,|aC�|�C@r(�C��C�|�C}D}(DB}MDP}cD
�}DhB�DhB�Dhr�D�r�DhBEhB7EhBREhBqEP}�E\}�E\}�Em}	Fm}1F}}WF}}�F�}�F�}�F�}�F�}G�}CG�}jG�}�G�}�G�}�G�}�G�}H�}5H�}YH�}yH�}�H�}�H"~�Hhr(I�I"~>Il~jIl~�I}~�I�r�I�r�I}~J�~&J�~EJ�~bJ�~�J�~�J�~�J�~�J�~K�~&K�~GK
fK
�K2�K2�KS�KSL�:L�`L
��L��L���LhB�LhBM�r$M�rLMhBoMhB�MhB�MhB�M��M��"N��8N��^N��N��!�N��N���N��O��!OhBAOhBeO�r�O�r�OhB�OhB�OhB PhBEP��kP��P��X�P��P���P��Qb�0QhBPQhBtQ�r�Qs�QhB�QhBRhB/RhBTR��zR��R��T�R��R]��R �=S�r(4S@BS]�hS}��S`��S�rP�SX5 �S}��Sb�Tp�9T�YThByThB�Ts�Ts�ThBUhB7UhBXUhB}Up��U��Up���U�V��BV��ZV���V��V��V`��VhB�VhBWs4WsXWhBwWhB�WhB�WhB�W��Wa�X�Q+Xa�KX4�iX4��X׊�X@���X׊�XN�YN�%Y`�FY`�VY��jYhB~YhB�Ys�Y+w�YhB�YhBZhBZhB.Z`�iZe��Ze��Z؋�Zp�h�Z�e=[؋[̌6[��A[s(60&T[̌}[���[Ќ*�[&�[���[G�\�G'\�%5\G�j\k��\P��\Fs�\qs
]Fs+$]�%	2]k�Z]���]p�?�]���]��]��n^qs(!^�%/^�S^��u^�s�^���^t��^`&�^t�_��_PT=._�s(@_P&
N_��i_ ����s��_@&�_ ��_���_���_��`��@`�d`��`W��n�g�`W��`z��`rt(�`&az�!a�@a�t-Za�%ha��aژ�a�t(�aP%�aژ�aB�bB�;b]�hb]��bi��bi��b|��b|�.c��`c���c���c���c�� d�txGd%Ud��|dI��d@�m�dgu-���$�dI�eĝ.e�u-Te�$beĝ�eݝ�eݝ�e��e�u6f�$	f�7f�Of�u6bfp$pf��f+��f-v6�f`$�f+��fJ�gJ�8g_�Zg_�~g���g���g���gcvP�gp%h��.h��Rh��hJ��hJ��h���hP�Ui��-i:�Di:�hi���i�v(�i�$�i���i���i�v(j0%#j��Lj��sjw(�j�$�j���j0��jhB�jhBk+w/k#zSkhBrkhB�khB�khB�k���k�'l��cDl�fl��l��l��l���l ��m��$m�Cm��@Um��me��m�u�me��m�	np��n�e=+n`�<`<n.HJn�un_��n �?�n_��nʵo`�jo+w(HLP->oʵco<��oеl�oSwP�o0-�o<��o��p@�_2p�w(Tp�,bp���pq��p����p��D�pq�q �,q���Gq�w(jq�,xq ��qh��q �H�qh�r��2rp��Ur�w(�rp-�r���r���r���rxP�S`,�r��s�8s��FKskx(fs�,ts��sU��s�E�s�xP�s ,�s,tU�.t~�Rt`�it�x(���-�t~��t��t��t��u��*u��?uy(<�-]u���u���u���u3y(�u�-�u��v��8v�-Fv��wv��v��;�v��v��4w�r\w[y(�k-(�w���w���w��x�yP�p�, 0x��Rx��rx���x�yP�x@,�x���x���x��y��,y7�Vy��Wsy7��y���y@�{�y��z��0z��>Sz���z?��z�?�z?��z��{@�E0{��Q{��p{��5�{���{��{��L�{��{��,| ��M|��v|6��|��F�|6��|��}@��}��A}��b}��v}���}���}���}��~0�=~���V~0�k~���~hB�~hB�~#z�~Bz�~hBhB8hBRhBp0��?��0��?�����@�L8���Y�r�x������r���<�Ȁ���ـ�/�<��+�!�@��0�+�^�����0������΁��������/���;���_���.v�����$�����4Ȃ$���r�$�0�BD�r�r�K��������K�����P��
0�`U=0K�0Y�#z~�����~����~̈́~��������F:���`��������������>�ӅhB�hB�Bz6��z]�hB�hB��hBĆhB����b�?����]�b������p��ć��Z�� �:%�Z�J���m�`�G��BzP���2���2�����2�������e=0�2�T�r�v�@�2��r���>�ω������<`���2H��z'�@�G�
k�hB��hB���z�R|
�hB5�hBa�hB��hB��@�ۋV
�@�"�V
O��
z�`
D���
Œ�
��
���zP(��56��
f��
���
���
��
	��
%��zPI��5W��
{�|
���
���C{�ώ�5ݎ�5�|
��
?��
[��e=w��{���
ɏ2	
���
��2	
@�Y	
j�@	
��Y	
���

א`	
0� �<`
�@6H&��{H��

���
���

\ߑ|��
7�~
\��
�t�~
���
֒�
[��|6n�6!$��
N��
v��
����
���
��
F��
;�
d��
!�� 
��
4
��hBʔhB�R|�~*�hBH�hBj�hB��hB�� 
Õ�
� 
���

��
"��
�-��(
DE�R|(X�X:f��
���
���
%���
֖�
���
�
��
.��
M��

_��e=q�z|(��:���
���
՗�
#���<`���:H��|��
E�� 
j��
���� 
��~!
Ԙ� 
��~!
��"
I��!
Eh��|���"
��$
͙�"
8ޙ$
���$
�$
���$
7�&
N��$
(X�&
���&
�� &
{Ț�|(���:��&
��'
.��&
�A��'
k�}(
���'
����|(ћ�:ߛ}(
��(
+��(
T�)
{��(
D��)
��9)
ל )
�9)
�"+
8�@)
�Q�}Pe�p:r�"+
���+
ȝ0+
���+
��.
%��+
�7�d}(Q� :_��.
�3
���.
7���}PǞ�9՞3
��
4
�3
�6��}(U�@:c�4
x�u5
��hB��hBǟ~�~�hB$�hBE�hB_�hB}�4
��$4
��4
Ơ$4
�54
�04
�54
5�T4
S�@4
d�T4
��l4
��`4
šl4
�w4
�p4
�w4
?��4
e��4
~��4
���4
Т�4
��4
�5
A��4
R^�5
{�5
��5
��5
ã%5
� 5
�%5
�55
6�05
K�55
r�J5
��@5

��J5
֤U5
��P5
�U5
1�e5
M�`5
\�e5
��u5
��p5
ե�5
��
7
�hBF�hBq�~��~ͦhB��hB'�hBO�hB{��5
���5
ѧ�5
��5
/��5
Z�W6
��W6
���6
ۨ�6

�
7
=�7
S�`D
m�hB��hB��~ĩ|~�hB�hB'�hBB�hBa�7
��!7
��7
��!7
ߪ�8
�07
Z��8
6��8
V��8
i��8
��L9
��@�<`����<HƫL9
�:
�p;
#�~(�P==�:
\�^;
y�:
N���<
H��^;
��i;
߬i;
�<
5�<
\��<
��,~(��0=���<
ԭ�>
���<
�
��>
/��>
O��>
,b��>
��@?
��@?
ˮ�?
�@?
���?
0�qB
V��?
�o�T~(!��<��qB
���B
Я�B
�	C
��Z=�	C
:�`C
]�`C
{��C
���C
��D
�D

�`D
3�`D
G��G
_�hBw�hB��|~���~ѱhB�hB
�hB&�hBC�`D
_�dE
y�dE
���E
���E
ϲ�F
��F
��G
1�|~(K�p=Y��G
m��J
��hB��hB���~ֳ��hB�hB3�hBL�hBi��G
���G
���G
̴�G
��G
�H
1�H
U�?H
w�?H
��eH
��eH
��H

��H
3�I
W��~(u��=��I
��LI
öLI
��I
��~"��I
E��I
f��~���I
��6J
Ϸ�~�6J
��J
-��~E��J
i��J
���J
��LO
ɸhB�hB�5�_�hB��hB��hBϹhB���J
�LK
)��J
\5�LK
`�LO
��PO
��'m
ɺhB�hB�8���c�hB��hB��hBֻhB��PO
*�yO
U�PO
)s�yO
���P
���O
ȼ�P
�ZQ
��P
�/�O�ZQ
|�>V
��`Q
�Ž!"�>V
��W
 �@V
j-�CPA� E
O��W
~��X
���W
N˾�(�E ��X
6�@Z
j�Y
@��@Z
̿�\
�@Z
�1��d��\
��a
��a
������D��D�0E�a
O��a
~��a
��Jj
��a
�����'��D5�Jj
b��k
��3�6���D���k
��%l
�i�(0�`D>�%l
p�'m
��0m
���t
��hB��hB���"���D�hBa�hB��hB��hB��0m
��#n
��0m
�z���<`�#n
)�jo
J�0n
:^�jo
���p
��po
W���p
��uq
�uq
9��s
Z��s
z��s
���s
��4t
��4t
���t
��t
+�J|
H�hBe�hB����������hB��hB�hB2�hBT��t
v��u
���t
���u
���w
��u
���w
B�(y
c�(y
��B{
��B{
��J|
��P|
��
�hB6�hBQ���m�����hB��hB��hB��hB��P|
!�a
E��e=Q�f=�`���*~�a
���
���
���
��
8���
V�hBt�hB����������hB�hB(�hBG�hBj��
����
����
��ގ
��hB�hB*���I�E�l�hB��hB��hB��hB����
���
���
@ ��
M�d�
x��
t��NG����F��0G��d�
���
�p�
�'��(< GB��
j���
��)�����
����
����

�Q�
,�Q�
J�ߋ
f�7�|�ߋ
��a�
��a�
��ގ
���
�f�
*�hBE�hBd�E�������hB��hB��hB�hB&��
H�B�
h��
b{�B�
��}�
��P�
-��}�
���
@���
1[���
��x�
����
���E�(��J"�x�
>���
e���
>�m���{�������{�+�K���
=���
_���
�t���9���J����
����
����
��߂(��J���
?�?�
_�?�
~�\�
���(bf`K��\�
����
��/�(
�@K���
K�̕
y�̕
��U�
��U�
��m�
�m�
*���
M���
r���
��W��.�J�� K����
���
��
D�Ƥ
o�����`J��Ƥ
��P�
��P�
�)�
7�)�
[�A�
}�A�
��^�
��P�
�^�
+�f�
T�p�
j�T�
��hB��hB���������hB�hB>�hBY�hBx�p�
����
��p�
>����
��H�
�H�
5���
V���
x�ڧ
����(��L��ڧ
����
���(��K-���
W�0�
���
���0�
���
��Մ��
5�T�
`��(���K��`�
����
��hB��hB������1�hBM�hBm�hB��hB��`�
��׬
��`�
w�׬
B�W�
l��
w��W�
����
���x���R���R����
�F�
1�F�
U���
w���
��#�
��hB��hB�������'�hBF�hBi�hB��hB����
����
����
V����
���
<���
e���
����
��#�
��0�
���
�hB�hB6���T��v�hB��hB��hB��hB��0�
�7�
*�0�
;�7�
`���
��@�
����S����
���
���
"�%�
E� �
[��TAg�%�
��>�
��>�
��_�
����(��S&�_�
I���
j���
���
���
��C�
����9�`S)�C�
K��
k���� �
����
��hB��hB�����)�hBF�hBg�hB��hB�� �
����
����
�*�
'�*�
K���
m���
���
���
��q�
�����q�
"�q�
I���
�p����q�
����
����
���
#�hBO�hB����<���hB�hBI�hBv�hB����
��K�
���
�)�K�
[���
����
����
����
���
M��(x��V$����
���
���
���
<�hBh�hB��<���=���hB.�hBb�hB��hB���
����
$��
�H���
n���
����
/��<���g���<�+o�Y���
C�L�
q���
l��g���L�
���
��P�
�	��Y!��Y/�x����YK���
}���
���
��?�^��`Y��@Y	���
=�e�
o������Z%��e�
���
���
:���
b�hB��hB��=��݈�hB@�hBp�hB��hB���
���
"���
�B��
p���
���
�J3	��
q��=�(� [���
�1�
+�1�
I���
e�@�
jt���
��)�
����
y�e�(�[��)�
'���
S�0�
`r���P��@[����
���
���
��6�hBQ�hBp�݈������hB�hB��hB�hB2���
O�,�
v��
�j�,�
����
��0�
d��݈���݈+4S�[8���
Y�8x���
����}���[���[��8���$IhBnhB�������hBhBEhBkhB����������� ��<q������"$��C"Z�o0sw�����F���(��]�5[g[�‰(�@^%�[��	`��LGz�g�G���PV���	3��K�(k^y�	����	2��(
 ^�F�o��
�:���]��]������;�j��l���	R�P5	p^C	�m	�	�	p�	hB�	hB
��0
�W
hBy
hB�
hB�
hB�
�'�<��PX�^f�^t��p�p��!�hB hBF�m���hB�hB�hB
hB2
pZ
,�
p��
,�
� �
0��� �_.� W!~� R�!��!��!c%*hBLhBr�����hB�hBhB7hB^�!�i"��!��i"�$p"�,��PL `Z$�r$� $R�r$�c%p%0J/NhBlhB���
��hB�hB hB?hBbp%��%�p%*��%��-��%��<��-7�-X�-{/��(��e�/�J/
P/'z1EhBchB�
��@��hB�hBhB6hBYP/wz1�
�6�Hf��1�J<�hB�hB@�9@�[hBxhB�hB�hB��1�2�1�22Y�2~2����<`��2�19�19�J<@�<8 P<;�OZhByhB�@�����hBhB2hBRhBvP<��<��P<g��<��=��<�@�(0h!�=A�?_�=ph�(�Ph���������+h)�?P7Au�?W�7A��A�@Az��A� B
�A` B<�D� B�W��(l hz�D��G��D��&�GUpI��G����pI�J�?JdNJ�NJ��J�����J! �ND 	��b �gp �N� �N� �N� AO!AO@!tOb!tO�!�O�!�O�!�O"��<X"P;"�Q^"hB�"hB�"���"���"hB##hBN#hBr#hB�#P�#aP�#aP!$�QN$�Qf$�Y�$hB�$hB�$���$ߎ%hB$%hBH%hBe%hB�%�Q�%NR�%�Q��%NR�%�Xz� �<`&��6&�h-&�XP&�Yl���<8q&�Y�&e�&hB�&hB�&ߎ'��9'hB\'hB�'hB�'hB�'ߎ�'
�)(ߎ+L(�iZ(�Y�([�(�Y.�([)�[4)�[Z)�\~)�\�)�\�)�\*A^.*
�P*A^�*\^�*\^�*0_+0_=+el+���+�i�+�i�+e�+�i�+hB,hBF,��p,��,hB�,hB�,hB-hBD-eh-f�-e��-f�->i�-��P.0jXPj.>i<.�id.�i�.v�.hB�.hB�.�"/n�P/hBy/hB�/hB�/hB�/�i0_jB0�i�Z0�(y0k�0_j�0�m�0�P�0`k1�m'1cqL1b��k1@ky1cq�1�u�1F�(�1 k�1�u 2vC2 vb2Kw�2hB�2hB�2n��2��#3hBJ3hBu3hB�3hB�3 v�3Kw4n�(/4�k=4Pw^4[��4hB�4hB�4���4�)5hBR5hB5hB�5hB�5Pw�5�w6�wM6�wy6�w�6x�6x7rx+7rxT7��{7Pl�7��P�70l�7���7�8�48��V8�(r8l�8���8?��8?��8�9�59�a9[��9`��9��9hB�9hB�9�:D�5:hBS:hBu:hB�:hB�:`��:��:�(;pl; �6;�T;hBr;hB�;D��;��;hB<hB&<hBE<hBh< ��<��< ���<D���< r�<�=�0=��E=�(b=rp=��=���=���=4�P�=�q<�q�=��> �H>���e>��(�>pq�>���>ד�>��+ ?0q.? �P?N�p? �.�?ד(�?Pq�?N��?d��?��x@�r)@�r7@d�X@Q�Np��w@���@Е&�@0�p�@w���@@r�@Q�Aɕ�I`�i@A*�(_A`rmAɕ�A���A���A.�%B�.AB.�gB���B���B���B��C��1C�PC��`bCR��|C�q�C��C՛�CB�PD�qD՛7DZ�\DZ�D��D��Dٝ�D��P'E�p!5EٝZE2�}E�:�Eq�E2��E|�F�x-F�p ;F|�fFC��F��P�F�p�FC��F�G�(Gd�p3G�XG۩�GhB�GhB�G�HԘ7HhBdHhB�HhB�HhB�H�I�1I�
EI�kI���I���I����I�w�I��J�=J��t[J��uJ��J���J����J���J��(KߢQK��?mKߢ�K~��KP�P�K�(
L�tL~�AL(�hL(��L9��L0�	�L9�M�>M@��`M��Mg��Mg��M��Np� (N4�(KN�tYN���ND��N\�P�N�t!�ND�O��IO��wO۩�O��(�Ou�O��O�PhB'PhBGPԘhP
��PhB�PhB�PhB�PhBQ�0QC�OQ�caQC��Q���QԘ�Q���Q�R�(R`u-R�RR�uR ���R��R���RhB�RhBS
�BS��lShB�ShB�ShB�ShBT
�4T8�dT
�+�T`x�T��T��T��T8�8U�xU�NU�{Up�P�U�x �U��UƮV��(2V�x@VƮwV��V��V��W�;�Px<W��jW���W#�(�W0x�W���Wl�XK�(@XxNXl�xX���Xs�(�A�w�X��X�YhB1YhB[Y���YÚ�YhB�YhB
ZhB4ZhB_Z�}Z���6	���Z��(�Zz�Z���Z!�[���3[!�Y[l�}[l��[��[ ��[�\hB!\hBC\Úf\W��\hB�\hB�\hB�\hB] �C]��m] ���]�z�]���]$��]Ú(�]�z^$�&^r�I^r�m^���^���^��^�6)@�z_�5_Z�V_Z��_���_���_��_!�6`�z` �,`��H`hBd`hB�`W��`T��`hB�`hBahB+ahBLaW�ua���aW�+o�{�a ��a �b�{b��(/b �Tb��wb�{�b��U�b���b���b��c��&c��UBc`{Pc��kc��chB�chB�cT��c��dhB;dhBbdhB�dhB�d���d���d��M�d��e�7eT�PWeP|ee0|se��e���ehB�ehB�e���e�#fhBBfhBefhB�fhB�f��f���f���f��PgP}g��@g�`g��sg��gT��g�D�g�)"E0}�gT�h��&h�<h��VhhBphhB�h��hߞ�hhB�hhBihB+ihBJi�li��i��i�9�i�~�i��ia�ja�$j��Cj��bjk�jV���j�~]q�~�jk��j���j���j��khB.khBLkߞkk=��khB�khB�khB�khBl��'l3�Dlߞ6[l�il3��li��li��l���l�(�lp
m��+m��Jm��fm��mhB�mhB�m=��m=�nhB<nhBdnhB�nhB�n���n��n�o��2ohBPohBro=��om��ohB�ohBphB#phBFp�kpO��p�?�p=��ph��p=�+<�qO�+q��Fqh�[q��tq��qhB�qhB�qm��q��rhB8rhB]rhB{rhB�r���r���r��s��#sm�(>s��Ls��lsL��sL��s���s���s��t��(/t��=t��dt��t��t���t��P�t`�u��.u0�Ou0�ru��u
�x�u ��@��u��u��v��6v�^v�wv���vhB�vhB�v���v��whB;whB`whB~whB�w��wP��w�@�wP�x��>xP�LSx��ixs��xhB�xhB�x���x���xhByhB=yhBXyhBwy���y��y��%�y��ys�z��z��.z��HzhBbzhB�z���z���zhB�zhB{hB{hB<{��\{��z{��@�{���{���{����{���{��|hB9|hB]|���|���|hB�|hB�|hB}hB=}��d}���}����}���}a��}����}a�$~��M~p�Ci~��(�~ ��~���~���~�����9��]���t���L�hB�hB����D�*�hBJ�hBn�hB��hB����ր����s��g=*�P�Lt�L��XƁX����D�Hn�����H���Ђ����	�_(�_J��j��������؃�̠("��0�W�s|��P&���s��݄�g=��L1�PH��c�hB~�hB��D������hB�hB#�hB?�hB_�P�����u߆u��#��I��m������������>��k����
ň
�Y!�D�(H��� V�Y{�����ȉ��l�(��� �?��b�hB��hB����Ԋۡ�hB'�hBR�hBv�hB��Ƌ2�2�2,�2Q���6p���~�2��HЌH�_2�_`�p��p��}�}��J��v�����Ў7��ʡ&�7M��r�������0+
�hB0�hBZ�ۡ�����hBސhB�hB3�hB^����"ȑ�2�"��A�0�\�ۡ���� ��M
� =�= k�  ���(��@�!Ó= �W !�@�<`?���<HZ�W ��!��!ߔ
#���<%�
#V�&��#���&וb&�&R&�`*	D�b&q��&��p&����&��'�'�3��'`�b(���(�����b(�S*�9�(@��N�S*{�i*��i*ؘ�*�a�Pl��#3��*h�0+����6ə��&י0+�U	�hB$�hBC��c�C���hB��hBɚhB�hB�0+/��,W�0+br��,��\-���,�͛\-���-)�`-ZI��-o�)/���-i��)/Мc/�0/3�c/.��0O�p/c��0���0���0)���0�J2
��0�+�J2P�m2s�P2���(�� ���m2��2�p2:1��(Y�Гg��2���2���24Ο7�(�P����2*�5U��2s�5���5��5�Π_�(��p���5��87��5�O���(o���}��8���8ˡ�8C��8�9(��8'<�9f�>�� 9�����`���̢�ڢ>���>��<`+���<H;��>]��?}��?���?ɣ�?��?��?B��Be��B���G���Gפ�I���&��IA��Mf��M��=P��=Pܥ�Q��Q.��SV�5�y��S��UϦ��ݦU���X�hB0�hBQ�C�s����hB��hBߧhB��hB�UJ�1Us�U!��1U��mUߨ@U-��mU#��VK�pU�f�C�P��Д���V��=XީW=���P���=XJ��Xs�@X����X���[êhBߪhB��� ��E�hBe�hB��hB��hBǫ�X�AY�AY'�ZI��(e� �s�Z��0Z��0Z��Z
��/��ZR��Zs��Z���Z���Zڭ�Z���Z��[;��[X�'\y�hB��hB������hB4�hB]�hB�hB���[ѯ�[���[!��[F��[r��[���[���[߰�[���[&�'\R��[Gq�0\���e��hB��hB����'�hBG�hBk�hB��hB��0\ʲM\�0\���g=�M\.�c\T��g=_��g=q�c\���]���]ֳ�]���]-��^[��^���^���^�_�_1�9_Y�9_���_���_ص'`�'`#�K`C�K`g�y`��y`���`ݶ�`��`'��`Z��`���`���`��`��`7��`a��`���`���`��`��`K��`~�a��a۹1a�1a/�QaW�Qa��qa��qaٺ�a��a3��aa��a���a���a��b��bB�[co�@����[c���c��c�1e:�1ep�Ue��Ue˽qe�qe��e6��ed��e���e��li�hB
�hB8��g����hBȿhB��hB%�hBT��e��_f���e��_f���f*�`f6I��fw�yh���f���g=��g=�yh(��h[��h���h���h��li�pi<�j]�hB~�hB��������hB�hBA�hBc�hB��pi���i���i�jI� j[�{q�hB��hB��������hB��hB�hB*�hBE� jh�Dj���g=���g=��Dj���k����<���(�0���k:��kV��k{��k���k���k��D�(����k7�l[�l�(���y�l��Bl����(��о��Bl�rl7���(T���b�rl���l���(����!���l��l@��(^�P�l��l��m��4�(��0���m�2m7�\�(\��j�2m��bm����(�����bm��m<���([�нi��m���m��Ԧ(�������m��m*���(G���I��mo�"n��$�(��p���"n��Rn�L�(>�P�L�Rno��n��t�(��0����n���n���( ��.��nR��nt�ħ(������n��o���(�м"�oH�Eol��(������Eo��uo��<�(����uo:��o_�d�(�p����o���o����(��P���o5�pa���(��0���p��5p��ܨ( ��".�5pR�ept��(�����ep���p��,�(�����p;��p^�T�(|������p��q��|�(����
�q9�Eqf���(��`� ��Eq��uq��̩(�@�+�uqH��qc��(y�(����q���q���(�����q(�rM�D�(m��{�r��5r��l�(��к��5r�er@���(a���o�er���r����(�������r��rO��(|�`�%���r���r���(��0�
��r4�%sY�4�(y����%s��Us��\�(�����Us"��sD���(a�йo��s���s����(�������s��s4�ԫ(R���`��s��t����(��p���t�Et&�$�(C�P�Q�Etv�ut��L�(��0���ut���t�t�(.��<��tc��t����(������t��u�Ĭ(%�и3�uU�5uu��(������5u��eu���(����	�eu(��uE�<�(]���k��u���u��d�(��p����u��v#���(H�P�V�v��av����(��0���av��v0�ܭ(T��b��v��w���(�����w�Qw9�,�(]�зk�Qw���w��T�(�������w��w8�|�(Z���h��w��x����(��p���x�Ux'�̮(I�P�W�Ux���x���(��0����x	��x3��(X��f��x��y��D�(�����y�UyB�l�(�2жg�Uy���y����(�������y���y����(�����y6�{Q��(g���u�{��G���hB��hB�����=�hB`�hB��hB��hB��{��|%�{�D�P~[Z���lt�������|��|����(������|��|<��|b��|���|��q}���|���q}��};��}VZ�4�(�������}��G~��}g4�G~Y���|��	��\�P���������������!���J��q����������/��/�>�b�c�b���������G����(=���!K�P�f�H���hB��hB�������hB6�hB]�hB}�hB��P�������P�����.�`�R��`i��(������`���ƞ��`�f��ƞ���=�О�T�
�(r���������פ����7|���	��5����@� 
����`� )�פP�2�u���6���#��2���H���P��߸�hB4�hBN��i�
���hB��hB��hB�hB�P��	�)<P��*��?�	�Z�a�s�a����������߸�������
�D�hBi�hB��
���]��hB�hB@�hBf�hB����7����W$�7�_�`���@� �`��u��`�7�u�c�¹����B��¹�*��йZG�*�s�i���0�9��p�����
�(�i�9���e�5�(���������
����]�#�hB>�hB]�]�}����hB��hB�hB��hB��8�t�8+�dO�8h=[�0h=i�,h=u�	i=�������t���������]�������=���R�k�n����������W��y�(��8����/�4h=/�:n�Zn�t޿�i=�(h=���(�����޿�����(ɲI��k`�� h=�`��'��`���h=h=h=-@h=�:ײ(T �b'��q��q��y�y�58�d8��������������0��H_�^��(o��	}_�����`�{�h=�'�'�������N-�|N�(���!�-��>�>�#a�Cv�(^p�la�������� � �3I�X��(xP��I��k��k�������]�4ƳQ]�{4��Գ�4����	��	]�2	`�J	��f	hB�	hB�	��	2��	hB
hB,
hBI
hBj
`��
���
`�!�
���
���
��#�
����#��-�P>@�
L��t�������������$��E��o����W��W�
��=
��U
��q
hB�
hB�
2��
Z��
hBhB7hBThBu�����������~�>���R~�xG������G��q��P�!q�C��s��W����9����Y2�()��79�Z��{@�N����+��+�}�/}�_���������hB�hB	Z�-O�UhBxhB�hB�hB�����+��A��iS���S� i=�S��s�`�s�N����$�8i=�Z�(���$
��<��l��$���(�0�������"���Ai=b��}�������������i�0
�R0i=h���
�������P�P���6��h��������.6�e6��d���(��$d�5��eA�����A��Ci=�A���A��R,�ghB|hB�O��ǵ�hB�hBhBhB3��Y��}O�(����������&�&�@F�_F����������������w�(/��=��a�����(������������ � �> ��[ ��z ,�� 0�� [�� hB� hB� ǵ
!2�)!hBC!hBa!hBx!hB�!ǵ�!��!ǵ+���!0�"{�."�(A"8�O"{�l"���"���"���"�x�"(��"���"��#��4#�N#�k#D��#����#��#D��#[��#`��#��$hB,$hBG$2�c$@��$hB�$hB�$hB�$hB�$`�%5�%%`��1%x�?%2�R%5�i%��~%���%���%���%g��%hB
&hB.&@�S&@�|&hB�&hB�&hB�&hB'��.'�L'�i'g��'p��'���'hB�'hB�'@��'Q�(hB0(hBN(hBe(hB�(p��(_��(p���(@�)_�>)=�g)`���)=��)`��)@�!�)`��)��*�!
*��'*��B*�I*��i*���*��*���*��*��*W�+W�C+w�e+w��+���+���+��+hB�+hB	,Q�$,��C,hB],hB{,hB�,hB�,���,=�
-���/-Q�(X-��f-=��-��-y�x�-���-�.��8.�(V.��d.���.���.�P�.p��.��/�./i��H/P�V/0�d/��/�/��/9�@�/�/�
f��0y��20�
V0�
x0A�PBc���0�
�0��0�1\%1\K1�o1�1�1hB�1hB�1���1���1hB
2hB)2hB>2hBW2�t2�2��(�20��2�2��2hB3hB:3��a3��3hB�3hB�3hB�3hB&4H4�h4��(�4p��4��4��4��4 
5hB 5hB:5�U5��t5hB�5hB�5hB�5hB�5�6�06�+K6��Y6�u6�a����6�u�6��
�6��6��6�*7U7~7[�7[�7p�7p8�!8�I8�o8��8	�8	�8F�8��J�8F9�-9˾MB9�a9�~9�O�9��9��9g�G�9�:�0:��MK:�f:v:����:���:v�:��:��:(;(<;F[;F�;^�;��G�;^�;p<pC<�k<�(A"���<��<��<�(�<p��<�=A7=AU=q=�=)�=)�=9�=9 >pC>,�(a>P�o>p�>��>��>�>T�<�>0�?7? `?��n? �?�!�?hB�?hB�?��	@�0@hBR@hBx@hB�@hB�@ �@!A��P.A��<Ap�JA!qA�!�A�(�AP��A�!�A�%�AhB
BhB+B�JBL�mBhB�BhB�BhB�BhB�B�!C�"#CHi=.C�EC�"gC�"�C�#��C�"�C##�C##D�#+D�HD�#gD^$�D^$�Dw$�Dw$�D�$EPi="E�$CE�%bE$�({E���E�%�E�%�EhB�EhB�EL��EL�FhB5FhBSFhBjFhB�F�%�F�%�F�%�F�%�F�%GJGhB5GhBSGL�rG,��GhB�GhB�GhB�GhBH�%6H&��%[H&�H$&<�&�H$&�H�'IL�(ȴ0�*I�'VI~(�I�'��It�(l���I~(�I�)J�(Z7J�)eJ"*�J�)B�J"*�J�+�J0*�K���3K`�AK�+jK-�K��(�KP��K-�KG.!LG.FLk.iLk.�L~.�L~.�L,0M,0-M5WM��P|M���M��!�M5�M�6�M 5mN�(,N �:N�6eN�6�N�6H�N�6�N7�N7%OD9LO,�PnO��|OD9�O8:�O8:�O�<P|�3P�<_P�=�P���P�=�P
?�P
?Q�?6Q��(PQ��^Q�?�Q�@�Q�@�QBR��(&R`�4RBcR1B�R1B�R�C�R@BU�R��(S��S�C5S�CRS�C�S�D�S$�(�S��S�D
T�D1T�D\T?E�TL�(�T���T?E�T�EUt�( U��.U�EWUAF~UAF�UG�U��(�U@��UG*VHTV���yV���VH�V�H�V�HW�H)W�HMW�IoW��P�W@��W�I�WJ�W�(X �XJ&X�P?XhBXXhBuX,��XG��XhB�XhB�XhB
YhB+YJLY$JkYJ}Yxi=�Y,��YW��Y,�+�YH�	Z$J7Z�KcZ0J��ZW�-�1`��Z�K�Z�L�Z�K�[�L<[�Ma[�L y[�i=�[�i=�[�i=�[pi=�[��!�[�M�[N"\��C\Na\wO}\��l�\8��\wO�\�O�\�(� ��\�O]�P9]ti=P]`i=]]�Pn]nQ�]hB�]hB�]G��]G��]hB^hB^hB5^hBO^�Pn^�P�^���^�P�^Q�^Q�^SQ_SQ_nQ0_pQF_�[`_hBz_BC�_G��_5��_hB�_hB`hB5`hBT`pQs`R�`pQ��`l=�`�k=�`�i=�`G�=�`R�`�Ral=*a�k=<al=Ia��bapBwa�B�a�R�auS�a���auS�a�Sb��(<b�Jb�SsbnT�b��P�b���bnT�b�Tc�T,cUSc�(uc���cU�cUU�c@�(�c��dUU&d�UJd�Uid"V�d$l=�d�k=�d l=�d"V�d�Y�d0V�e�k= el=0eh�Fe�Ybe�Y|e�Y�eZ�eZ�eFZ�eFZf�Zf�Z:f�ZVf��xmf�{f�B�f0C�f��(�f&��f0C�fBC�f�Z g[Fg[mg@[�g@[�g�[�g'��g�[h<g hBC<hBC\h5�}h^��hhB�hhB�hhBihB$i�[Fi�[fi�[Wyi�[�i^�i�[�i^�i�_j^�j�_3jfVj�_Dlj5�)�jf�jf�jf�j.fk.f<k<g_k@gskLk�kBC�kBC�k^��k5��khBlhB9lhBRlhBol@g�l�g�l^�<�lp��l�g�lFh�l��6m`�mFh-mghEm��Wmghpm�h�m���m�h�m�i�m���m�in�i0n�iOnjlnj�n,j�n,j�nLk�n��8oP�oPk&o�BoBC^oBC~o5��oT��ohB�ohBphB%phBFpPkup�k�pPkV�p�k�plq�k^>qlpq�l�ql��q�l�qLm!r�l|Br(l=PrLm}rn�rPm��r5�(�r ��rnsYp:s n9Ls]�"fs��s���s�+U@�	�sYp�s�p t`pnIt�pzt<q�t�pl�t��"�t��-u��cu��+�u���u<q�u�q�u@q|v�qv�r3v�q�>v�rvv�s�v�r�v��w�s)w�sJw�svw�s�w�s�wt�w�(�w��xt'x�tGx-�(bxp�px�t�x
v�xU�P�xP��x
vy�v;y��<`Uy�v�yw�y���ywz�y?zw�^z���z�y�zkz�zkz{}z5{}zd{�z�{�z�{{�{{|8{5|8{b|s}�|@{3�|��3�|s}}G~/}��-�<�Q}G~s}s~�}s~�}�~�}'�(�>��~�~:~�d~O��~��~��~��#�F�g����BC�BC�T����A�hBg�hB��hB��hBۀ����#���9���:C�`�BK����R�`��Y���_��Bf���n�����)�΁)�����,�0�`M���z�������ӂÁ��Á-��Y����	���	�փ����+�(�U�(���<���<�؄H��H�1�~�]�T���~�����݅i����-���U�����ɂ��ɂֆ؂�؂.��Y����������ۇ���.�0�U�~�v�0�����؈�����/�j�Y�j���������������3���j�x������NJ����x�"�/�K�/�������������:���i�6�����*��6��h��h�Q�a���a�����Ѝ�|�������&��L��~��������9��9�C��p� ���[���BCՏBC����$���P�hBw�hB��hBƐhB� ����� ��(���F���b����q���x�@��� �<���������ؑ���[�(�`�0���9��>� �C���K�y�U��a�`�v�8���BC��BCŒ�����hB"�hBC�hB]�hB{�`���H�ӓ`���H����9�P�gO���p������(z�0l=����-���Ȕ��ѫ��@l=�ѫ.�_�w,	8l=L�_�f�0�~�0���Y�������Y�ҕ������������$���2���I�ձ^���m�ձ����������������Җ����г�гD��j������ʗ����#�.�#�_�X���X���l��l�$���V�����ȴ��ȴ�ܴ�ܴH��x����8�֚@��=��BC#�BCB��b����hB��hBțhB�hB�@�#���@�@�zP���k���������=���@�ΜW��BC��BC��7���X�hBt�hB��hB��hBʝ@��E��@�"�E�>�B�X�P��e��y�B�������P�P��_=ƞ_=Ҟ_=ߞ����5���@R��q�-����M��jl=���l=��-�ҟV��0�&	�il=��8�V�`�{���`���xl=��pl=Ƞ{�������.���6���Y���o����F��m�l=��hl=��F�ܡW��F��W�H�h�q�W���������c�`=3<	�`=��`=���ۢ���h�
�@����`=���=�q�Y����h�@�(����q��������cȣ��}�����}�,�|�H����W�dl=�kl=e�h�|�|���������6Ѥ������@`= 0��V���z� `= ������!�ޥ�!��`= �v�&�U�;�U�Y�/�u�/���m�Ǧ/�>�!���'��0��(�m� >���U�i�j� _=(|�'�������0��ѧ`l=ߧi�#�����'�B�'�h�W���W�����ڨ`�'����l�#�`_=(7�l�M�L�a��_=(r�L���,����l=(��,�ө<��<��g�8�g�Z�|�z�|���������������,���N���r�����������֫��2����>�;�>�_�Z���Z�����Ǭ������>�A�i�A���\���\�ܭ��������7��e�����������ٮ���'�)�'�T�<�}�<��������ǯ����������W�1����>���S�`�f���}�BC��BC����˰��hB�hB%�hB=�hBY�`�y������� ����Ա���	�3��3�w�P�<�Hg��u�w��������rȲ���������8���R���p�BC��BC���ӳ���hB�hBB�hBa�hB����������̴��޴4��BC
�BC$��?�T�^�hBx�hB��hB��hBȵ��ߵN���(�H�N�(�4�=�,�(L�@Z�@�p�Z���BC��BC¶T��b��hB"�hBD�hB_�hB~�@�����·�����������8�T�O��r�����k��
������͸J�������J�1�`�Q�`�v�������P��PĹ������$�Z�B��PZ�ph�`�������BCʺBC�b��b�B�hBh�hB��hB��hBܻ`���J��`��.�J�P���p�@~�0����������BCӼBC�b��w�0�hBM�hBn�hB��hB��������ֽb�������
�^)�BCE�BCe�w������hB˾hB�hB�hB-���O��o���.�������¿��Կw����
���+���	<���Z���v�������
��������������������;�8���{I�;�g�����@�������������#����
��
��
������
���6�-�V���mi�-���������o������E��8�"�E�L�y�t�y��������������.��F�#;�.�f�f���0�6��f������������A���c�a��i�'��a��x����0�x+�^M���Aj�`����BC��BC�����p��hB+�hBL�hBf�hB��`�����`=����0��sL��`=i��Oa������� ��(��L��s�����������`=��P����)��S��~�����������3��U�	u�	��6	>	�l=��^�(�����6	�8
'��l=<���(���W�8
s����@
P����9�� 
��������*!�*E��g��������U������������0���JO��m�_m����_�����H�(������
��9��R��o�BC��BC��p�������hB�hB;�hBY�hB{�������a=��p�T��������3��C�eW�BCk�BC����������hB��hB��hB�hB��8��S� m=[�m=d���y����������N�m=��l=���5�NV�{u�{�����������.9�.V�>q�>��N��N����P��A�eh�����p��C'��BC��BC������~��hB'�hBC�hBX�hBq�p��w��p��w������
�����<��fU��x���������(�"������n����p!1��(��J�np����>��o������9 ��9 �W @�W b�!���(��0��!���!��.�(�f��!!�"@�"f��"���"���"���"���"
��"/�q#R�q#r��#���#��]$��]$��i$�i$9��$^��$}�%��V�(�����%��J%�J%/��%L��%d�3&z�3&���&���&���&���&��C'�P'3�q.N�BCi�BC��~���$���hB��hB�hB*�hBJ�P'j��*��~����*��+��+��W+�W+?�.^����w�@�� ��.��B.��B.��q.��.*��0E�BC`�BC�$���t���hB��hB�hB!�hBA��.f��.���.���.���.���.���.$��.I��.Pa��.��4/��4/��H0�����$�(�H04��0M�L�(`��n��<0��0���6��BC��BC��t������hB$�hBA�hBW�hBq��0���0���0B��t�������t�+<���0��L2��1L����L26��2P��2m�"3��"3��f3��f3��4�����4#��4>���S��4t��5���5���5���5��P6�����P64��6S���l��6���6���6��/9��BC��BC���'���J�hBh�hB��hB��hB���6��C7��6c�C76��7Q��7t�'8��'8��_8��_8��/9�09&��9=�BCT�BCo���������hB��hB��hB��hB�090�g9E�g9\��9q�:��OB��BC��BC������B���hB�hB+�hB@�hBY�:r�i<���
��i<���<���<��>������(�>;� >V� >p�`>��`>��OB���
����P��PB���E
�BC*�BCK�B�m�B���hB��hB��hB��hB�PBB��Ci��C���E���E���G��BC�BC%�B�E�X�i�hB��hB��hB��hB���E�$G#�B�:�$GU�QGn�QG���G���G���I��BC��BC�X�5���X�hBv�hB��hB��hB���G��-H��G}$�X�=�-H\��Hy�f�(A"p���H���I����P��P��@��I&��IE��IX��Ko�BC��BC���������hB��hB�hB/�hBK��Ig�K��`m=��Xm=��@m=������K�^K�^K��K*��K:�YON�BCb�BCz���������hB�hB�hB��hB��K*�	L@���P�	Li�pL�����pL���L���L��L��L��L'��LE��La��Lz�M���(�� 
��M��M��M�	N*�	NE�YO^�A�Dq��`O��7S��BC��BC�������hB�hB9�hBN�hBg�`O~��O��`Oz���m=��pm=���O�ZP��Oz�xm=�hm=�ZP��P%��P?�SQW�SQq��Q���Q���R���R�7S�@S�{W�BC1�BCM���j�����hB��hB�hB�hB��@S$�ESI�@Sa�ES��US��PS�US��S��S"��S=���(R�p`��S��S����(��`���S��T���T�T7�Td�T��T�$U�$U�UI��r�U��U��U��V��V+KWXKW�YW�YW�{W��W	]&BCCBCd���w��hB�hB�hBhB2�WT�Xt�WK���a�p��X��Y��X��Y+3ZM�[G�(w3Z��Z�o�x����Z�Z0��(OP]�Z�[��(J,0�[>[37�(`&n>[�e[�_�P���e[��[��(3�A�[d	\���P���	\��\�'�(	�	�\D	�\q	�\�	�\�	O�(�	`
�\+
]T
]n
C`�
BC�
BC�
w��
)�hB8hB^hB}hB�]�@]�]0�w�D@]qs]�@]3����s]
)^'
��(D
�R
)^v
^^�
��P�
��
^^�
~^,�(Z�'h~^��^�9�(�P��^_<a�(^0l_�G_���(��G_��_��(:�H�_k�_���(�F���_� ` `2C`\�(���P`�i�BC�BC)�/��WhBzhB�hB�hB�P`�`5P`�O�`|�a��`���a��b-�aS�bw�b��b�c�cme)meVvf�)�i�p�vf��g��m=�g6Fh_���Fh�i� i�vBC7BCX��z���hB�hB�hBhB& iH.ih i{.i��i�0i����i�i5�iQ�iy�j��i������jIl*�jYE��(��gIl�m�Pl������(�m qnJ0X	�(|qn��o��n"�1�(�p	�o,NrM�o�a�oY�(���Nr��s��s�s<�s`�s��s�v� v�h}�BCBC8��Y��~hB�hB�hB�hB v0�v^ v��v�|��v�|�S| S|D �|g �|� !}� !}� h}� p}!n�!BC6!BCQ!��m!���!hB�!hB�!hB�!hB�!p}!"x}E"p}\"x}�"�}�"�}!�"�}�"�}#�}"6#�}_#!~�#�}A�#!~�#{�#0~K
${,$�L$�-_$��$w��$���$��(�$�"�$w�%Ѐ9%ЀZ%�y%��%���%��(�%`#�%��&
�/&
�\&��&��&-��&-�'?�!'?�A'��_'��Pa�#x'���'���'���'�(�2(A�N(A�t(l��(P��(l��(��)��3)��])���)���)��!�)��*�>*�n*��*��*W��*W�+ʄ@+ʄf+2��+Єb�+2��+م�+@��,!�",م=,'�[,'��,D��,D��,���,��-چC-��\-چy-~��-~��-F��-F��-��.@#".C�@@.��].�x.��.��.��.I�/I�7/��R/��o/��/��/Q��/Q��/�� 0��B0	�b0	��0#��0#��0ێ�0ێ14�@14�n1���1��(�1 #�1���1�2�A28�g28��2u��2u��2��2�3̓;3��Q3��(o3�!}3̓�3��3��3�4��P04#>4�c4���4#�(�4�"�4���4��4K�(5�"5�>5��`5s�(���"}5���5��5��xT�`"�5�6[�:6[�X6�t6�(�6H"�6��6Y��6Y�7ߙ%7ߙI7-�k7;�(��0"�7-��7t��7t�8ɚ*8ɚP8�t8��8R��8c�(�8 "�8R��8��9��(09">9��k9���9���9��9��9�:�=:��`:���:n��:p��:��:BC;BCH;��s;+��;hB�;hB�;hB!<hBL<p�x<��<p���<��<�= ��2=��xV=P$d=0$r=p$�=��=���=��>��<>Ӥh>Ӥ�>��>��>(�?BC6?BC`?+��?��?hB�?hB@hB9@hBd@��@���@���@��AȦ-A��JAȦvA٩�AЦ	�A+��@X`%�A%�A %@%�A٩2B�eB�
�B��(�B�%&�B��B� C�QC(��C0��C���CBC�CBCD�%D��NDhBrDhB�DhB�DhB�D0�E{�*E0�KAE�x_E &mE{��E���E���E���E�%F��(EF@&SF�{F4��F4��Fl��Fl�#G��MG��xG���G���G���GBC�GBCH��7Hs�]HhB~HhB�HhB�HhB�H��I�EI��AhI��I��I��I�'�I��P�I�Jc�-J�cAJ(OJ�@jJ�'xJc��J̳�Jp�\�J̳K��%Kг�=KK�(\K0(jK���K��K��A�K��KٵL��>LٵcL��L��L���L���L��M��8M��VMBCtMBC�Ms��M���MhBNhB(NhBGNhBjN���N.��N����N.��NT��N0�$Os�P'O�*5OT�YOT�{O`���O��P�O�*�OT��O�P`��P��1Pp*?P�*MP�qP��P ���P�(�P�*�P�QM�6Q�mZQ3�(�Q@*$�QM��Q���QP���Q[�(R *$R��IR�lR��R��(�R*�R��R���R+S��8%S��=S��YSBCuSBC�S���Ss��ShB�ShBThB<ThB]T���TP��T����T��P�T,�TP�Ug�>UP�TU3��qU0,Ug��U��Up��X5�+�U���V�+V��RV ��lV���V���V���V���V��WC�(WBCDWBCdWs��Ws��WhB�WhB�WhBXhB,X��NX��nX���X���X��X���X��X1�&Y�!@Y1�iY���Y���YC��YP�Z��*ZBCLZBCrZs��Z���ZhB�ZhB[hB7[hB^[P��[���[P�1�[���[��\��5\s�(U\�,c\���\���\���\��]��']F�C]BC_]BC]���]��]hB�]hB	^hB&^hBG^��i^���^��/�^���^B��^B�_��"_P�W5_��O_��q_q��_����_�.�_q��_o��_���`o�9`B�b`��(�`�.�`B��`���`��(�``.�`��)a��Sa�(wa@.�a���aF��aP��az��aBCbBC;b�\ba��bhB�bhB�bhB�bhBcP�%c��EcP�VXc��zc���c����c�P�cP/�c���cz�d��6d��UdBCtdBC�da��dQ��dhBehB-ehBMehBqe���e{��e����e{�	f8�,f���Bfa��_f@0�i 0mf8��f���f���fu��fBCgBC-gQ�Ogy�ughB�ghB�ghB�ghB�g��h��?h���Sh��yh��h��1�h��h���h��iQ�('ip05i��\ix��i����ix��iC��iC�ju�)j��Fj��gjBC�jBC�jy��j��jhB"khBKkhBmkhB�k���k���k��Yl��Hl��yl����l���l��m��@m��im���m���m��9�m���mA��m�Any�(��1nA�Bn��dnP�tyn���n	��n���n	�o��;o��PZo�1ho���o���o�(�o�1�o��pk�Fpk�wp���p���p��pBC�pBCq�Aq��hqhB�qhB�qhB�qhB�q��r��>r��1Vr��{r��r��B�r��r���r�ss�(+s29s��ksr��sr��s��sA�Pt02t �-t�MtBCmtBC�t���tC��thBuhB+uhBLuhBqu ��uX��u �8�uX�v��:v`�c`v���v���v����v���v��w��.w��Rw��tw���H��4�w���w���w��6�w��x+�4x�+Ex+�ex��x0���x����x5�x��x��y �~y@5)y1�:Gy`5Uy 5cy���y���y����yk�(�y�5�y��z�,z�5:z��8Qz�yz9��z�(���4�z9��z�{�P���4>{�W{�t{BC�{BC�{C��{k��{hB|hB@|hB^|hB�|��|
��|�:#}
�F}��g}��{}���}1�}1�}1~�.~@qI~�l~��~�2�~C�(�006�~��~��/�T�w����=�=J�]w�]���ۀ���
�BC(�BCG�k�g����hB��hB́hB�hB	��*�`I���[�`��z��`ڂz
��8��Y�k�P��`8������̓�Yރ���,��<0���I�,m����0����(�� 8΄��	�	#�	D��
c�	�u�����@8���
��U�U	�d0�d]�������\��BCՆBC����8�hBW�hBz�hB��hB�������d5��V�ku�
k��k���Ɉpk܈���\�0�8�`9�pX�BCw�BC�������hB	�hB0�hBP�hBt�`�����`BՊ������$��I�Ql�����Q����`1��+�pP�ph����BC��BC�������hB&�hBJ�hBg�hB��p���̍pI��9���0��CC���8$:]���~����(�� :͎~�����H��q��������ӏQ:�BC��BC���4��S�hBm�hB��hB��hB����^����^:��]�`Os���xP�`@������Xv�ő��>
��n#�!�(A��@O�>y����@`�����
��#��m=7��`��������m=�������2��P��l�I�(���@�����	ɔ	��2�bM�q�(c��@q�b������ݕ������=��`��������ϖ���5�3W�3��I��I֗�����1��M��m=_��m=m������֘����-� Y����� ��� ֙� �� 2���Z�� }�Z!��Z!��|!��(���?�|!'�{"@��!�L��PF�@`�{"y��"��A�(���@
���"ƛ�"ڛ�"��Y#�Y#8��#T��#v�$���#s��$ǜ�$��$���$��$8��$W��${��$���$ĝG%�G%
�q%/�q%T��%w�i�P���?���%��'ݞ�%/���P��@�'*�9'A�9'a�q'�	(���@��q'Ÿ�'ܟ�'+��'�V(#�V(P��({��(��@)٠1�@)*�a*P�?^q�p?�a*��8,ѡ�^�P?� ?"�8,7��/\��m=x�����@@���/Ţi0��b��0@�i0+��1L���h��?v�@���1��x2���(̣@ڣx2��2$��2O��2x��2��r3���(դ�>�r3��3��3F��4k�(���>
���4���4ߥ�4���4��4L��4y��4��M5��M5ݦY5�Y5+��5S�6(wa�>v��5���5���5ݧ6��6!��6D��6f��6���6��7̨7�:�^� ��?.�:U�):z�):��Q:ԩ`:�);
�BC'�BCH��j�'��hB��hB֪hB�hB�`:7��:V��-o��:��);��);ͫ);�BC�BC7�'^�'��hB��hB٬hB��hB#�0;?�<_�BC�BC��'ȭ'�hB�hB=�hB^�hB��0;���;���;��;��;"�<A� <b�tA��BC��BCկ'���-�hBV�hB��hB��hBӰ <��<5� <�X��<���=���<&±'I�pC��=�>)��=7�>T��?o�p)���?��>@̲��>@��@A�PCO��@x�tA�����tA�tA�BC(�BCP��y����hBδhB��hB�hBH�tA_�tAz�BC��BC���Ե���hB�hB:�hBV�hBv�tA��tA��BCɶBC����2�hBS�hBx�hB��hB���AзeG�BC�BC(��I��n�hB��hB��hBϸhB��A��A.��A;?��Ac�kB���&��kBǹ/C��	�/C+�kDK��Re�kD���E��L'ʺ�E��eG �s�<�DR��DD�eG]�eGz�BC��BC���ڻ��hB!�hBF�hBd�hB��pG���]��BCӼBC���6�hBU�hBx�hB��hB��pG��G
�pG�'��GL�Ho�H��H���HѾ�H*��H
�7I)��H�;��(U�Mc�7I��"J��@I���"J׿\K��0J,�!x.��L<�\Kd�iL��`K	��iL��L�pL ��('�pL5��L]��L���LF���L�qM��L���qM�KQ=��M�O�KQu��Q���Q��R��R���R��R8�(ZU��Pm� M{�@M��(Z���Z���L��P���Z�[6��LD�aP\�[���\���L���P���\���\!��\L��\u��\���]���]���]��]��a5�BCN�BCk���Q��hB��hB��hB�hB!��]G�g^k��]w��g^���^��p^���^$�_H��^�_�_���_���_���_���_�a�a=�aY�a{�ga��(���M��ga���a�)(4��MB��aQ��ed�BCw�BC��Q��#	��hB��hB��hB�hB ��aL��av��a	���a��*b��b*���m=��*b�Ub%�Q5�UbW��bw�p���b���b���b���c��m= ��(<�POJ��cd��c|��c��d��d��,d��,d�Hd&�Hd>��dT�n=d��D�@O	u��d��e��e���eH�0O���(���e��*�BCC�BC`�#	~����hB��hB��hB��hB��e:�qf\��e�q�`n=��#	��qf��5g���f�
�5g>��gm�@g����g��rh���g���rh	��h&��h6�1	N��hx��h���hG��?	(���V��g	��	6�g	+T�pUb��h��i���h(��pn=���	��i��i9� i�I��ip��k���i���@n=��0n=��Pn=��	-6��k^�l��l��Al���	(���V
��Al��im�Pl2�n=C��n=J�imf��m���m��n���	��n
��o#�xn=8��nMR��	Pf��Vt��o���o���o��jp�� n=�J
(�pV+�jpK��pi�r
x^�PV���p��q��q��Zq���
(�0V%�ZqM��rs��<�V���r���r���r���r(��r_��r���r,������r��r:��rn�,s��s,�����,s �;sL�;sy��s���s���s���s.��s\��P���U!���s��Pt��Pt��|t�Pt,:��]�|t}��t���t��$u���t4��3�$u^�<u��<u��iu��@u)��K�iur��u���u���u���u�nv�nv8��vS��v��@w��@w��ew	�ew-��xO��x��x���x,�����x�y9�yg�Ly�� y,��	��Ly��y1��yU�6zw�6z��I{��@z	��I{�D|#�P{�3�D|]��|���|��~��~��P~�P~@��~g�P~2�����~��w��w��+��[�"����2����"��������L�Ԁ{���4����Ԁ��,��(]��UB�,�_�_�z�_�������`�2��E���+���N���������2��J����f�2�f�[�����p�2��O������������>��k�2����2��T��2��������D��n���,��Y����������,�H��,f�^��,���9���9���P��P�:�i�`�i�������c(���U�����������<�7�^�7�����������������6���!���<���\��z����%���%������������<���`���|�̒��̒�������������'��L��u�����������������N�#�~����#���@���@���7��W��u����l���BC�BC����%�hBD�hBg�hB��hB�������������.���G���=V��(v��[����������2���*�2��:O�*�n�ę��0����Ц������ę�r��Й�)��K�r�q�Y��������Hb=������Ȏ=�
(�p[�Y�.���X�`�9u��n=������%�����	��=�%�L���}�0�c��:
(��Z$�������9��n=��n= ��n=$��n==�b
�Q�@[_�([m�X[{���������Y���-�-��=I�-�o���������^��^����3���Z����̎=��:K��[��������=��Z,��a�U���U���������.e�T�ue��Υ��f��Z�ΥЦEЦ`X�yX��������l��Nv�Z"p�:
�VBCrBC����hB�hBhB9hBZp����p�B����.���P\.�Bj�cj��
����׶�BC�BC�'hB>hBYhBmhB�����c��s����DZ�DZ�ٱб	4ٱNԳfԳ����	���C��C�Y�;P�	RY�p׶������BC�BC��hB#hB>hBRhB����c��2j�������������	���
	��%	��I	��k	��	�	���	��	��	��	�	
�/
��K
��^
E�u
BC�
BC�
�
,�
hB�
hBhB5hBQ��m���(�]
����+��`b=(�<(]!+�<N�Ud(h�\vN������P��\������
�(3
�\A
��n
��
(�
�\�
��
/�/� 9�>9�hE��P�����BC�BC�,|(hBChBbhBzhB�P�����,P`]��,f�MBCnBC�|�5�hBhB1hBShBy�������������G��n����������|��P_���
��+��P?Dgo�D+�0_����|�����o3|�U��u����(��^���������U�('p_5��Yh�{�h��(�_�h����p�m6��[�~��<@����6�
6�?I�oI��f��p����BC2BCW5}�hB�hB�hBhB=p�d|��p��|�������	���,��`��
���������S���3�=�3^3�����@�n���������C��6��V��i5f��`���������_�����9��P��u?���<@��(��`�?�V�4V�f����(��`#�����2�(]@`$k������BC�BC� �? hBd hB� hB� hB� ��� ��#!��<!��a!���!���!���!	�"�	."	�R"/�t"��"�"/��"V��"0�&#!$#V�G#��h#`�#|#/�#���#���#��3�#=6�a$��9$K�^$��{v$s�$K��$���$�b=@�$��%u�3%BCQ%BCs%��%��%hB�%hB&hB$&hBG&��k&���&���&���&���&���&��!'��R'��v'��'��'��'���'��
(�� (�7(��W(��u(���(c��(��s�(�>�(�b�(c�)u�6)p�H)c=@b)���)U��)BC�)BC*�/*�`*hB�*hB�*hB�*hB+��A+��n+���+���+���+���+��&,��O,��k,���,���,��	-��A-��l-���-���-;��-��k.;�/.E�Y.@�v.E��.U��.P��.pc=/�c=@,/`�E/��b/BC/BC�/��/��/hB	0hB.0hBL0hBn0`��0���0`�9�0`c�0���0��1��11��J1�j1���1���1���1���1���1��2��92�Z2�w2 ��2 ��2���2���2�3BC3BC63�T3�v3hB�3hB�3hB�3hB�3��4��4��74�P4�k4��4 ��4a��4BC�4BC�4�5�(5hBE5hBf5hB�5hB�5 ��5���5�(�5�c
�5��	6��#6��?6��Y6��s6)��6)��6a��6�=�6p��6��7BC!7BC?7�^7��7hB�7hB�7hB�7hB�7p�8��78p�VG8��n8��8��D�8��8���8 ���8��8��%9��J9��k9.��9��9.��9���9���9P�:3:P�T:i�s:�:i��:���:���:=�;=�>;=�g;B�;=��;���;a"�;��<��3<��Y<��}<���<7��<BC�<BC�<�=�'=hBE=hBg=hB�=hB�=���=��=�>�'>`�I>`�o>���>���>7��>��>@��>�?BC?BC/?�G?�c?hBz?hB�?hB�?hB�?@��?���?��@��-@��H@�a@�}@2��@hi
�@��@2��@s��@�	As�)A��GA��gA�e�Pi�A��A��A���A��B�+B�NBD�oBD��B���B���B�C�+C��QC��pC��C0i�C�<�C��C�DiD�0DQ�HD.(b�i[DQ�vD��DVP�D�h�D��D��D�E-E�(EE�hSErE[�E�(=��h�E[�E�EF�F�7F�RF�kF��F��F���F�i�F�F�G�'G�NG�sG��G�G�Gd�G@i�GHd+H�CH�^H}
wH>�H}
�HG�HG�H�I�"IAIaI/I/�I��I��I�J�c=J�:JnTJntJ��JL(��h�J��Jk�JkK�?K�`K�K��K�K�K��K�Ll3LlTL�sLt(�M�h�L��L�LBC�LBC	M�-MUMhBxMhB�MhB�MhB�M�	N�-N�DN�jN�N�N�N4�N 	O4,O�MO@�aO���O�6�O��O�
P�;P�XPlsPl�P��P�j�P�
Q	9Q	gQ�Q�Q)�Q)R�R0T'R�DR�_R�(tRk�R��R�R�R#�R#S5HS5uS�S�=�S�S �S|TBCTBC5TQTqThB�ThB�ThB�ThB�T �TkUk7USUsU|�U��U�2�UBC�UBC�U	Vw)VhBDVhBcVhB{VhB�V��V��V��V�W�EW�_W��W��W���Wx�pn�W��WX/X8NX8mXO�XO�X��X��X�&Y�BY�\Y�zY+ �Y+ �Y@ ��0 �Y@ ZM <ZM lZ] �Z] �Zk �Zk ![� R[p 5v[� �[� �[� �[� $\� X\!�\� /�\!�\ !] !"]Q!=]Q!\]�!y]�!�]�!�]�!�]�!
^�!?^"o^�!!�^"�^"�^" _O"T_ "/{_O"�_k"�_P"	`k"7`{"c`{"�`�"�`�(��n�`�"�`b#�`b#a�#"a�#Ca�#ba�#�ar$�ar$�a�$�a�$�a�$b�$Ib$%vb$%�bQ%�bQ%�b�%"c�%@c<&\c�(sc�n�c<&�c�&�c@&s�c�(�c�nd�&#d'Ad'_d9'{d9'�dT'�dT'�d�'�d`'re�';e"(J��'B_e"(}ek(�ek(�e�(�e�(f*;fhYfPngf*�f�*�fv9�f0n�f�*�fa+g�PtR n2ga+^g�+�g�+�g\,�g�(on�g\,hp,1h`,Ohp,xh�,�h�,�h�,�h�,!i�,Gi�,ki�,�i8-�i'(�i�m �i8-#js-Gj@-3^js-�j�-�j�-�jn.kO( k�m.kn.Tk�.xkp.�k�.�kF1�kF1�k�1l�1<l~2cl~2�l�2�l�2�lu4�lBC
mBC/mwRmwymhB�mhB�mhB�mhBn�2'n�2In�2^n�2�n�2�n�2�n�2o37o�2'Po3uo�3�o 3��o�3�ou4�o�4p�78pBCZpBC�pw�p��phB�phB"qhBEqhBlq�4�q�4�q�4<�q�4rh6,r�4�Frwgrh6�r�6�rp6M�r�6�rH7#sH7Ss�7�s�7�sCU�sBC�sBC�s�t@7thBWthB{thB�thB�t�7�t�7u�71u�74ur8Ou8r]ur8�u�8�u�8�u9�u�8�v�C� v9Dv�9fv 9�{v�9�v�:�v�9��v�:�v�:w�:3w�:Nw�:~w�:�w�:�w�<�w�:��w�<x0=x�<�-x0=Qx�>sx�(�x�q�x�>�x�>�x�>Q�x�>!ynAHy�>~bypqpy�P�ynA�y}C�ypA
�y�P�y�q�y}Cz�C:z�C	Nz�ClzE�zE�z:G�z E�zO({�p{:G7{!IW{@G�j{w(�{�p�{!I�{�K�{�x�{�q|�K+|?QS|�K_n|)�|q�|0q��Pq�|�p�|?Q�|�Q�|@Qp}�Q>}�Qj}�Q1�}�Q�}�R�}�R~�S-~�R�G~�Si~�S�~�S�~�S�~�S�T+�T\�T��T�CU�PU�zV�BC!�BCA�@b�@��hB��hBˀhB�hB	�PU,�VM�PU�a�V��zV���Vā�`�BC�BC+�@Q��{�hB��hBɂhB�hB��VO��V���V���V��W��V+B�`Z�[�@(���r���WՄX��WIF�Xn�YZ�� X9��h(ͅprۅYZ�[)�[Z��[�� [����[ۆ\	��[O*�\[�i\��\Y��i\��\*�p\$[��\���]���\V݈�]�8_-�^8G�8_u��_���r���(Չ�r��_�p`3�p`d��`���`��2aNJBC�BC��$��I�hBi�hB��hB��hBˋ�`��`��`L#��`G�2ai�@a���c��BC��BC��� +�hBM�hBs�hB��hB��@aڍ�a��@aB��a8�eb[��a�q�eb���bӎ�b���c��P;��rI��ca�Pe}�BC��BC�� ڏ� ��hB�hBC�hB`�hB���c��]dǐ�c�ܐ (;��s��]d��d<�`dIP�`s^��d��e��0 (���sΑe�Pe�X (6�@sD�Pe_�A�~�BC��BC��� �"'�hB/�hBV�hBv�hB��Peϓ�e�PeM(��e\��e���e0���eؔf���eB�f8��f]� fqu��f���fٕ�f���f)�gS��fRp�g��1gҖ g��1g%��gS�@gNt�� ��� ؗ� +�W�y���g-��g\��gE~�� P�� y"���g�*h��gJ>�*hd��h��0h���� }���y̙�h��ai$��hqB� �_�x!(6�z��ai���i�pit
��iE��j~��i����jЛl��j��py��!-d=Py8�lv��l�� l���l�>n9��l~W�>n���p��@n�ĝ�!���y���p(�wrY��p�}��"�ee�y��wr՞t���r���#(A�zO�tt��y�� tj���#E˟pzٟPz�0z���y��yC��yU\��y��{���y���$(��xԠ{����{�2��x@�%�^��xl����փ��փޡ��
&P%��x3��_�=���=����������A�Z&(k�`x"y����f�ף�&x� x!�f�>���l���������&(ޤx���A�B�P�W�;�p�BC��BC��"'ĥ-�hB�hB$�hB>�hB\�P�|����P�����ɦ����"'�
�H~��2�!�J�!�g������*x��8~������đקđ�A��Z+x�`(~$�A�@���Z��+Pn�~
|��������",Pը�}����ݓ�r,x�~
$�ݓ>�}�V��,(T��}h�}���;���@���:�̩BC�BC��-�#-2�hBK�hBh�hB~�hB��@���E�Ϊ@�۪E���:��-"�@�4�v�J�BC`�BCz�#-��#-��hBΫhB�hB�hB�@�<�v�X�`~t_���|�����BC��BC�#-	��-3�hBX�hB��hB��hBɭ���ݛ���]�ݛ8�-�_��My�#-���`���-�Ѯ`���`����8���`��������E���BC֯BC���-��-<�hB\�hB��hB��hB���հT���T�T����"�`��,�0�
:���Y���v���������ݦȱ��=۱ݦ�������'���N�Ǩs�Ǩ��E���P�ڲ����BC�BC5��-W�f.}�hB��hBóhB�hB�P��w�1�P�':��-;J��	X�w�z������=���=R��=���=˴�=�(�=�.(�Ё
��+�<�J� �=`��=v�0.6������<���L�ݵL��[�-�[�Q���s��������BC��BC׶f.��;/�hB4�hBU�hBo�hB�������ɷ��@ٷf.Pa>p����.���.���.+<@������5���I��.(e���s����������7θ	/(�P�����R�3�R�S���q�����������ʹ����'�#�'�A�k�]�1/t�k���������˺��6/�����*�BCA�BC\�;/x��/��hB��hBһhB�hB��)�#�J��3^��c=i�;/&��a/���/Ƽa/(ټ�c=�#����݄��=�`�= +�H�=;�@�=L��/c_��m�����5���5�����We�ٽ������BC�BC)��/B�0_�hBw�hB��hB��hB����׾ն�ն��!��/(5��
C� �X��q�BC��BC��0ſ0�hB�hB%�hB?�hB]� �v������������ ��D���BC�BC;�0_��1��hB��hB�hB�hB� �0���I� �|U���p������|�����Q���Q����)�0I���h�Q����c=���c=����=��"0��@���Q��q�,�q�S���x�"1U���������������C���o�����w1������:���17�:�f�j���j���������=��1>$� �2���_������1�����������-�D�Q�P�r�����BC��BC���1��2=�hBf�hB��hB��hB��P����+��1"H���n����2�����u���2	�u�2���Y�32z�����5���I2��5����7�_2Y���~�����u2�����E���BC�BC*��2J��2n�hB��hB��hB��hB����E� �P�6���P�BCj�BC���2��83��hB��hB
�hB%�hBD�P�^���v��2�����������BC��BC��83�83>�hB^�hB��hB��hB������u�����T���u�.���H���j���������>���>�����"���;�]�X�BCu�BC��83��`3��hB��hB$�hBB�hBd�����]���83(�����`�������BC�BC;�`3_�e6��hB��hB��hB��hB�`�5���S�`�md�`3(�bЏ}�����s���������#��3(;��3i��3���3+�����s��������3x0��>��k�r���r������������B���g�G���S4(��p���G������������>�{4(�YP�]�����f����4U�/0���f����6��4(_��!m��������� 5Pf�������������H���q�����4���p5-������4�������5�<���J���s�����������=6(L(`�	���3���[���v�����BC��BC��e6���6#�hBF�hBm�hB��hB���������������7�e6(Q���%_�����7���7������������BC)�BCA��6Z��6w�hB��hB��hB��hB�������	�����,�a�C�a�h�y���p�	��y���������������$���G���	]������������������	1���P��m��}����BC��BC���6���6��hB�hB'�hB<�hBU��r���������@������������� �����������+��� 9��T�H�m�H���Y���P�	��Y��������,��Q���	i������������������	���,�'�K�'�f����������	��������>�)�c� �	{�)���G���G���Y��P�	�Y�>��]��x�|��|������	�����)��P��u��	�����������	�	/�	P��o������BC��BC���6��}7��hB
�hB)�hB>�hBW��n�����5��@�`����`������������K���`0�`Y�i��`	��i���������"��	<��U�3
l��6�}� �
��3
��I
��@
	��I
�~
%�~
P��
y��
	���
���
���
���
%��
	A��
d�W��W�����������BC�BC�}77��7U�hBn�hB��hB��hB�����Y���y�}7�Y7��R��o�2
��2
���
���
���
��
$�eD�ee����������BC��BC���7���7
�hB"�hB>�hBS�hBl������������������BC2�BCP��7o��7��hB��hB�hB�hB��&��>��I��r�"���7(����"�>�>%�iD�id����������(�($�9D�9f�I��I��Y�Y��
��/�+R�+y�����������8��G�LZ�BCm�BC���7��+8��hB�hB�hB��hB��1�'J��WV�'m�E��E������7(�P������
��,��I��a�w���9��9�R�R�x%�x?��W��u�������E��7P)@�
�E���0�LO�Pc��{�BC��BC��+8��8�hB	�hB)�hBB�hB_�P|����+8P�����������.{8PC��Q�{���������!BC-BCM�8nk9�hB�hB�hB�hB�8kY�8(tp��k����8(��P���� &9(:0�H� i�!�C9(<b���!�.$�BC�BCk9#�9EhBbhB�hB�hB��!�	"�	"�"3�"U�"u�"�|#�k9(����|#�.$�9G���#0$8�.QBCjBC��9�&:�hB�hBhBhB=0$a3%�0$�3%�'�@%��9;3`�A'c�'��'�4(�4(��(��(	q)3	q)T	H*s	H*�	_+�	_+�	d,
:$
d,A
�,\
�,�
�-�
�-�
.�
.j.$j.Q�.|�.��.��.��.�. ;L8BCPBCl&:�)>�hB�hB�hB�hB
�.:
�/V
�.�e
�/
�0�
&:P���
�0�
�0�
v:�
�0;4�0K!�:����3�
�0�A;4Y�4oM;��4��5��4G��5��5�5*N6F^;6t�]N6v�6��;^L>Л
��6��7��;P���7<c8ZB<sc8�%9�%9�:�R<P���:Q;6�<6Yf��JQ;j�;��;��;��;��;��;<*�<(A��O<hJ<=(�p�
�J<�=�=�9=9=4 >M(=(5	`�a >y]>�]>��>��>�O@�O@�@/�@H�@_�@x.A�.A�RA�P=(�P��RA��Ax=(@�-�AI�Ac�A}AB�AB��B��B�C�C9C+9CF_C__Cz�C��C�?D�?D�nD�nD�D7�DS�Dm�D�E�E�E�E�sE#sEP�E{�E�F�F��F�0�	��F�G �
%�G?�GW�GxH�H�+H�+H�>H	>H({HE{He�H��H��H��H��I��I�I7�I[AJ}AJ�`K��=9���`K��K�=($К2�KI�K^�K�;L�>(����@L�4]BCBC6)>Q)>phB�hB�hB�hB�@L��L�L0�LJ�LknM�nM��M�pM\��M�M�M=3NZ�MSx3N�FN�FN��N��N O. OI |Ob  O\{ |O� �O� �O� �O� �OS!�O !�O;!�OX!SPs!SP�!�P�!�P�!�Q�!�Q"�Q9"�Q\Y"�Q}"R�"R�"cR�"RS#cR)#vRK#vRo#�R�#�R�#LS�#LS�#�S$PS\,$�SM$�Sl$�S�$T�$�SS�$T�$&T	%&T*%�TI%�Tn%�T�%�T�%LU�%�T\�%LU&VU9&VU\&�U}&`US�&�U�&�U�&�U	'#V+'#VM'�Vm'�V�'�V�'�V\�'�V�'W(W&(cWD(WSc(cW�(vW�(vW�(�W�(�W)lX!)lX>)�XY)pXlu)�X�)�X�)�X�)CY�)�XS*CY'*VYD*VYc*�Y�*�Y�*,Z�*,Z�*�Z�*0Zl+�Z+�Z9+�ZT+[m+�ZS�+[�+[�+[�+s[�+s[
,�[%,�[\>,�[X,�[p,�[�,L\�,L\�,�\�,�\�,�\-�\#-�\<-�\Z-�\v-�\�-4]�-@]�-b�-BC�-BC.)>0.�>R.hBo.hB�.hB�.hB�.@]�.�]/@]x/)>(#/��1/�]O/�]k/Q>�/�]�/1^�/_>�/1^�/n^0n^$0v_D0m>(^0�l0v_�0�_�0�_�0�_�0�_1n`<1�>([1Мi1n`�1y`�1y`�1�`�1�`�1�`
2�`+2bG2�>]2b{2c�2BC�2BC�2�>3�>73hB]3hB�3hB�3hB�3b�3c4`�!4�>;4cW4�iw4BC�4BC�4�>�4?	5hB-5hBU5hBv5hB�5c�5�c�5c��5�>6�c<6�g\6�c�H��o6�g�6�iT� ��6�>�6�i�6l7BC!7BCE7?j7e?�7hB�7hB�7hB8hB%8�iE8lc8?U{8l�8�w�8BC�8BC�8e?�8�?9hB.9hBM9hBe9hB�9l�9al�9lQ�9e?:�?3:e?+.��F:ala:�lz:pl8�:�l�:�l�:�l�:Qn��@�>�:�;�?P��3;QnT;sns;sn�; o�;�n��; o�;�o<�o=<Bp]<Bp</q�<�</q�<oq�<oq=�q;=�q\=�q{=�q�=r�=r�=�r�=��\>@�!> �4> �C>`�\V>�r�>�u�> ��>�yd
�>���>��
�>��$]?@Ch ?�'h4?�^�H?�uo?�v�?�v�?Ow�?Ow@�w&@�wL@�wp@�w�@:��@BC�@BC�@�?�@�@AhB*AhBJAhBcAhB�A�w�A�x�A�w��A�xBIz?B�x�ZBIzBdz�Bdz�B\{�Bpz�C�C\{7C~[C`{rC�?(�C���C~�C�C
D	�3D	�SD��qD���D��D��D��D@(E��E�9EP�VEP�xEb��Eb��E���E���E·F·8FA�TFA�yF���F���F̉�F̉�F.�G.�=G��^G��G���G���G���G���G��H��4H��KKH��nH��H��HF��H�6IF�?IX�kIX��Ik��Ik��I~�J~�GJ��oJ0@P�J���J���J��J�@(�Jx��J�K��6K��OKْfKْ�K̓�K̓�K	��K	�L+�(L+�KLP�lLP��Lj��Lj��L���L�@P�2`�M��.M_�KM_�jM���M���M���M��N˕#N˕JN�oNЕC�N��N&��N&��NK�O0�;OK�[O��yO���O���O���O�P�0P�SP�}P:��P@��Ph��PBC�PBC
Q�@,Q�@OQhBmQhB�QhB�QhB�Q@��Qh��Qp�R^�+RBCERBCcR�@�R�@�RhB�RhB�RhBShBSp�9S^�QS`�gSѳ�SBC�SBC�S�@�S�A�ShBThB;ThBVThBuT`��T���T`�/�T��<��T���T�U��QU�6UL�MU�\WUL�tUM��UP���UM��Uݛ�UP���Uݛ�U)�V�I V)�9V��PV0�ZZV��vV���V���V���V���V��	�V���VɜW��	Wɜ:Wh�UWМ�cWh��Wa��W��=�Wa��WW��W�@(Xp�(XW�GX��dX`�:tX���X���X���X��X��X)�Y)�5Y$�NY A(bYP�pY$��Y@��Y@��YQ�ZQ�FZ°rZHA(�Z0��Z°�Z��[pAP<�.[�!<[��c[ѳ�[��[ٺ�[BC�[BC�[�A\hBD\hBe\hB�\hB�\hB���A���A���A+<��\��\ٺ]�A}���]�%](�3]�M],�k]BC�]BC�]hB�]hB�]hB^hB=^hB\^hB^��^��^��^��^	�_	�2_,�T_0�j_L��_BC�_BC�_hB�_hB�_hB`hB>`hBY`hBx`0��`���`���`L��`P��`b�aBCaBC6ahBQahBpahB�ahB�ahB�ahB�aP��ab�bPCb�Cb�C/bd=>b�<ebDqb�<�b<�p�P��b
d��b �<�b8	=�b8��b�c=�bH=Ķ	��8`�XȀ�ȭ���$	��
��@c��
d���8��`@��<�< �<8	=H=P=d=ؑ}�b ��ca	c`�j*cpp�;cRSOc��qc��;}c`�< �c��c�s�c���c��c�d�-d��jCd �GQdБ=nd ��d�d��d�7��d�d`e�d�q
e�,eЄbCe�_#We��2ne�^M�e�jx�e`U$�e�)��e���e@�
1f��O/f���Jf�
�wf`�<H�fP�i�f����f��f��	�f�E	�C�f�f	g�m	1g�vwUg�<Xcg��
tg�g �	�gb��g�g \�g0���g0C;hzk;h�`^h�u2yh���h�AI�h !�3|��	�h0;n�h�
d�hpji@	i0f/i��<@Mi�
2fiP�	`si/�i0n"�i@���iH$�iPG
j+01j`��$�Gj��\j�l"rj����j�j�o%�N ��j`%,�j�]��jГ9�j�kPk�N	4k�6�Mkp�lkp���k�*�kP��kp�
r�k��g�klh��	l��	<*l0&_Hl�,fl��
B�l@��l l!�l`;F�l�l����ll
%m�'�.m�
pV�jAm a=PNm��\m t%qmp[)�m0:!�m0��mP��m �r�m�#�n���+np?n� �Qnp*�tn��7�n��
��n�m��n�	��n�n�5�o��$o�Z	�>o�Nq^o�Moxo��_�o�Om�o`PN�o@�5�opr%�o��w�o	�o�"�
p�#p aG6p��bJp�
�cpzpP	�p�*�pa�p�
U�p ���pp��	q ,q�*�;q�c=Kq�\
gq�_�q :1�q�q,�q�q_)�q�l��q0
Jr�	r[!r��-8rБqFrpaz`r�or�-A�r�T�r��l�rШu�rp@�rp=	<�r�}
	s�C	#sZ=P@sP4
2\s`w7us@�3�s �	��s�s��v�sp���s��
�s�=	 t`e3tP��;t
m[t@'1lt��
Q�t�,�t�tv�tpt
��t��utPu j%u�o5u�yvJu`�!Zu@��u�u��u�S/�u@ ��u@��u�Rv�%+v��P=v[v@�	�mv�v`!�vPt%�v �
�v0�v�tJ�v��
ww��0w��?SwPl"iw���w`���w��*�wpjg�w���w��w�T
O�w�.�x e0#x#8xL`BxP�
`x��'xx s9�x���x��k��H��x��!�x�|syyp8�&y��Y3y���Hy v	�`y1	(�y@C�y �y�
��y���y�yp
z a,z��;zP��Cz�ckz`Kayz�6	��zma�z���z�J��z`Kp�zp0�
{���'{���?{��Q{�<P]{pB4c{"�{P}�{�pA�{�
R�{`�	m�{��||P��+|P�E>|�	kY| �7y|0���|0C�|�)��|@��|@	��|}�|�}��:3}��X}��~r}�mv�}��A�}P5	�}���}Pn�}@�
i�}��s~�z,~P%!A~ 2	�\~9	*�~�"�~@1	�~�o�~�}��~08
+�~�5 ��J�k�5
!�p$/���K���
� r����e�p.�&�0j6�O�M���H[�#�r����_!���$���k	s߀���������,�0�H�p+e��K���i�����}��bŁ`o���!�$�0��=��
2Z�Pk�y�p�B����(��������Pނ��c�P���E3�p�	�>��uV��	r� �� o%�� �	�������0�D׃`�"���#	 ��x
xZ�H��%	T�`^{��E���@�2Ä�!	�� [z��PY��}
"�0q?3��$@��
\��&�y��o
���s
x��Յ@�
h����
#�0ZP>��S� ��]���|o���S���*����,dž�5ֆ�����PS�@-��W��	�m���z}���0�
x��pTo·�S؇��|������P5
��\1�WC� �^���Sj��7
��� �c��0�������͈ Y=�ވPw���`.�PBt6���Y��o�l���@���h�� D
@���kԉ��[����	s�`W[-���(H���!	phg��`��������@uԊPh���Y���� (��;�PJ�V�u��e��p���Mn���)��qNj��� ����f?��i	(��4
�G�!�b�P�|�P�7��P���P1	*ˌ`�	ߌ�]� +7�� c � �,���1C����W� �<0�P�	�h�0�2��`D
��`����@P�΍�6��`W
�p�&��"S>��ZK��)[��C
_t�P*���		���2B���IQ̎@Ҏ�l�@y~�wA-��n%B� _bV�l��y���Ф
��������Џ@
�� ES���I	�p�^,�0(	J@���
�d��	z��xB���n
��� o���dߐ���H
Q[	�u�k��!)#��:��sU���e�	���x5���4����wÑ�.ّ �A��
���#*�p;��ea�0m=h���}����1
}����Gǒ��
��P���0y
	�0��:� �WJ��!]�p�jq���	���P�����Γp
���&S���$����.2��PCB�@�	UV�`Zl�P1\��p9������ ���@����T
c� ~
�&���<����L�0		d��$Ut��������P�%����		ڕT���uA�PU
-%�`�(B���	M]��c=d�P�	�
t��V���b���`PN��@��ז [ �ptO�`6(���4�`�E� �a��
yz���
3����	N������@�$�@N����
L���!����.�P�M���h"�0�)[�en��&W��E
X��@_���P/*��P�
4ܘv{�� ���pXl �9�PQ�P�pLb��Dy����������l���Coə	
�ٙ8�`u
���`�����
�'�`�	jB�p��[���y������	�������ۚ�^����	�	�x
r)���,A�p9L���W]�P�n��u$��c����`;
	˛ ��@�	��
��@q
>� vAZ��Tj��6h�@sh��P�A���\	͜���`�z����@�A-�P�A��b�U�qJQ��
f���,p�p����w
8�������cݝ`�
����/���
%��?H��4
Y�0>�}� ������p�J���?ʞ�Y!Ԟ���`�
��%���
^H�`�
�\� �uf��2	����S��@�T������̟P�ݟPj
������*����F�\�0Zlg�p�����0b�����Ǡ�������f>�#�pi5��g=Q����g�p�k��� 4�� �
�ˡ`�:ܡ�q:���	���>_�0Ux1� �w@��*>Q����f���b���#�����Ǣp(���;����
�E$��TB��P��1m��#,���
����=�� -'ϣP{
��08/���e5�w�H�P�e�Ph	2��n��p0	��?	-ФpB��Pr1��p��"��^4����D��$HS�P`)h�p�ns�Pp�u��H���ED�������j���i!Х�G
��E
���`+��#�`g/���:���/S� 	c������@X=���L���0�Ŧ�WSצ�a����u�p�2�0ZoG��YZ���.j�����
2����p^����p�/��h�p�
P-��X=��SSN��	�`��"��`FZ��Ϩ�
u��n%��B�4�@jW��vAr� �<@���R���P�
���%Gթ�w
4��0/	�0�.��6A�]��Z~m�`s��������P�R���p�ЪP�
������0�	�Q����.�p

C��F�M� c��2�v� S��pi[��ī NWӫ|	����/�A��sK��
?[��q�}��R���Ђ
C���J���H�ˬ l"���P~#�v����(}$�p"C�P�b�`>�p�@F��pe���O�ǭ�	
Jܭ�J��@�<��#3� qT�0Z�v�pL������ �q���`߮ z��`�b��+*� �JG��LY� �|o�p�@�����Q\�� �7ï ��د�A��C#�B�=�P�P��S^��x����@,l���ư x5����b�	��#�7� 
#P���
k��iE��PF���iƱ@�Xޱ��;�� �
��@H;+�P'�<���I�EX��8
�h��%b~��
O��`55�Pd����Y�ϲ��\��
���+� �<0;���6P��A
�h�@t
Yu��s%���s%���2���P7kٳ��(���!	0� �?���X�0e�~�PW	������P�´P�8ش�;������	���,�p�
>����[���
�y�В����y��0H�ֵ�n[���],�A#��\	/��\T=��
�T���
zq�`|��0�$���b.���Qʶ�-޶ �!w{����*��kz6����W���	,s� �
#���`��0� �� �@Ƿp($�P�T�� �o��>6� wF��OSS��yAa��v�@c=�l �d���a=����@t
"���p%��+�I�<��w
�P��c�\x����<����Ϲ�ݹN��`n%� {	2�`��U�`�)_��ZBn����P�
����	ú0�%غ�;	�0�>� 7�,�P
.<��o�N�P�c���q���h����=��|p���rԻ@���P6v��Z�0�<��5
4Y�l��cw��V
T������O��P�
���e��`����I0����@��}
X����e�`W=���@}
���� ���\NԽ��9��x7��
�0�a2��
&P���
�l��k}��6
{����'��p��Ⱦ��r�Q��E�0�гI��?h�`�<0{��TV����=��pu���ǿ�m=ӿ�Cq�`a
�0�e#��c+E��U�pm"l�@H
%���]��pG
j��``=0��r
���z��1	���	� ��a
�>�P�
aR��m
Wq�p�������P���5M��0[	'�0

8������`*)��w
C��)X��T�u�P����l"��@)��pPH��`�U��6�� [>� DN�Ath������X���w	�V�@>��%:����P���KN��?n��m,���
!
B��'	?c��	�P 
��`����D_���"9���"	��������j���0�0	C��8Af��`,u��������pH
���|���g����k"�@'���[$�p*QI��LgV��u�d��~
v�P�2��0�'����@�����;E�� �	����
�@P�.����B�`��]��_Fn�`yAz���#��@`����\
��0~����	���_�
���
(��F�P�_��q%w������������������(����B|���f	����#��S�=��QI��"�+	b���@r���Z��Ё#��@�	N�� �U��P
=����
*�`8	�S��tp����{�9
<��`�7��P�)���X�� =X��� O\�`$+����;���<Xi���E�y�BYp�P�
���pe��� �����
K�����������u�,���	48�e_� �v��H�����U?��`�2����j��Ps��-�p�;��iL��Q\�y�x� ����������p�L��x���\�� �s*�@��9� �:M�P3
[f��`b{���V���P�����>���\5��`�Y���
{#���I�Х	B`�@��p����x�@���������G���������3'� Z&4�Py
U��""_���(MY	P.w��������
@�������H��7���8���ZS����
���P1�P��C��a�`��u���+���������<����B
����*�P�.I�@9
Z�PE�x����0�$��`$	�� �
����_0���/	<���,+��>���
a���
Qq�`'��R��@�����g=����4�������.���<0Q�@�<q���}����a=��0i���`Z=X���M���W��Q	� ��3��hY�l��`��@������L<�������{1��@�J�@t�)� �=��`=0W�`w�`�
R���L��@�
{����������@7
=��Ю
!��o%9�P?	*}��b=d�J�y� � ������`����0)��`���f��PK
��@�]�p,.7�P�>M�P^r������#����������t%���6
Z� !	#�;�0�0U�`�j��'��0����p�����Im��@�
��0Vl��@)!��k� �PS\0�NI<����O��"	o� ����@�Q��{
��� 7e���������� ��+�F�F�[����w��n=��o	����	����	����S	@�	����@{	 {� �Pw
4B� �e[�`�$���}��"��0����`T����3�0=Z+���B��KK\�p�д���?���	j��p�	���P�	���s'���F�[���B�>� S�0�e�p�6x���R�� �����H��@�T������� [S��`x7�0	b/��aP�p�	fa�0��s������s%��0���0���� 	����y��$,1���3O���	k�`�`w� 
��b��e�� �"���7�`�����'���78���L�`�
[��Q=Pm�`SO|��
Q���>
`���Z=X�� d���S���[����`� z,��oEX�`�]i��Nlx���)��Їq���n
��Li��@���,���K/��	;�O�@�g��p
������0		��0�1����
���T1�`#!��t�3��TtR���
�o�PNS���3���`��y
	��Љ^��P_a��pqL��d2�@�
M��	_��<Xm���<@�������T����3��������/	�`8�-���K���\��$	n�0������������
���H
u����C�����'��JD��~Ya�pDIw�00	$����T��pz
���k"��@����0A"���S)���f%��~� ���
�B���	hV��`�s�I
<��������@�U�����(���\$��.:��-[��y��MS���eg���H����	 ���4?��`�O�����8� 'B���7Z����
d�����`j���T\��������7f�00�$��m�=��i=Q�<c���	�r�@�,����	q����
���Pw?��@a�	�61�� ��	,�p��?��/]_��B��`�N��@�x��	��0s��wO� �
Q�Po8:��|
I_���v�`4O��`�+��`�1��P���� ;��p��	��L*�`!	&+��T=�>��x~
X��	
?dX	r��U=���9a���wX��@�����X��!���p3�	� �&�`
5���5P�p�
jg���	�%�� 
���c�������"������0TS���
S1�>?���<@W��/		v������ca���%����U���0(;����<�������8�@\=.� _'A��_+T���	�k��"y}�����`����PBo����G���������n���Np�@w%?���	^�p`	i��r
"������0�
����~����	��Pf:�Ѐ8 ��a<��[G�0I�n�p�3��PJ���

C��P7d�������`	���r
"�@��@���N�?�a��m=z��A����e���W�@>����P�p������&�@�;����X�k��A}�`YS��`��t���`�

�`��PH��0	u�1��H�0~<g�`jG��8��
����Q� 
�� ����:�%�=��>a��w5z��G
���s
��� M��@4E�Po%��.D���6�`�0�]!E� >=N��h	q�p���K�����������o��z�����r4��zO��2@k�������L���DR�1	���

���?��P|y�P|
�@�I�`]	m
.�@gB6��AaA�u%T�p.r���"��`\=@�� �<0��P��M��.��0��@=�(�`�c=���U��}
i�j.��@�
��Pv
2���k�0��H���Pd�p2&� �P�P�Y^������`����7�����@{3
�P�g"��'<�P@RF��v
#t�����i=����
�� *���RS�p�i���U)��di>�Ы
3c� ��|���@(����P�������P=�� K���b�!Z0��"+7��=2X���Az� l	�����
Z���f$������
B	�n+	�
�D	�	.[	���p	��
Q�	���	p\�	0J�	��U�r	0�	T�	�"a	��k#	��;	�1�8	�J	*%k	`�N�	��o��0���	P���	P���	�\#�	4��	���	��Q	��U5	P�
$P	d	��q	p���	 7$�	v��	��^�	�'	+�	`w	��
�	�A�)	0l
�L	p�
nW	�t	���}	�	J>�	�c��	p��	����	
	�$	W	 ��/	��
�S	2y	�b�	�
w�	���	���	�
�	 P�	�	�	��	P)�<	 >�M	J8l	��	z	�z�	w�	����	`GG�	p
q	`q"	�`,-	0w	�:
pmI	�[\T	�nM`	0�p�	�3��	�E�	����	��<�	�		P+!	5	0�AL	@
IY	�ie	�k�	�[p�	P�
�	�S�	@ �����	��	���	�r%9	@�V	�,Xv	��w�	�	��U�	@<	"�	I�	��		���		0�q+		"A		 CM		�m�f		���r		`8
��		�?��		p���		�		����		�		��
�
	��1
	�
[
	e�f
	����
	0u�
	ГJ�
	���
	5	��
	Vj	@y
2	�^MM	0�	^	`A"j	�Z�~	P89�	��'�	��\�	��	0	R'	 ?	�
8P	�hv	�'	�	QC�	P�C�	�	�;(�	�x	'
	�L
	��
	�RC
	�W
	 qn
	�u�
	0?��
	`�
��
	p��
	`y
��
	`�>
	@�?-	`�(B	@�'V	0�
r	��	��|�	0�lه �v�����	��	����	�|
	�yW1	�'	Q	p�?t	`!)�	PL�	P���	@�!�	��	�"�	pI�	��	3	/
�N	p}
g	`b6z	�/4	Hw�	�M�	 xR��Z�	�<@�	�V=��	�=X�		��
M	�`7	��Z	�:9l	P9	@�)�	��	pR�	0��	�	��	��	��
�ؑ=	��<	m"Z	p�#y	�P	�	�3�	P�g�	�E�	p�
�	�no	p'	0�=	pN	`|=d	@[Jv	P�
��	n
v�	�(�	0�
I�	pvA	P6o	pu%	@�6	�K9?	T	@�(u	P�j�	 ��	n�	З��	�	�	�$o�	�IQ	��	��(	=	 |�M	p�	yg	p�j�	У+�	���	 �	�	����	@���	`���	@m"	(	�b7	0"X	�	�m	��8J�0�
�	�k�	~"�	�	@A3�	��O�	p~
	`Ca	�1	�;	��LH	PE
-f	�Xx{	��<X�	B��	���	���	�2
}[� '		`�w	��@	�`\	���z	�-w�	�	m�	0f2�	 !1�	`�
=�	 F��	��3	p	P)	 .J;	 �
U	�#�e	`Qo	�`�	`�k�	�@��	�+�	.n�	0N�	 H
#	��E	�	`	`Wu	WS�	0�	I�	��
�	��@�	`w�	�w
	�v<	"}S	�s
8d	`>�n	 y
	�	0^.�	��&�	p`���R�	`(\�	@�*	�b�)	@9	PQ	��d	0�Kp	�_0�	�U�	��1�	0��	����	`	�
i.	�Z	@�YB	uyd	Н
�	��i�	�	А>�	��
��	P9
�	�3
2&	`�S8	`�dU	r	p�z	�}
�	@�6�	`Y��	����	���	�ID	��c+	@�=	R	�_Wc	���v	��$�	0y
�	`�	�	�
��	H/�	� 	�i 	 y58 	0`K 	`"%i 	���� 	P�G� 	@@�� 	��� 	��!!	!�,!	��`A!	Е
�S!	��af!	�`�!	�!	�_��!	�+	�--�!	�!	�&	�
�p<I"	�G /"	`�	#D"	_=A	]"	@iVx"	p�+�"	0f�"	����"	P\�"	����"	��<4�@ 
�"	��x��Z#	��&#	���,#	@��A#	�M�Y#	�W<v#	0%!�#	[�#	�0^�#	p,`�#	pr
3�#	`���#	$�$	$	�n&0$	�VeM$	 �;j$	����$	 ���$	P%��$	p���$	��	�$	09��$	��T%	���%	���%%	0�B;%	��O%	`�Ed%	�a=�}%	P�t�%	�E<�%	�/	�%	��%	�t�%	`�_	&	�c=&	�I!'&	0&	0#YF&	@� T&	@r%m&	��:�&	~@�&	�t%�&	��V�&	p���&	`�R'	'	��%'	�3'	�Y@'	X'	�<X{'	��p�'	�g��'	���'	���'	@_A�'	P��'	��:(	��
z3(	 {�J(	�+�Y(	2xe(	y(	0�(�(	�(	p�3�(	�}��(	��	��(	�l")	P:
�,)	ЕCD)	�B
YO)	 ja)	 �	6w)	���)	�J�)	@u%�)	�)	���)	P\\�)	P��*	��JH*	�\	T*	`a�q*	��=�*	�b�*	 �	�*	 B�*	��9�*	���*	�Q�+	-+	 NpK+	 =o+	�	*�+	p%�+	�o%�{��+	`� �+	�+	R�,	�b,	�=X),	p$GL,	��Va,	8m=m,	`��,	�,	`�<X�,	�,	 v
#�,	`�-	@�-	0�	(-	E�H-	�~�]-	��
�p-	�(�-	C
P�-	�3�-	�US�-	��	��-	��-	U��.	��%.	�52.	p@�Ԍ��S.	 �}.	����.	P��.	���.	��	�.	�.	�F/	�
&/	`��G/	��3l/	~/	0v�/	���/	����/	����/	����,	�/	0	 .0	~�D0	0I�X0	(4d0	'�w0	�N3�0	���0	p
B�0	�0	�0	�h�1	�a&1	i=21	`hE1	 @S1	�sp1	pfEy��Z�1	��	�1	�1	����1	��X�1	
N�1	��
2	��<02	`�
+02	��fC2	p��W2	PjHi2	�Id�2	0Hى���2	PR��2	@E��2	v
�2	��$�2	�2	 =3	'3	��H3	`�Z3	�]
t3	��&�3	�"r�3	`C
Y�3	 H�3	 �b�3	 �m�3	��	t4	@4	���84	`h�c4	��+}4	���4	p���4	�J�4	p�#�4	�th5	0�
�5	�_65	�5P5	P�Vk5	�	Uu5	�B��5	 ��5	 �
��5	`�	��5	@�$�5	�2B������5	p�>6	�*6	��@,6	pC6	p�i6	Q	��6	�6	�h	�6	0�<�6	�I��6	�
|
7	r7	` 67	�v!N7	��L_7	P9�u7	0���7	P�Y�7	����7	`Mf�7	0}8�7	�8	��08	��S8	h8	�J
T}8	�E[�8	����8	�
e�8	0o-�8	��>9	`�9	��/9	��U9	p�2g9	�P�r9	��9	`�=�9	 ���9	 k!�9	�9	���9	@�Z
:	@�\:	�D8:	�P:	`�
�j:	�g��:	�%	�:	�+'�:	�i�:	�C�:	P��g	��:	�;	Pm
P';	�=;	T;	���w;	��;	@���;	��;	�(��;	�e<	)
�-<	��A<	@�^<	�!�n<	��<X�<	��"�<	@ �<	n"�<	 �	�<	P���<	�	=	|C/=	�v
#T=	��f=	�V\v=	r%�=	����=	P�r�=	��C�=	P��=	���=	��|	 >	 q%@>	�g	xd>	`�<0t>	��G�>	��!�>	i	�>	`q��>	�>	 0		!?	@[=4?	�/�D?	pD.T?	@��s?	p�?	�r%�?	�Rl�?	p"	 �?	�;>�?	�[i@	��
3@	PU/@	�4D@	�U@	�'	z@	<�@	 �)�@	����@	p�4�@	����@	�"�@	�Q�A	��
<A	PA	�<0cA	�XqsA	�>I�A	���A	�1��A	`���A	���A	��4�A	pW
$B	�m"-B	�?TB	���{B	 w	�B	�s
T�B		�B	�m�B	����B	����B	��	�C	0G!C	P�o2C	��:C	�
mMC	���oC	p
-�C	�B�C	�4�C	��$�C	 :	�C	�^ZD	��!D	�^=5D	@��KD	@fD	���tD	��D	�<X�D	e�D	�F�D	�D	�
�E	�]�'E	��7E	 �+OE	���dE	` �wE	G
:�E	` ��E	�E	PZP�E	P�,�E	 ���E	І�F	��-F	��AF	 �]F	���wF	�h	�F	`Q��F	 
q�F	�}
�F	�B��F	P�>G	��7
G	!G	@[%3G	�WG	@�kG	�s}�G	�G	�l�G	��G	@&Y�G	Px~�G	�xG�G	�G	�~
	H	0dH	�=/H	��MH	�h@^H	��lH	 �	�H	���H	��H	0�
�H	�U��H	�GI	�/	6I	pb����YI	@LChI	��}I	�h��I	�I	�$�I	PL��.`c=�I	PyjJ	���%J	�	@J	��
�SJ	@�xdJ	��=sJ	@^.J	�~(�J	@J
F�J	�IB�J	��3�J	�	�J	�jq�J	�cK	��K	�6	I2K	`��LK	���hK	���wK	���K	� �K	�[�K	�S�K	P��K	/:�K	��L	P/p>L	@�VL	pw$kL	�&KtL	�B�L	pL�L	�v
�L	�L	�L	���L	 �qM	�8	3M	�MM	�h	+wM	097M	0�	8�U�%C�M	@��M	�5
g�M	�sg�M	��	N�M	X\=
N	��a$N	�LmDN	��/aN	uN	@	�N	�N	p�#�N	���N	@_��N	�'�O	��7)O	CO	�#�VO	�8yO	P�H�O	�T�O	�$	�O	pa=�O	��p�O	�a�O	`�wP	p��&P	 �?P	�XYP	`�/kP	�r}P	0a"�P	s
�P	����P	���{���)�P	Pk
O�P	��Z�� BQ	 f)Q	��:BQ	P
gZQ	мvQ	`���Q	�4��Q	�Q	0�/M�P[�Q	�G�Q	�w�`��Q	`��R	0e!"R	��0R	ER	\aR	�tR	�6�R	�F��R	�R	P���R	6p�R	p��R	�]=@S	`c2S	���1S	DS	pq�}���_S	 ��rS	 �0���l�S	�XS�S	pM\�S	0�g�S	�`,�S	0b%�S	`�	{�S	�S�S	�!IT	b�T	�G8T	�)WT	@*#zT	�G�T	�s1�T	��I�T	��}�T	0j;U	�OU	�I
F/U	 	�NU	gU	���~U	p�^�U	@p%�U	�B?�U	�U	�
�U	pE

V	p��!V	��< 2V	�vpQV	0HjaV	0��zV	`]��V	 �1�V	p�V	PY��V	��	��V	����V	�
�"W	p��2W	 �7KW	eW	`2
o�W	s%�W	��<�W	��W	�o��W	X	��X	�$X	0W(OX	�$,bX	yX	��y�X	0���X	@Z��X	�!\�X	0��X	@��X	����X	�D
cY	@�		0Y	AY	 >	cY	�OqY	@D.}Y	����Y	�$ �Y	{(�Y	0?	�Y	 Z��Y	�~
Z	|'Z	 AZ	p�NZ	��thZ	�_=xZ	�Z	�	�Z	�l
��Z	0�Z	��3�Z	�
W[	�[	0�|2[	��P[	d[	P<�t[	�0
��[	@S=@�[	�X�[	�6��[	���[	p��	\	[�'\	��D\	���[\	0s%r\	�p
��\	P��\	����\	�c�\	pP��\	p��\	 ]	`}
(]	�D]	`+Z]	�G�q]	��]	@���]	PO$�]	����]	P{	*�]	�]	0�^^	 <*^	P�0^	`�-O^	�Mh^	�^	0�My� Z�^	P�D�^	P���^	p�G�^	�?_	Pq%._	���?_	`:�Q_	 �j_	��w_	0�$�_	����_	�z�_	�_	 �_	�7g�_	���`	`0	)`	�4`	��L`	8e=k`	�Q~`	���`	�r�`	.2�`	`e�`	�s�`	�F
��`	`USa	P�m-a	@*
Ra	�|1qa	036}a	P��a	@�)�a	8��a	�A!�a	@e�a	P�
Eb	P�U)b	`�!Lb	 �ib	�\��b	Ph�b	�b	���b	�v��b	>��b	`^�c	�
F"c	�;c	�8Gc	
fc	p�7�c	0�N�c	
��U	:i�c	�c	p�#�c	�{	ud	@��-d	 �=d	�.�Ud	���hd	 ��d	p�t�d	%	��d	pW�d	��P�d	��
'e	�q%5e	`(
�Ze	��9ne	PI
F�e	 ���e	�e	�

�e	��k�e	 3Wf	%$7f	`�Tf	�p�f	�Ss�f	`�<0�f	@�(�f	�f	 ���f	 ���f	0���f	P
g	�V�8g	��	Zg	pvXhg	D��g	�G�g	�B��g	p�	�g	P2��g	�K�g	�$	�g	�-&h	�B
&8h	��!Ph	���`h	�}h	����h	@���h	�m+�h	�t%�h	0!/�h	p�'i	�M7i	PRi	�/	pi	 >@{i	�G
�i	0���i	�Ts�i	��Ը�i	�i	@�i	 	5j	 zR/j	0�HTj	@�gj	� K�j	��j	`���j	0�8�j	����j	`u�k	��T&k	p*�Ak	 �!Vk	�g�dk	���k	�\��k	�ie�k	s��k	U�k	p�
l	�u)#l	E.l	0�Jl	fl	�w�{l	pp%�l	����l	0���l	�m"�l	 `#�l	m	�7m	d�`m	Pzvm	`s%�m	�z{�m	 W
:�m	0Q��m	 ��m	�H2n	�m=n	��'n	�$�9n	�7Rn	�I
Ffn	R�qn	���n	P.!�n	�#�n	P�I�n	��n	����n	 �o	p�*o	�Z!Co	�}
To	@to	�Go	 v+�o	��>�o	�/\�o	6N�o	���o	 �p	��;(p	�rAp	��YRp	Юzp	0�!�p	p}��p	0���p	�+�p	�.��p	@/q	�0q	`�Hq	�
]eq	�5wq	 U5�q	 �
f�q	`�q	��N�q	�_�q	"r	��	�r	 cM1r	�LgOr	�AD\r	p�4sr	��
�r	��
,�r	�Yl�r	P�5�r	�r	`�	�r	��r	p#Hs	 �_s	�"2s	�!Js	0_�ls	P�Q�s	�]Q�s	��	�s	 T�s	���s	!�s	v�s	hvt	�O8t	��Pt	��	$at	FA{t	���t	�,-�t	�t	 j$�t	�L�t	�t	t�u	P��,u	�G?u	 qOu	��+$����qu	P�u	u��u	�[\�u	��B�u	���u	P�e�u	���v	��8v	Lv	`m^_v	@�<@yv	@:��v	0r
4�v	�
�v	���v	0�;�v	��d�v	@�w	��7w	P
;Tw	`�Dkw	`6
H�w	@0�w	��	�w	�:�w	 }[�w	�dZx	Pa0x	R�Bx	��L]x	p�{x	�;	a�x	��;�x	��
�x	�e=�x	�=�x	@L#y	���By	�sSy	��)]y	@"vyy	�Z�y	@~v�y	�y	��U�y	���y	�Y	z	(z	��=z	�\Oz	��bz	�O/�z	G��z	0	�z	@	�z	�"	��z	 i	{	��54{	M{	`l
Va{	0�~{	P�c�{	�5P�{	��2�{	�w7�{	�{	pI�{	��|	� 6|	@�	Y|	�H9j|	��x|	�G�|	0�
�|	���|	�\	�|	��|	�|	�(}	@�.}	H}	�qS}	�u%c}	Ђ�}	 �b�}	0�p�=j�}	�}	0�:�}	�?�}	��~	@lb!~	`/L~	�R8\~	P0`h~	�OJ�~	�'	�~	�3
[�~	�~	�~	��,	p�"%	Y�9		&N	�!o	 ��	`n�	@��.annobin_dict_fs.c.annobin_dict_fs.c_end.annobin_dict_fs.c.hot.annobin_dict_fs.c_end.hot.annobin_dict_fs.c.unlikely.annobin_dict_fs.c_end.unlikely.annobin_dict_fs.c.startup.annobin_dict_fs.c_end.startup.annobin_dict_fs.c.exit.annobin_dict_fs.c_end.exit.annobin_fs_dict_iterate_deinit.start.annobin_fs_dict_iterate_deinit.endfs_dict_iterate_deinit.annobin_fs_dict_deinit.start.annobin_fs_dict_deinit.endfs_dict_deinit.annobin_fs_dict_get_full_key.start.annobin_fs_dict_get_full_key.endfs_dict_get_full_keyfs_dict_get_full_key.cold.2.annobin_fs_dict_transaction_commit.start.annobin_fs_dict_transaction_commit.endfs_dict_transaction_commitfs_dict_transaction_commit.cold.3.annobin_fs_dict_iterate_init.start.annobin_fs_dict_iterate_init.endfs_dict_iterate_initfs_dict_iterate_init.cold.4__func__.5863.annobin_fs_dict_lookup.start.annobin_fs_dict_lookup.endfs_dict_lookupfs_dict_lookup.cold.5__func__.5287__func__.5854.annobin_fs_dict_iterate.start.annobin_fs_dict_iterate.endfs_dict_iterate.annobin_fs_dict_transaction_init.start.annobin_fs_dict_transaction_init.endfs_dict_transaction_init.annobin_fs_dict_init.start.annobin_fs_dict_init.endfs_dict_init.annobin_dict_register.c.annobin_dict_register.c_end.annobin_dict_register.c.hot.annobin_dict_register.c_end.hot.annobin_dict_register.c.unlikely.annobin_dict_register.c_end.unlikely.annobin_dict_register.c.startup.annobin_dict_register.c_end.startup.annobin_dict_register.c.exit.annobin_dict_register.c_end.exit.annobin_dict_drivers_register_builtin.start.annobin_dict_drivers_register_builtin.end.annobin_dict_drivers_unregister_builtin.start.annobin_dict_drivers_unregister_builtin.end.annobin_oauth2.c.annobin_oauth2.c_end.annobin_oauth2.c.hot.annobin_oauth2.c_end.hot.annobin_oauth2.c.unlikely.annobin_oauth2.c_end.unlikely.annobin_oauth2.c.startup.annobin_oauth2.c_end.startup.annobin_oauth2.c.exit.annobin_oauth2.c_end.exit.annobin_oauth2_json_tree_build.start.annobin_oauth2_json_tree_build.endoauth2_json_tree_build.cold.0__func__.6101.annobin_oauth2_valid_token.start.annobin_oauth2_valid_token.end.annobin_oauth2_request.c.annobin_oauth2_request.c_end.annobin_oauth2_request.c.hot.annobin_oauth2_request.c_end.hot.annobin_oauth2_request.c.unlikely.annobin_oauth2_request.c_end.unlikely.annobin_oauth2_request.c.startup.annobin_oauth2_request.c_end.startup.annobin_oauth2_request.c.exit.annobin_oauth2_request.c_end.exit.annobin_oauth2_request_free.start.annobin_oauth2_request_free.endoauth2_request_free.annobin_oauth2_request_parse_json.start.annobin_oauth2_request_parse_json.endoauth2_request_parse_json.cold.11__func__.7189.annobin_oauth2_request_callback.start.annobin_oauth2_request_callback.endoauth2_request_callbackoauth2_request_callback.cold.12__func__.7159.annobin_oauth2_request_fail.start.annobin_oauth2_request_fail.endoauth2_request_fail.annobin_oauth2_request_response.start.annobin_oauth2_request_response.endoauth2_request_responseoauth2_request_continue.annobin_oauth2_request_continue.start.annobin_oauth2_request_continue.endoauth2_request_continue.cold.13__func__.7172.annobin_oauth2_request_start.start.annobin_oauth2_request_start.endoauth2_request_start.annobin_oauth2_refresh_start.start.annobin_oauth2_refresh_start.end.annobin_oauth2_introspection_start.start.annobin_oauth2_introspection_start.end.annobin_oauth2_token_validation_start.start.annobin_oauth2_token_validation_start.end.annobin_oauth2_passwd_grant_start.start.annobin_oauth2_passwd_grant_start.end.annobin_oauth2_request_abort.start.annobin_oauth2_request_abort.end.annobin_oauth2_jwt.c.annobin_oauth2_jwt.c_end.annobin_oauth2_jwt.c.hot.annobin_oauth2_jwt.c_end.hot.annobin_oauth2_jwt.c.unlikely.annobin_oauth2_jwt.c_end.unlikely.annobin_oauth2_jwt.c.startup.annobin_oauth2_jwt.c_end.startup.annobin_oauth2_jwt.c.exit.annobin_oauth2_jwt.c_end.exit.annobin_get_field.start.annobin_get_field.end.annobin_escape_identifier.start.annobin_escape_identifier.endescape_identifier.annobin_get_time_field.start.annobin_get_time_field.endget_time_field.annobin_oauth2_validate_hmac.start.annobin_oauth2_validate_hmac.endoauth2_validate_hmac.annobin_oauth2_try_parse_jwt.start.annobin_oauth2_try_parse_jwt.endoauth2_try_parse_jwt.cold.15__func__.7557__func__.4995.annobin_oauth2_key_cache.c.annobin_oauth2_key_cache.c_end.annobin_oauth2_key_cache.c.hot.annobin_oauth2_key_cache.c_end.hot.annobin_oauth2_key_cache.c.unlikely.annobin_oauth2_key_cache.c_end.unlikely.annobin_oauth2_key_cache.c.startup.annobin_oauth2_key_cache.c_end.startup.annobin_oauth2_key_cache.c.exit.annobin_oauth2_key_cache.c_end.exit.annobin_oauth2_validation_key_cache_init.start.annobin_oauth2_validation_key_cache_init.end.annobin_oauth2_validation_key_cache_deinit.start.annobin_oauth2_validation_key_cache_deinit.end.annobin_oauth2_validation_key_cache_lookup_pubkey.start.annobin_oauth2_validation_key_cache_lookup_pubkey.end.annobin_oauth2_validation_key_cache_lookup_hmac_key.start.annobin_oauth2_validation_key_cache_lookup_hmac_key.end.annobin_oauth2_validation_key_cache_insert_pubkey.start.annobin_oauth2_validation_key_cache_insert_pubkey.end.annobin_oauth2_validation_key_cache_insert_hmac_key.start.annobin_oauth2_validation_key_cache_insert_hmac_key.end.annobin_oauth2_validation_key_cache_evict.start.annobin_oauth2_validation_key_cache_evict.endoauth2_validation_key_cache_evict.cold.0.annobin_smtp_parser.c.annobin_smtp_parser.c_end.annobin_smtp_parser.c.hot.annobin_smtp_parser.c_end.hot.annobin_smtp_parser.c.unlikely.annobin_smtp_parser.c_end.unlikely.annobin_smtp_parser.c.startup.annobin_smtp_parser.c_end.startup.annobin_smtp_parser.c.exit.annobin_smtp_parser.c_end.exit.annobin_smtp_parser_parse_snum.isra.2.start.annobin_smtp_parser_parse_snum.isra.2.endsmtp_parser_parse_snum.isra.2.annobin_smtp_parser_init.start.annobin_smtp_parser_init.end.annobin_smtp_parser_parse_domain.start.annobin_smtp_parser_parse_domain.end.annobin_smtp_parser_parse_address_literal.start.annobin_smtp_parser_parse_address_literal.end.annobin_smtp_parser_parse_quoted_string.start.annobin_smtp_parser_parse_quoted_string.end.annobin_smtp_parser_parse_atom.start.annobin_smtp_parser_parse_atom.end.annobin_smtp_parser_parse_string.start.annobin_smtp_parser_parse_string.end.annobin_smtp_parser_parse_xtext.start.annobin_smtp_parser_parse_xtext.end.annobin_smtp_syntax.c.annobin_smtp_syntax.c_end.annobin_smtp_syntax.c.hot.annobin_smtp_syntax.c_end.hot.annobin_smtp_syntax.c.unlikely.annobin_smtp_syntax.c_end.unlikely.annobin_smtp_syntax.c.startup.annobin_smtp_syntax.c_end.startup.annobin_smtp_syntax.c.exit.annobin_smtp_syntax.c_end.exit.annobin_smtp_string_parse.start.annobin_smtp_string_parse.end.annobin_smtp_string_write.start.annobin_smtp_string_write.endsmtp_string_write.cold.8__func__.5084.annobin_smtp_xtext_decode.start.annobin_smtp_xtext_decode.end.annobin_smtp_xtext_parse.start.annobin_smtp_xtext_parse.end.annobin_smtp_xtext_encode.start.annobin_smtp_xtext_encode.end.annobin_smtp_helo_domain_parse.start.annobin_smtp_helo_domain_parse.end.annobin_smtp_ehlo_keyword_is_valid.start.annobin_smtp_ehlo_keyword_is_valid.end.annobin_smtp_ehlo_param_is_valid.start.annobin_smtp_ehlo_param_is_valid.end.annobin_smtp_ehlo_params_are_valid.start.annobin_smtp_ehlo_params_are_valid.end.annobin_smtp_ehlo_params_str_is_valid.start.annobin_smtp_ehlo_params_str_is_valid.end.annobin_smtp_ehlo_line_parse.start.annobin_smtp_ehlo_line_parse.endsmtp_ehlo_line_parse.cold.9__func__.4770.annobin_smtp_address.c.annobin_smtp_address.c_end.annobin_smtp_address.c.hot.annobin_smtp_address.c_end.hot.annobin_smtp_address.c.unlikely.annobin_smtp_address.c_end.unlikely.annobin_smtp_address.c.startup.annobin_smtp_address.c_end.startup.annobin_smtp_address.c.exit.annobin_smtp_address.c_end.exit.annobin_smtp_address_parse_any.start.annobin_smtp_address_parse_any.end.annobin_smtp_parse_mailbox.start.annobin_smtp_parse_mailbox.endsmtp_parse_mailboxsmtp_parse_mailbox.cold.5__func__.4990.annobin_smtp_address_write.start.annobin_smtp_address_write.endsmtp_address_write.cold.6__func__.5116.annobin_smtp_address_write_path.start.annobin_smtp_address_write_path.end.annobin_smtp_address_encode.start.annobin_smtp_address_encode.end.annobin_smtp_address_encode_path.start.annobin_smtp_address_encode_path.end.annobin_smtp_address_encode_raw.start.annobin_smtp_address_encode_raw.end.annobin_smtp_address_encode_raw_path.start.annobin_smtp_address_encode_raw_path.end.annobin_smtp_address_init.start.annobin_smtp_address_init.end.annobin_smtp_address_detail_parse.start.annobin_smtp_address_detail_parse.end__func__.5076.annobin_smtp_address_detail_parse_temp.start.annobin_smtp_address_detail_parse_temp.end.annobin_smtp_address_init_from_msg.start.annobin_smtp_address_init_from_msg.end.annobin_smtp_address_clone.start.annobin_smtp_address_clone.endsmtp_address_clone.cold.7.annobin_smtp_address_parse_mailbox.start.annobin_smtp_address_parse_mailbox.end.annobin_smtp_address_parse_path_full.start.annobin_smtp_address_parse_path_full.endsmtp_address_parse_path_full.cold.8__func__.5037.annobin_smtp_address_parse_path.start.annobin_smtp_address_parse_path.end.annobin_smtp_address_parse_username.start.annobin_smtp_address_parse_username.end.annobin_smtp_address_create.start.annobin_smtp_address_create.end.annobin_smtp_address_create_from_msg.start.annobin_smtp_address_create_from_msg.end.annobin_smtp_address_clone_temp.start.annobin_smtp_address_clone_temp.end.annobin_smtp_address_create_temp.start.annobin_smtp_address_create_temp.end.annobin_smtp_address_create_from_msg_temp.start.annobin_smtp_address_create_from_msg_temp.end.annobin_smtp_address_add_detail.start.annobin_smtp_address_add_detail.end__func__.5197.annobin_smtp_address_add_detail_temp.start.annobin_smtp_address_add_detail_temp.end__func__.5205.annobin_smtp_address_cmp.start.annobin_smtp_address_cmp.end.annobin_smtp_address_cmp_icase.start.annobin_smtp_address_cmp_icase.end.annobin_smtp_common.c.annobin_smtp_common.c_end.annobin_smtp_common.c.hot.annobin_smtp_common.c_end.hot.annobin_smtp_common.c.unlikely.annobin_smtp_common.c_end.unlikely.annobin_smtp_common.c.startup.annobin_smtp_common.c_end.startup.annobin_smtp_common.c.exit.annobin_smtp_common.c_end.exit.annobin_smtp_capability_find_by_name.start.annobin_smtp_capability_find_by_name.end.annobin_smtp_proxy_data_merge.start.annobin_smtp_proxy_data_merge.end.annobin_smtp_params.c.annobin_smtp_params.c_end.annobin_smtp_params.c.hot.annobin_smtp_params.c_end.hot.annobin_smtp_params.c.unlikely.annobin_smtp_params.c_end.unlikely.annobin_smtp_params.c.startup.annobin_smtp_params.c_end.startup.annobin_smtp_params.c.exit.annobin_smtp_params.c_end.exit.annobin_smtp_param_parse.start.annobin_smtp_param_parse.end.annobin_smtp_params_copy.start.annobin_smtp_params_copy.end.annobin_smtp_params_add_one.start.annobin_smtp_params_add_one.end.annobin_smtp_params_add_encoded.start.annobin_smtp_params_add_encoded.end.annobin_smtp_params_drop_one.start.annobin_smtp_params_drop_one.end.annobin_smtp_param_write.start.annobin_smtp_param_write.end__func__.6415.annobin_smtp_params_write.part.24.start.annobin_smtp_params_write.part.24.endsmtp_params_write.part.24.annobin_smtp_params_get_param.start.annobin_smtp_params_get_param.end.annobin_smtp_params_decode_param.start.annobin_smtp_params_decode_param.end.annobin_smtp_params_equal.start.annobin_smtp_params_equal.end.annobin_smtp_params_mail_copy.start.annobin_smtp_params_mail_copy.end.annobin_smtp_params_mail_add_extra.start.annobin_smtp_params_mail_add_extra.end.annobin_smtp_params_mail_parse.start.annobin_smtp_params_mail_parse.end.annobin_smtp_params_mail_encode_extra.start.annobin_smtp_params_mail_encode_extra.end.annobin_smtp_params_mail_drop_extra.start.annobin_smtp_params_mail_drop_extra.end.annobin_smtp_params_mail_write.start.annobin_smtp_params_mail_write.endsmtp_params_mail_write.cold.26__func__.6552.annobin_smtp_params_mail_get_extra.start.annobin_smtp_params_mail_get_extra.end.annobin_smtp_params_mail_decode_extra.start.annobin_smtp_params_mail_decode_extra.end.annobin_smtp_params_mail_add_to_event.start.annobin_smtp_params_mail_add_to_event.endsmtp_params_mail_add_to_event.cold.27.annobin_smtp_params_rcpt_copy.start.annobin_smtp_params_rcpt_copy.end.annobin_smtp_params_rcpt_add_extra.start.annobin_smtp_params_rcpt_add_extra.end.annobin_smtp_params_rcpt_parse.start.annobin_smtp_params_rcpt_parse.end.annobin_smtp_params_rcpt_encode_extra.start.annobin_smtp_params_rcpt_encode_extra.end.annobin_smtp_params_rcpt_drop_extra.start.annobin_smtp_params_rcpt_drop_extra.end.annobin_smtp_params_rcpt_set_orcpt.start.annobin_smtp_params_rcpt_set_orcpt.end.annobin_smtp_params_rcpt_write.start.annobin_smtp_params_rcpt_write.endsmtp_params_rcpt_write.cold.28__func__.6722__func__.6729.annobin_smtp_params_rcpt_get_extra.start.annobin_smtp_params_rcpt_get_extra.end.annobin_smtp_params_rcpt_decode_extra.start.annobin_smtp_params_rcpt_decode_extra.end.annobin_smtp_params_rcpt_equal.start.annobin_smtp_params_rcpt_equal.end.annobin_smtp_params_rcpt_add_to_event.start.annobin_smtp_params_rcpt_add_to_event.endsmtp_params_rcpt_add_to_event.cold.29__func__.6762__func__.6756.annobin_smtp_reply.c.annobin_smtp_reply.c_end.annobin_smtp_reply.c.hot.annobin_smtp_reply.c_end.hot.annobin_smtp_reply.c.unlikely.annobin_smtp_reply.c_end.unlikely.annobin_smtp_reply.c.startup.annobin_smtp_reply.c_end.startup.annobin_smtp_reply.c.exit.annobin_smtp_reply.c_end.exit.annobin_smtp_reply_write_message_one_line.isra.3.start.annobin_smtp_reply_write_message_one_line.isra.3.endsmtp_reply_write_message_one_line.isra.3.annobin_smtp_reply_init.start.annobin_smtp_reply_init.end.annobin_smtp_reply_printf.start.annobin_smtp_reply_printf.end.annobin_smtp_reply_get_enh_code.start.annobin_smtp_reply_get_enh_code.end.annobin_smtp_reply_get_text_lines_omit_prefix.start.annobin_smtp_reply_get_text_lines_omit_prefix.end.annobin_smtp_reply_write.start.annobin_smtp_reply_write.endsmtp_reply_write.cold.5__func__.4930.annobin_smtp_reply_write_one_line.start.annobin_smtp_reply_write_one_line.endsmtp_reply_write_one_line.cold.6__func__.4947.annobin_smtp_reply_log.start.annobin_smtp_reply_log.end.annobin_smtp_reply_get_message.start.annobin_smtp_reply_get_message.end.annobin_smtp_reply_copy.start.annobin_smtp_reply_copy.end.annobin_smtp_reply_clone.start.annobin_smtp_reply_clone.end.annobin_smtp_reply_add_to_event.start.annobin_smtp_reply_add_to_event.end.annobin_smtp_reply_parser.c.annobin_smtp_reply_parser.c_end.annobin_smtp_reply_parser.c.hot.annobin_smtp_reply_parser.c_end.hot.annobin_smtp_reply_parser.c.unlikely.annobin_smtp_reply_parser.c_end.unlikely.annobin_smtp_reply_parser.c.startup.annobin_smtp_reply_parser.c_end.startup.annobin_smtp_reply_parser.c.exit.annobin_smtp_reply_parser.c_end.exit.annobin_smtp_reply_parser_error.start.annobin_smtp_reply_parser_error.endsmtp_reply_parser_error.annobin_array_idx_i.isra.4.part.5.start.annobin_array_idx_i.isra.4.part.5.endarray_idx_i.isra.4.part.5__func__.4690.annobin_smtp_reply_parse_enhanced_code.start.annobin_smtp_reply_parse_enhanced_code.end.annobin_smtp_reply_parse.start.annobin_smtp_reply_parse.endsmtp_reply_parsesmtp_reply_parse.cold.10__func__.5544__func__.5127.annobin_smtp_reply_parser_init.start.annobin_smtp_reply_parser_init.end.annobin_smtp_reply_parser_deinit.start.annobin_smtp_reply_parser_deinit.end.annobin_smtp_reply_parser_set_stream.start.annobin_smtp_reply_parser_set_stream.end.annobin_smtp_reply_parse_next.start.annobin_smtp_reply_parse_next.endsmtp_reply_parse_next.cold.11__func__.5552.annobin_smtp_reply_parse_ehlo.start.annobin_smtp_reply_parse_ehlo.endsmtp_reply_parse_ehlo.cold.12__func__.5559.annobin_smtp_command_parser.c.annobin_smtp_command_parser.c_end.annobin_smtp_command_parser.c.hot.annobin_smtp_command_parser.c_end.hot.annobin_smtp_command_parser.c.unlikely.annobin_smtp_command_parser.c_end.unlikely.annobin_smtp_command_parser.c.startup.annobin_smtp_command_parser.c_end.startup.annobin_smtp_command_parser.c.exit.annobin_smtp_command_parser.c_end.exit.annobin_smtp_command_parser_error.start.annobin_smtp_command_parser_error.endsmtp_command_parser_error.annobin_smtp_command_parse_finish_data.start.annobin_smtp_command_parse_finish_data.endsmtp_command_parse_finish_data.annobin_smtp_command_parse.start.annobin_smtp_command_parse.endsmtp_command_parse__func__.5340smtp_command_parse.cold.3__func__.5377__func__.5328.annobin_smtp_command_parser_init.start.annobin_smtp_command_parser_init.end.annobin_smtp_command_parser_deinit.start.annobin_smtp_command_parser_deinit.end.annobin_smtp_command_parser_set_stream.start.annobin_smtp_command_parser_set_stream.end.annobin_smtp_command_parser_pending_data.start.annobin_smtp_command_parser_pending_data.end.annobin_smtp_command_parse_next.start.annobin_smtp_command_parse_next.end__func__.5402smtp_command_parse_next.cold.4.annobin_smtp_command_parse_data_with_size.start.annobin_smtp_command_parse_data_with_size.endsmtp_command_parse_data_with_size.cold.5__func__.5407.annobin_smtp_command_parse_data_with_dot.start.annobin_smtp_command_parse_data_with_dot.endsmtp_command_parse_data_with_dot.cold.6__func__.5413.annobin_smtp_command_parse_auth_response.start.annobin_smtp_command_parse_auth_response.end__func__.5421smtp_command_parse_auth_response.cold.7.annobin_smtp_client_command.c.annobin_smtp_client_command.c_end.annobin_smtp_client_command.c.hot.annobin_smtp_client_command.c_end.hot.annobin_smtp_client_command.c.unlikely.annobin_smtp_client_command.c_end.unlikely.annobin_smtp_client_command.c.startup.annobin_smtp_client_command.c_end.startup.annobin_smtp_client_command.c.exit.annobin_smtp_client_command.c_end.exit.annobin_smtp_client_command_insert_prioritized.start.annobin_smtp_client_command_insert_prioritized.endsmtp_client_command_insert_prioritized.annobin_smtp_client_command_payload_input.start.annobin_smtp_client_command_payload_input.endsmtp_client_command_payload_input.annobin_smtp_client_command_disconnected.start.annobin_smtp_client_command_disconnected.endsmtp_client_command_disconnected.annobin_array_idx_i.isra.5.part.6.start.annobin_array_idx_i.isra.5.part.6.endarray_idx_i.isra.5.part.6.annobin_smtp_client_command_get_name.part.7.start.annobin_smtp_client_command_get_name.part.7.endsmtp_client_command_get_name.part.7.annobin_smtp_client_command_update_event.start.annobin_smtp_client_command_update_event.endsmtp_client_command_update_event.annobin_smtp_client_command_finish_dot_stream.start.annobin_smtp_client_command_finish_dot_stream.endsmtp_client_command_finish_dot_streamsmtp_client_command_finish_dot_stream.cold.17__func__.8032.annobin_smtp_client_command_create.start.annobin_smtp_client_command_create.endsmtp_client_command_create.annobin_smtp_client_command_new.start.annobin_smtp_client_command_new.endsmtp_client_command_new.cold.18__func__.7865.annobin_smtp_client_command_ref.start.annobin_smtp_client_command_ref.end.annobin_smtp_client_command_unref.start.annobin_smtp_client_command_unref.endsmtp_client_command_unref.cold.19__func__.7879.annobin_smtp_client_command_name_equals.start.annobin_smtp_client_command_name_equals.end.annobin_smtp_client_command_lock.start.annobin_smtp_client_command_lock.end.annobin_smtp_client_command_unlock.start.annobin_smtp_client_command_unlock.end.annobin_smtp_client_command_drop_callback.start.annobin_smtp_client_command_drop_callback.end.annobin_smtp_client_command_abort.start.annobin_smtp_client_command_abort.end__func__.7907smtp_client_command_abort.cold.20.annobin_smtp_client_command_fail_reply.start.annobin_smtp_client_command_fail_reply.endsmtp_client_command_fail_reply.cold.21__func__.7928.annobin_smtp_client_commands_fail_delayed.start.annobin_smtp_client_commands_fail_delayed.endsmtp_client_commands_fail_delayed.cold.22__func__.7945.annobin_smtp_client_command_fail.start.annobin_smtp_client_command_fail.end.annobin_smtp_client_commands_list_abort.start.annobin_smtp_client_commands_list_abort.endsmtp_client_commands_list_abort.cold.23__func__.7959.annobin_smtp_client_commands_list_fail_reply.start.annobin_smtp_client_commands_list_fail_reply.endsmtp_client_commands_list_fail_reply.cold.24__func__.7980.annobin_smtp_client_commands_abort_delayed.start.annobin_smtp_client_commands_abort_delayed.end.annobin_smtp_client_command_set_abort_callback.start.annobin_smtp_client_command_set_abort_callback.end.annobin__cmd_data_context_free.start.annobin__cmd_data_context_free.end_cmd_data_context_free.annobin__cmd_data_abort_cb.start.annobin__cmd_data_abort_cb.end_cmd_data_abort_cb.annobin_smtp_client_command_set_sent_callback.start.annobin_smtp_client_command_set_sent_callback.end.annobin_smtp_client_command_set_replies.start.annobin_smtp_client_command_set_replies.end__func__.8019smtp_client_command_set_replies.cold.25.annobin_smtp_client_command_send_more.start.annobin_smtp_client_command_send_more.endsmtp_client_command_send_more.cold.26__func__.8067__func__.8047__func__.8089__func__.8083__func__.8025.annobin_smtp_client_command_submit_after.start.annobin_smtp_client_command_submit_after.endsmtp_client_command_submit_after.cold.27__func__.8117.annobin_smtp_client_command_plug.start.annobin_smtp_client_command_plug.end.annobin__cmd_data_cb.start.annobin__cmd_data_cb.end_cmd_data_cb_cmd_data_cb.cold.28__func__.8296.annobin_smtp_client_command_submit.start.annobin_smtp_client_command_submit.end.annobin_smtp_client_command_set_flags.start.annobin_smtp_client_command_set_flags.end.annobin_smtp_client_command_write.start.annobin_smtp_client_command_write.endsmtp_client_command_write.cold.29__func__.8134.annobin_smtp_client_command_vprintf.start.annobin_smtp_client_command_vprintf.end.annobin_smtp_client_command_printf.start.annobin_smtp_client_command_printf.end.annobin_smtp_client_command_set_stream.start.annobin_smtp_client_command_set_stream.endsmtp_client_command_set_stream.cold.30__func__.8152.annobin_smtp_client_command_input_reply.start.annobin_smtp_client_command_input_reply.endsmtp_client_command_input_reply.cold.31__func__.8161.annobin_smtp_client_command_get_state.start.annobin_smtp_client_command_get_state.end.annobin__cmd_bdat_send_chunks.start.annobin__cmd_bdat_send_chunks.end_cmd_bdat_send_chunks_cmd_bdat_cb_cmd_bdat_sent_cb_cmd_bdat_send_chunks.cold.32__func__.8329.annobin__cmd_bdat_sent_cb.start.annobin__cmd_bdat_sent_cb.end.annobin__cmd_bdat_cb.start.annobin__cmd_bdat_cb.end_cmd_bdat_cb.cold.33__func__.8302.annobin_smtp_client_command_noop_submit_after.start.annobin_smtp_client_command_noop_submit_after.end.annobin_smtp_client_command_noop_submit.start.annobin_smtp_client_command_noop_submit.end.annobin_smtp_client_command_vrfy_submit_after.start.annobin_smtp_client_command_vrfy_submit_after.end.annobin_smtp_client_command_vrfy_submit.start.annobin_smtp_client_command_vrfy_submit.end.annobin_smtp_client_command_rset_submit_after.start.annobin_smtp_client_command_rset_submit_after.end.annobin_smtp_client_command_rset_submit.start.annobin_smtp_client_command_rset_submit.end.annobin_smtp_client_command_mail_submit_after.start.annobin_smtp_client_command_mail_submit_after.endsmtp_client_command_mail_submit_after.cold.34.annobin_smtp_client_command_mail_submit.start.annobin_smtp_client_command_mail_submit.end.annobin_smtp_client_command_rcpt_submit_after.start.annobin_smtp_client_command_rcpt_submit_after.endsmtp_client_command_rcpt_submit_after.cold.35.annobin_smtp_client_command_rcpt_submit.start.annobin_smtp_client_command_rcpt_submit.end.annobin_smtp_client_command_data_submit_after.start.annobin_smtp_client_command_data_submit_after.endsmtp_client_command_data_submit_after.cold.36__func__.8347.annobin_smtp_client_command_data_submit.start.annobin_smtp_client_command_data_submit.end.annobin_smtp_client_transaction.c.annobin_smtp_client_transaction.c_end.annobin_smtp_client_transaction.c.hot.annobin_smtp_client_transaction.c_end.hot.annobin_smtp_client_transaction.c.unlikely.annobin_smtp_client_transaction.c_end.unlikely.annobin_smtp_client_transaction.c.startup.annobin_smtp_client_transaction.c_end.startup.annobin_smtp_client_transaction.c.exit.annobin_smtp_client_transaction.c_end.exit.annobin_smtp_client_transaction_mail_free.start.annobin_smtp_client_transaction_mail_free.endsmtp_client_transaction_mail_free.annobin_smtp_client_transaction_mail_replied.start.annobin_smtp_client_transaction_mail_replied.endsmtp_client_transaction_mail_repliedsmtp_client_transaction_mail_fail_reply.annobin_smtp_client_transaction_result_event.start.annobin_smtp_client_transaction_result_event.endsmtp_client_transaction_result_event.annobin_smtp_client_transaction_rcpt_free.start.annobin_smtp_client_transaction_rcpt_free.endsmtp_client_transaction_rcpt_freesmtp_client_transaction_rcpt_free.cold.4__func__.7886.annobin_smtp_client_transaction_rcpt_fail_reply.start.annobin_smtp_client_transaction_rcpt_fail_reply.endsmtp_client_transaction_rcpt_fail_reply.annobin_smtp_client_transaction_mail_new.start.annobin_smtp_client_transaction_mail_new.endsmtp_client_transaction_mail_new.annobin_smtp_client_transaction_rcpt_new.start.annobin_smtp_client_transaction_rcpt_new.endsmtp_client_transaction_rcpt_new.annobin_smtp_client_transaction_mail_abort.start.annobin_smtp_client_transaction_mail_abort.end__func__.7858.annobin_smtp_client_transaction_rcpt_abort.start.annobin_smtp_client_transaction_rcpt_abort.end__func__.7917smtp_client_transaction_rcpt_abort.cold.5.annobin_smtp_client_transaction_rcpt_set_data_callback.start.annobin_smtp_client_transaction_rcpt_set_data_callback.endsmtp_client_transaction_rcpt_set_data_callback.cold.6__func__.7941.annobin_smtp_client_transaction_create_empty.start.annobin_smtp_client_transaction_create_empty.end.annobin_smtp_client_transaction_create.start.annobin_smtp_client_transaction_create.end.annobin_smtp_client_transaction_ref.start.annobin_smtp_client_transaction_ref.end.annobin_smtp_client_transaction_unref.start.annobin_smtp_client_transaction_unref.endsmtp_client_transaction_unref.cold.7__func__.8005.annobin_smtp_client_transaction_abort.start.annobin_smtp_client_transaction_abort.endsmtp_client_transaction_abort.cold.8__func__.7996.annobin_smtp_client_transaction_try_complete.start.annobin_smtp_client_transaction_try_complete.endsmtp_client_transaction_try_completesmtp_client_transaction_try_complete.cold.9__func__.8225.annobin_smtp_client_transaction_rcpt_cb.start.annobin_smtp_client_transaction_rcpt_cb.endsmtp_client_transaction_rcpt_cbsmtp_client_transaction_rcpt_cb.cold.10__func__.7891.annobin_smtp_client_transaction_finish.start.annobin_smtp_client_transaction_finish.endsmtp_client_transaction_finishsmtp_client_transaction_finish.cold.11__func__.7976.annobin_smtp_client_transaction_rset_cb.start.annobin_smtp_client_transaction_rset_cb.endsmtp_client_transaction_rset_cb.annobin_smtp_client_transaction_data_cb.start.annobin_smtp_client_transaction_data_cb.endsmtp_client_transaction_data_cbsmtp_client_transaction_data_cb.cold.12__func__.7933__func__.8149.annobin_smtp_client_transaction_destroy.start.annobin_smtp_client_transaction_destroy.end.annobin_smtp_client_transaction_fail_reply.start.annobin_smtp_client_transaction_fail_reply.endsmtp_client_transaction_fail_reply.cold.13__func__.8034.annobin_smtp_client_transaction_fail.start.annobin_smtp_client_transaction_fail.end.annobin_smtp_client_transaction_mail_cb.start.annobin_smtp_client_transaction_mail_cb.endsmtp_client_transaction_mail_cbsmtp_client_transaction_mail_cb.cold.14__func__.8077.annobin_smtp_client_transaction_set_event.start.annobin_smtp_client_transaction_set_event.endsmtp_client_transaction_set_event.cold.15__func__.8058.annobin_smtp_client_transaction_set_timeout.start.annobin_smtp_client_transaction_set_timeout.endsmtp_client_transaction_timeoutsmtp_client_transaction_set_timeout.cold.16__func__.8068.annobin_smtp_client_transaction_start.start.annobin_smtp_client_transaction_start.endsmtp_client_transaction_submit_moresmtp_client_transaction_start.cold.17__func__.8101.annobin_smtp_client_transaction_submit_more.start.annobin_smtp_client_transaction_submit_more.endsmtp_client_transaction_submit_more.cold.18__func__.8158__func__.8182__func__.8197.annobin_smtp_client_transaction_submit.start.annobin_smtp_client_transaction_submit.endsmtp_client_transaction_submit.annobin_smtp_client_transaction_add_mail.start.annobin_smtp_client_transaction_add_mail.endsmtp_client_transaction_add_mail.cold.19.annobin_smtp_client_transaction_start_empty.start.annobin_smtp_client_transaction_start_empty.endsmtp_client_transaction_start_empty.cold.20__func__.8111.annobin_smtp_client_transaction_add_rcpt.start.annobin_smtp_client_transaction_add_rcpt.endsmtp_client_transaction_add_rcpt.cold.21__func__.8132.annobin_smtp_client_transaction_add_pool_rcpt.start.annobin_smtp_client_transaction_add_pool_rcpt.endsmtp_client_transaction_add_pool_rcpt.cold.22__func__.8143.annobin_smtp_client_transaction_send.start.annobin_smtp_client_transaction_send.endsmtp_client_transaction_send.cold.23__func__.8170.annobin_smtp_client_transaction_reset.start.annobin_smtp_client_transaction_reset.endsmtp_client_transaction_reset.cold.24__func__.8191.annobin_smtp_client_transaction_set_immediate.start.annobin_smtp_client_transaction_set_immediate.end.annobin_smtp_client_transaction_connection_result.start.annobin_smtp_client_transaction_connection_result.end.annobin_smtp_client_transaction_connection_destroyed.start.annobin_smtp_client_transaction_connection_destroyed.endsmtp_client_transaction_connection_destroyed.cold.25__func__.8242.annobin_smtp_client_transaction_get_times.start.annobin_smtp_client_transaction_get_times.end.annobin_smtp_client_transaction_get_state.start.annobin_smtp_client_transaction_get_state.end.annobin_smtp_client_transaction_get_state_name.start.annobin_smtp_client_transaction_get_state_name.endsmtp_client_transaction_get_state_name.cold.26__func__.8252.annobin_smtp_client_transaction_get_state_destription.start.annobin_smtp_client_transaction_get_state_destription.endsmtp_client_transaction_get_state_destription.cold.27__func__.8260.annobin_smtp_client_transaction_timeout.start.annobin_smtp_client_transaction_timeout.end.annobin_smtp_client_transaction_switch_ioloop.start.annobin_smtp_client_transaction_switch_ioloop.end.annobin_smtp_client_connection.c.annobin_smtp_client_connection.c_end.annobin_smtp_client_connection.c.hot.annobin_smtp_client_connection.c_end.hot.annobin_smtp_client_connection.c.unlikely.annobin_smtp_client_connection.c_end.unlikely.annobin_smtp_client_connection.c.startup.annobin_smtp_client_connection.c_end.startup.annobin_smtp_client_connection.c.exit.annobin_smtp_client_connection.c_end.exit.annobin_smtp_client_connection_rset_dummy_cb.start.annobin_smtp_client_connection_rset_dummy_cb.endsmtp_client_connection_rset_dummy_cb.annobin_smtp_client_connection_find_extra_capability.start.annobin_smtp_client_connection_find_extra_capability.endsmtp_client_connection_find_extra_capability.annobin_smtp_client_connection_streams_changed.start.annobin_smtp_client_connection_streams_changed.endsmtp_client_connection_streams_changed.annobin_smtp_client_connection_handshake.start.annobin_smtp_client_connection_handshake.endsmtp_client_connection_handshakesmtp_client_connection_handshake_cb.annobin_smtp_client_connection_xclient_submit.start.annobin_smtp_client_connection_xclient_submit.endsmtp_client_connection_xclient_submitsmtp_client_connection_xclient_cb.annobin_smtp_client_connection_auth_deinit.start.annobin_smtp_client_connection_auth_deinit.endsmtp_client_connection_auth_deinit.annobin_smtp_client_connection_commands_fail_reply.start.annobin_smtp_client_connection_commands_fail_reply.endsmtp_client_connection_commands_fail_reply.annobin_smtp_client_connection_xclient_add.start.annobin_smtp_client_connection_xclient_add.endsmtp_client_connection_xclient_addsmtp_client_connection_xclient_add.cold.39__func__.8598.annobin_smtp_client_connection_start_transaction.start.annobin_smtp_client_connection_start_transaction.endsmtp_client_connection_start_transactionsmtp_client_connection_do_start_transaction.annobin_smtp_client_connection_do_connect.part.10.start.annobin_smtp_client_connection_do_connect.part.10.endsmtp_client_connection_do_connect.part.10smtp_client_connection_connect_timeoutsmtp_client_connection_delayed_connect_errorsmtp_client_connection_do_connect.part.10.cold.40__func__.8854.annobin_smtp_client_connection_connect_next_ip.start.annobin_smtp_client_connection_connect_next_ip.endsmtp_client_connection_connect_next_ip.annobin_smtp_client_connection_connect_unix.start.annobin_smtp_client_connection_connect_unix.endsmtp_client_connection_connect_unix.annobin_smtp_client_connection_established.start.annobin_smtp_client_connection_established.endsmtp_client_connection_establishedsmtp_client_connection_outputsmtp_client_connection_established.cold.41__func__.8793.annobin_smtp_client_connection_ssl_init.start.annobin_smtp_client_connection_ssl_init.endsmtp_client_connection_ssl_initsmtp_client_connection_ssl_handshaked.annobin_smtp_client_connection_ssl_handshaked.start.annobin_smtp_client_connection_ssl_handshaked.end.annobin_smtp_client_connection_record_param_extensions.isra.17.start.annobin_smtp_client_connection_record_param_extensions.isra.17.endsmtp_client_connection_record_param_extensions.isra.17smtp_client_connection_record_param_extensions.isra.17.cold.42__func__.8696.annobin_smtp_client_connection_clear_password.part.18.start.annobin_smtp_client_connection_clear_password.part.18.endsmtp_client_connection_clear_password.part.18.annobin_smtp_client_connection_do_start_transaction.start.annobin_smtp_client_connection_do_start_transaction.end.annobin_smtp_client_connection_xclient_addf.constprop.34.start.annobin_smtp_client_connection_xclient_addf.constprop.34.endsmtp_client_connection_xclient_addf.constprop.34.annobin_smtp_client_connection_transactions_fail.constprop.37.start.annobin_smtp_client_connection_transactions_fail.constprop.37.endsmtp_client_connection_transactions_fail.constprop.37.annobin_smtp_client_connection_login_callback.start.annobin_smtp_client_connection_login_callback.endsmtp_client_connection_login_callbacksmtp_client_connection_login_callback.cold.43__func__.4722__func__.8499.annobin_smtp_client_connection_already_connected.start.annobin_smtp_client_connection_already_connected.endsmtp_client_connection_already_connectedsmtp_client_connection_already_connected.cold.44__func__.8905.annobin_smtp_client_connection_dns_callback.start.annobin_smtp_client_connection_dns_callback.endsmtp_client_connection_dns_callbacksmtp_client_connection_delayed_host_lookup_failuresmtp_client_connection_dns_callback.cold.45__func__.8883.annobin_smtp_client_connection_do_create.start.annobin_smtp_client_connection_do_create.endsmtp_client_connection_do_createsmtp_client_connection_do_create.cold.46__func__.8944.annobin_smtp_client_connection_get_capabilities.start.annobin_smtp_client_connection_get_capabilities.end.annobin_smtp_client_connection_get_size_capability.start.annobin_smtp_client_connection_get_size_capability.end.annobin_smtp_client_connection_accept_extra_capability.start.annobin_smtp_client_connection_accept_extra_capability.endsmtp_client_connection_accept_extra_capability.cold.47__func__.8433.annobin_smtp_client_connection_get_extra_capability.start.annobin_smtp_client_connection_get_extra_capability.end.annobin_smtp_client_connection_cork.start.annobin_smtp_client_connection_cork.end.annobin_smtp_client_connection_get_state.start.annobin_smtp_client_connection_get_state.end.annobin_smtp_client_connection_start_cmd_timeout.start.annobin_smtp_client_connection_start_cmd_timeout.endsmtp_client_command_timeout.annobin_smtp_client_connection_update_cmd_timeout.start.annobin_smtp_client_connection_update_cmd_timeout.end.annobin_smtp_client_connection_send_xclient.start.annobin_smtp_client_connection_send_xclient.endsmtp_client_connection_send_xclient.cold.48__func__.8614.annobin_smtp_client_connection_trigger_output.start.annobin_smtp_client_connection_trigger_output.end.annobin_smtp_client_connection_connect.start.annobin_smtp_client_connection_connect.endsmtp_client_connection_connect.cold.49__func__.8910.annobin_smtp_client_connection_list_init.start.annobin_smtp_client_connection_list_init.endsmtp_client_connection_vfuncssmtp_client_connection_set.annobin_smtp_client_connection_disconnect.start.annobin_smtp_client_connection_disconnect.end.annobin_smtp_client_connection_create.start.annobin_smtp_client_connection_create.end.annobin_smtp_client_connection_create_ip.start.annobin_smtp_client_connection_create_ip.end.annobin_smtp_client_connection_create_unix.start.annobin_smtp_client_connection_create_unix.end.annobin_smtp_client_connection_ref.start.annobin_smtp_client_connection_ref.endsmtp_client_connection_ref.cold.50__func__.8979.annobin_smtp_client_connection_unref.start.annobin_smtp_client_connection_unref.endsmtp_client_connection_unref.cold.51__func__.8984.annobin_smtp_client_connection_fail_reply.start.annobin_smtp_client_connection_fail_reply.endsmtp_client_connection_fail_reply.annobin_smtp_client_connection_fail.start.annobin_smtp_client_connection_fail.endsmtp_client_connection_fail.cold.52__func__.8859__func__.8551.annobin_smtp_client_connection_connect_timeout.start.annobin_smtp_client_connection_connect_timeout.end.annobin_smtp_client_connection_lost.start.annobin_smtp_client_connection_lost.endsmtp_client_connection_lostsmtp_client_connection_lost.cold.53__func__.8564.annobin_smtp_client_connection_handle_output_error.start.annobin_smtp_client_connection_handle_output_error.end.annobin_smtp_client_connection_uncork.start.annobin_smtp_client_connection_uncork.end.annobin_smtp_client_connection_delayed_host_lookup_failure.start.annobin_smtp_client_connection_delayed_host_lookup_failure.endsmtp_client_connection_delayed_host_lookup_failure.cold.54__func__.8875.annobin_smtp_client_connection_handshake_cb.start.annobin_smtp_client_connection_handshake_cb.endsmtp_client_connection_auth_cbsmtp_client_connection_starttls_cbsmtp_client_connection_handshake_cb.cold.55__func__.8673.annobin_smtp_client_connection_starttls_cb.start.annobin_smtp_client_connection_starttls_cb.end.annobin_smtp_client_connection_auth_cb.start.annobin_smtp_client_connection_auth_cb.endsmtp_client_connection_auth_cb.cold.56__func__.8634.annobin_smtp_client_connection_xclient_cb.start.annobin_smtp_client_connection_xclient_cb.endsmtp_client_connection_xclient_cb.cold.57__func__.8579.annobin_smtp_client_command_timeout.start.annobin_smtp_client_command_timeout.end.annobin_smtp_client_connection_output.start.annobin_smtp_client_connection_output.end.annobin_smtp_client_connection_input.start.annobin_smtp_client_connection_input.endsmtp_client_connection_inputsmtp_client_connection_input.cold.58__func__.8767.annobin_smtp_client_connection_connected.start.annobin_smtp_client_connection_connected.endsmtp_client_connection_connectedsmtp_client_connection_connected.cold.59__func__.8832.annobin_smtp_client_connection_delayed_connect_error.start.annobin_smtp_client_connection_delayed_connect_error.end.annobin_smtp_client_connection_close.start.annobin_smtp_client_connection_close.end.annobin_smtp_client_connection_destroy.start.annobin_smtp_client_connection_destroy.endsmtp_client_connection_destroy.annobin_smtp_client_connection_update_proxy_data.start.annobin_smtp_client_connection_update_proxy_data.end.annobin_smtp_client_connection_switch_ioloop.start.annobin_smtp_client_connection_switch_ioloop.end.annobin_smtp_client_connection_add_transaction.start.annobin_smtp_client_connection_add_transaction.end.annobin_smtp_client_connection_abort_transaction.start.annobin_smtp_client_connection_abort_transaction.endsmtp_client_connection_abort_transaction.cold.60__func__.9031.annobin_smtp_client_connection_next_transaction.start.annobin_smtp_client_connection_next_transaction.endsmtp_client_connection_next_transaction.cold.61__func__.9037.annobin_smtp_client.c.annobin_smtp_client.c_end.annobin_smtp_client.c.hot.annobin_smtp_client.c_end.hot.annobin_smtp_client.c.unlikely.annobin_smtp_client.c_end.unlikely.annobin_smtp_client.c.startup.annobin_smtp_client.c_end.startup.annobin_smtp_client.c.exit.annobin_smtp_client.c_end.exit.annobin_smtp_client_init.start.annobin_smtp_client_init.endevent_category_smtp_client.annobin_smtp_client_deinit.start.annobin_smtp_client_deinit.end.annobin_smtp_client_switch_ioloop.start.annobin_smtp_client_switch_ioloop.end.annobin_smtp_client_init_ssl_ctx.start.annobin_smtp_client_init_ssl_ctx.end.annobin_smtp_server_cmd_helo.c.annobin_smtp_server_cmd_helo.c_end.annobin_smtp_server_cmd_helo.c.hot.annobin_smtp_server_cmd_helo.c_end.hot.annobin_smtp_server_cmd_helo.c.unlikely.annobin_smtp_server_cmd_helo.c_end.unlikely.annobin_smtp_server_cmd_helo.c.startup.annobin_smtp_server_cmd_helo.c_end.startup.annobin_smtp_server_cmd_helo.c.exit.annobin_smtp_server_cmd_helo.c_end.exit.annobin_cmd_helo_next.start.annobin_cmd_helo_next.endcmd_helo_next.annobin_cmd_helo_completed.start.annobin_cmd_helo_completed.endcmd_helo_completedcmd_helo_completed.cold.3__func__.7152.annobin_smtp_server_cmd_ehlo_reply_create.start.annobin_smtp_server_cmd_ehlo_reply_create.endstandard_caps.7190smtp_server_cmd_ehlo_reply_create.cold.4__func__.7200.annobin_smtp_server_cmd_ehlo_reply_default.start.annobin_smtp_server_cmd_ehlo_reply_default.end.annobin_smtp_server_cmd_helo_run.start.annobin_smtp_server_cmd_helo_run.endsmtp_server_cmd_helo_runsmtp_server_cmd_helo_run.cold.5__func__.7174.annobin_smtp_server_cmd_ehlo.start.annobin_smtp_server_cmd_ehlo.end.annobin_smtp_server_cmd_helo.start.annobin_smtp_server_cmd_helo.end.annobin_smtp_server_cmd_starttls.c.annobin_smtp_server_cmd_starttls.c_end.annobin_smtp_server_cmd_starttls.c.hot.annobin_smtp_server_cmd_starttls.c_end.hot.annobin_smtp_server_cmd_starttls.c.unlikely.annobin_smtp_server_cmd_starttls.c_end.unlikely.annobin_smtp_server_cmd_starttls.c.startup.annobin_smtp_server_cmd_starttls.c_end.startup.annobin_smtp_server_cmd_starttls.c.exit.annobin_smtp_server_cmd_starttls.c_end.exit.annobin_cmd_starttls_next.start.annobin_cmd_starttls_next.endcmd_starttls_nextcmd_starttls_destroycmd_starttls_next.cold.1__func__.9300.annobin_cmd_starttls_start.start.annobin_cmd_starttls_start.endcmd_starttls_startcmd_starttls_start.cold.2__func__.9278.annobin_cmd_starttls_destroy.start.annobin_cmd_starttls_destroy.endcmd_starttls_outputcmd_starttls_destroy.cold.3__func__.9290.annobin_cmd_starttls_output.start.annobin_cmd_starttls_output.end.annobin_smtp_server_cmd_starttls.start.annobin_smtp_server_cmd_starttls.endsmtp_server_cmd_starttls.cold.4__func__.9310.annobin_smtp_server_cmd_auth.c.annobin_smtp_server_cmd_auth.c_end.annobin_smtp_server_cmd_auth.c.hot.annobin_smtp_server_cmd_auth.c_end.hot.annobin_smtp_server_cmd_auth.c.unlikely.annobin_smtp_server_cmd_auth.c_end.unlikely.annobin_smtp_server_cmd_auth.c.startup.annobin_smtp_server_cmd_auth.c_end.startup.annobin_smtp_server_cmd_auth.c.exit.annobin_smtp_server_cmd_auth.c_end.exit.annobin_cmd_auth_input.start.annobin_cmd_auth_input.endcmd_auth_inputcmd_auth_input.cold.3.annobin_cmd_auth_check_state.start.annobin_cmd_auth_check_state.endcmd_auth_check_state.annobin_cmd_auth_start.start.annobin_cmd_auth_start.endcmd_auth_startcmd_auth_start.cold.4__func__.7188.annobin_cmd_auth_completed.start.annobin_cmd_auth_completed.endcmd_auth_completedcmd_auth_completed.cold.5__func__.7154.annobin_smtp_server_cmd_auth.start.annobin_smtp_server_cmd_auth.end.annobin_smtp_server_cmd_auth_success.start.annobin_smtp_server_cmd_auth_success.end.annobin_smtp_server_cmd_auth_send_challenge.start.annobin_smtp_server_cmd_auth_send_challenge.endsmtp_server_cmd_auth_send_challenge.cold.6__func__.7179.annobin_smtp_server_cmd_mail.c.annobin_smtp_server_cmd_mail.c_end.annobin_smtp_server_cmd_mail.c.hot.annobin_smtp_server_cmd_mail.c_end.hot.annobin_smtp_server_cmd_mail.c.unlikely.annobin_smtp_server_cmd_mail.c_end.unlikely.annobin_smtp_server_cmd_mail.c.startup.annobin_smtp_server_cmd_mail.c_end.startup.annobin_smtp_server_cmd_mail.c.exit.annobin_smtp_server_cmd_mail.c_end.exit.annobin_cmd_mail_completed.start.annobin_cmd_mail_completed.endcmd_mail_completedcmd_mail_completed.cold.6__func__.7596.annobin_cmd_mail_check_state.start.annobin_cmd_mail_check_state.endcmd_mail_check_state.annobin_cmd_mail_recheck.start.annobin_cmd_mail_recheck.endcmd_mail_recheck.annobin_smtp_server_cmd_mail_reply_success.start.annobin_smtp_server_cmd_mail_reply_success.endsmtp_server_cmd_mail_reply_success.cold.7__func__.7635.annobin_smtp_server_cmd_mail.start.annobin_smtp_server_cmd_mail.endsmtp_server_cmd_mail.cold.8__func__.7621.annobin_smtp_server_cmd_rcpt.c.annobin_smtp_server_cmd_rcpt.c_end.annobin_smtp_server_cmd_rcpt.c.hot.annobin_smtp_server_cmd_rcpt.c_end.hot.annobin_smtp_server_cmd_rcpt.c.unlikely.annobin_smtp_server_cmd_rcpt.c_end.unlikely.annobin_smtp_server_cmd_rcpt.c.startup.annobin_smtp_server_cmd_rcpt.c_end.startup.annobin_smtp_server_cmd_rcpt.c.exit.annobin_smtp_server_cmd_rcpt.c_end.exit.annobin_cmd_rcpt_destroy.start.annobin_cmd_rcpt_destroy.endcmd_rcpt_destroy.annobin_cmd_rcpt_completed.start.annobin_cmd_rcpt_completed.endcmd_rcpt_completedcmd_rcpt_completed.cold.5__func__.7415.annobin_cmd_rcpt_check_state.start.annobin_cmd_rcpt_check_state.endcmd_rcpt_check_state.annobin_cmd_rcpt_recheck.start.annobin_cmd_rcpt_recheck.endcmd_rcpt_recheck.annobin_smtp_server_command_is_rcpt.start.annobin_smtp_server_command_is_rcpt.end.annobin_smtp_server_cmd_rcpt_reply_success.start.annobin_smtp_server_cmd_rcpt_reply_success.endsmtp_server_cmd_rcpt_reply_success.cold.6__func__.7462.annobin_smtp_server_cmd_rcpt.start.annobin_smtp_server_cmd_rcpt.endsmtp_server_cmd_rcpt.cold.7__func__.7453.annobin_smtp_server_cmd_data.c.annobin_smtp_server_cmd_data.c_end.annobin_smtp_server_cmd_data.c.hot.annobin_smtp_server_cmd_data.c_end.hot.annobin_smtp_server_cmd_data.c.unlikely.annobin_smtp_server_cmd_data.c_end.unlikely.annobin_smtp_server_cmd_data.c.startup.annobin_smtp_server_cmd_data.c_end.startup.annobin_smtp_server_cmd_data.c.exit.annobin_smtp_server_cmd_data.c_end.exit.annobin_cmd_data_chunk_completed.start.annobin_cmd_data_chunk_completed.endcmd_data_chunk_completed.annobin_cmd_data_replied_one.start.annobin_cmd_data_replied_one.endcmd_data_replied_one.annobin_cmd_data_chunk_replied.start.annobin_cmd_data_chunk_replied.endcmd_data_chunk_repliedcmd_data_chunk_replied.cold.9__func__.7509.annobin_cmd_data_destroy.start.annobin_cmd_data_destroy.endcmd_data_destroycmd_data_destroy.cold.10__func__.7477.annobin_cmd_data_replied.start.annobin_cmd_data_replied.endcmd_data_repliedcmd_data_replied.cold.11__func__.7496.annobin_cmd_data_completed.start.annobin_cmd_data_completed.endcmd_data_completedcmd_data_completed.cold.12__func__.7502.annobin_smtp_server_cmd_data_check_size.start.annobin_smtp_server_cmd_data_check_size.endsmtp_server_cmd_data_check_size.cold.13__func__.7464.annobin_smtp_server_connection_data_check_state.start.annobin_smtp_server_connection_data_check_state.end.annobin_cmd_data_handle_input.start.annobin_cmd_data_handle_input.endcmd_data_handle_inputcmd_data_handle_input.cold.14__func__.7538.annobin_cmd_data_input.start.annobin_cmd_data_input.endcmd_data_input.annobin_cmd_data_next.start.annobin_cmd_data_next.endcmd_data_nextcmd_data_next.cold.15__func__.7560.annobin_cmd_data_start_input.start.annobin_cmd_data_start_input.endcmd_data_start_inputcmd_data_start_input.cold.16__func__.7574.annobin_cmd_data_start.start.annobin_cmd_data_start.endcmd_data_startcmd_data_start.cold.17__func__.7588.annobin_smtp_server_cmd_data.start.annobin_smtp_server_cmd_data.end.annobin_smtp_server_connection_data_chunk_init.start.annobin_smtp_server_connection_data_chunk_init.endsmtp_server_connection_data_chunk_init.cold.18__func__.7614.annobin_smtp_server_connection_data_chunk_add.start.annobin_smtp_server_connection_data_chunk_add.endsmtp_server_connection_data_chunk_add.cold.19__func__.7628.annobin_smtp_server_cmd_bdat.start.annobin_smtp_server_cmd_bdat.end.annobin_smtp_server_cmd_rset.c.annobin_smtp_server_cmd_rset.c_end.annobin_smtp_server_cmd_rset.c.hot.annobin_smtp_server_cmd_rset.c_end.hot.annobin_smtp_server_cmd_rset.c.unlikely.annobin_smtp_server_cmd_rset.c_end.unlikely.annobin_smtp_server_cmd_rset.c.startup.annobin_smtp_server_cmd_rset.c_end.startup.annobin_smtp_server_cmd_rset.c.exit.annobin_smtp_server_cmd_rset.c_end.exit.annobin_cmd_rset_completed.start.annobin_cmd_rset_completed.endcmd_rset_completedcmd_rset_completed.cold.2__func__.6769.annobin_smtp_server_cmd_rset_reply_success.start.annobin_smtp_server_cmd_rset_reply_success.endsmtp_server_cmd_rset_reply_success.cold.3__func__.6784.annobin_smtp_server_cmd_rset.start.annobin_smtp_server_cmd_rset.endsmtp_server_cmd_rset.cold.4__func__.6780.annobin_smtp_server_cmd_noop.c.annobin_smtp_server_cmd_noop.c_end.annobin_smtp_server_cmd_noop.c.hot.annobin_smtp_server_cmd_noop.c_end.hot.annobin_smtp_server_cmd_noop.c.unlikely.annobin_smtp_server_cmd_noop.c_end.unlikely.annobin_smtp_server_cmd_noop.c.startup.annobin_smtp_server_cmd_noop.c_end.startup.annobin_smtp_server_cmd_noop.c.exit.annobin_smtp_server_cmd_noop.c_end.exit.annobin_smtp_server_cmd_noop_reply_success.start.annobin_smtp_server_cmd_noop_reply_success.endsmtp_server_cmd_noop_reply_success.cold.1__func__.6819.annobin_smtp_server_cmd_noop.start.annobin_smtp_server_cmd_noop.endsmtp_server_cmd_noop.cold.2__func__.6815.annobin_smtp_server_cmd_quit.c.annobin_smtp_server_cmd_quit.c_end.annobin_smtp_server_cmd_quit.c.hot.annobin_smtp_server_cmd_quit.c_end.hot.annobin_smtp_server_cmd_quit.c.unlikely.annobin_smtp_server_cmd_quit.c_end.unlikely.annobin_smtp_server_cmd_quit.c.startup.annobin_smtp_server_cmd_quit.c_end.startup.annobin_smtp_server_cmd_quit.c.exit.annobin_smtp_server_cmd_quit.c_end.exit.annobin_smtp_server_cmd_quit.start.annobin_smtp_server_cmd_quit.endsmtp_server_cmd_quit.cold.0__func__.6771.annobin_smtp_server_cmd_vrfy.c.annobin_smtp_server_cmd_vrfy.c_end.annobin_smtp_server_cmd_vrfy.c.hot.annobin_smtp_server_cmd_vrfy.c_end.hot.annobin_smtp_server_cmd_vrfy.c.unlikely.annobin_smtp_server_cmd_vrfy.c_end.unlikely.annobin_smtp_server_cmd_vrfy.c.startup.annobin_smtp_server_cmd_vrfy.c_end.startup.annobin_smtp_server_cmd_vrfy.c.exit.annobin_smtp_server_cmd_vrfy.c_end.exit.annobin_smtp_server_cmd_vrfy_reply_default.start.annobin_smtp_server_cmd_vrfy_reply_default.endsmtp_server_cmd_vrfy_reply_default.cold.1.annobin_smtp_server_cmd_vrfy.start.annobin_smtp_server_cmd_vrfy.endsmtp_server_cmd_vrfy.cold.2.annobin_smtp_server_cmd_xclient.c.annobin_smtp_server_cmd_xclient.c_end.annobin_smtp_server_cmd_xclient.c.hot.annobin_smtp_server_cmd_xclient.c_end.hot.annobin_smtp_server_cmd_xclient.c.unlikely.annobin_smtp_server_cmd_xclient.c_end.unlikely.annobin_smtp_server_cmd_xclient.c.startup.annobin_smtp_server_cmd_xclient.c_end.startup.annobin_smtp_server_cmd_xclient.c.exit.annobin_smtp_server_cmd_xclient.c_end.exit.annobin_cmd_xclient_completed.start.annobin_cmd_xclient_completed.endcmd_xclient_completedcmd_xclient_completed.cold.8__func__.7428.annobin_cmd_xclient_recheck.start.annobin_cmd_xclient_recheck.endcmd_xclient_recheck.annobin_smtp_server_cmd_xclient.start.annobin_smtp_server_cmd_xclient.end.annobin_smtp_server_reply.c.annobin_smtp_server_reply.c_end.annobin_smtp_server_reply.c.hot.annobin_smtp_server_reply.c_end.hot.annobin_smtp_server_reply.c.unlikely.annobin_smtp_server_reply.c_end.unlikely.annobin_smtp_server_reply.c.startup.annobin_smtp_server_reply.c_end.startup.annobin_smtp_server_reply.c.exit.annobin_smtp_server_reply.c_end.exit.annobin_smtp_server_reply_destroy.start.annobin_smtp_server_reply_destroy.endsmtp_server_reply_destroy.annobin_smtp_server_reply_alloc.start.annobin_smtp_server_reply_alloc.endsmtp_server_reply_allocsmtp_server_reply_alloc.cold.9__func__.8075__func__.8086.annobin_smtp_server_reply_write_one_line.start.annobin_smtp_server_reply_write_one_line.endsmtp_server_reply_write_one_linesmtp_server_reply_write_one_line.cold.10__func__.8292.annobin_smtp_server_reply_get_path_len.isra.4.start.annobin_smtp_server_reply_get_path_len.isra.4.endsmtp_server_reply_get_path_len.isra.4smtp_server_reply_get_path_len.isra.4.cold.11.annobin_smtp_server_reply_update_event.start.annobin_smtp_server_reply_update_event.endsmtp_server_reply_update_event.annobin_smtp_server_reply_set_status.start.annobin_smtp_server_reply_set_status.endsmtp_server_reply_set_status.cold.12__func__.8110.annobin_smtp_server_reply_get_status.start.annobin_smtp_server_reply_get_status.end.annobin_smtp_server_reply_create_index.start.annobin_smtp_server_reply_create_index.endsmtp_server_reply_create_index.cold.13__func__.8123.annobin_smtp_server_reply_create.start.annobin_smtp_server_reply_create.end.annobin_smtp_server_reply_create_forward.start.annobin_smtp_server_reply_create_forward.endsmtp_server_reply_create_forward.cold.14__func__.8139.annobin_smtp_server_reply_free.start.annobin_smtp_server_reply_free.end.annobin_smtp_server_reply_add_text.start.annobin_smtp_server_reply_add_text.endsmtp_server_reply_add_text.cold.15__func__.8156.annobin_smtp_server_reply_prepend_text.start.annobin_smtp_server_reply_prepend_text.endsmtp_server_reply_prepend_text.cold.16__func__.8180.annobin_smtp_server_reply_replace_path.start.annobin_smtp_server_reply_replace_path.endsmtp_server_reply_replace_path.cold.17__func__.8189.annobin_smtp_server_reply_submit.start.annobin_smtp_server_reply_submit.endsmtp_server_reply_submit.cold.18__func__.8193.annobin_smtp_server_reply_submit_duplicate.start.annobin_smtp_server_reply_submit_duplicate.endsmtp_server_reply_submit_duplicate.cold.19__func__.8203.annobin_smtp_server_reply_allv.start.annobin_smtp_server_reply_allv.endsmtp_server_reply_allv__func__.8258.annobin_smtp_server_reply_indexv.start.annobin_smtp_server_reply_indexv.end.annobin_smtp_server_reply.start.annobin_smtp_server_reply.endsmtp_server_reply.cold.20__func__.8222.annobin_smtp_server_reply_index.start.annobin_smtp_server_reply_index.end.annobin_smtp_server_reply_index_forward.start.annobin_smtp_server_reply_index_forward.end.annobin_smtp_server_reply_forward.start.annobin_smtp_server_reply_forward.endsmtp_server_reply_forward.cold.21__func__.8241.annobin_smtp_server_reply_all.start.annobin_smtp_server_reply_all.end.annobin_smtp_server_reply_early.start.annobin_smtp_server_reply_early.end.annobin_smtp_server_reply_quit.start.annobin_smtp_server_reply_quit.end.annobin_smtp_server_reply_get_one_line.start.annobin_smtp_server_reply_get_one_line.end.annobin_smtp_server_reply_get_message.start.annobin_smtp_server_reply_get_message.end.annobin_smtp_server_reply_send.start.annobin_smtp_server_reply_send.endsmtp_server_reply_send.cold.22__func__.8312.annobin_smtp_server_reply_is_success.start.annobin_smtp_server_reply_is_success.endsmtp_server_reply_is_success.cold.23__func__.8323.annobin_smtp_server_reply_add_to_event.start.annobin_smtp_server_reply_add_to_event.endsmtp_server_reply_add_to_event.cold.24__func__.8328.annobin_smtp_server_reply_create_ehlo.start.annobin_smtp_server_reply_create_ehlo.end.annobin_smtp_server_reply_ehlo_add.start.annobin_smtp_server_reply_ehlo_add.endsmtp_server_reply_ehlo_add.cold.25__func__.8340.annobin_smtp_server_reply_ehlo_add_param.start.annobin_smtp_server_reply_ehlo_add_param.endsmtp_server_reply_ehlo_add_param.cold.26__func__.8348.annobin_smtp_server_reply_ehlo_add_params.start.annobin_smtp_server_reply_ehlo_add_params.endsmtp_server_reply_ehlo_add_params.cold.27__func__.8355.annobin_smtp_server_reply_ehlo_add_8bitmime.start.annobin_smtp_server_reply_ehlo_add_8bitmime.end.annobin_smtp_server_reply_ehlo_add_binarymime.start.annobin_smtp_server_reply_ehlo_add_binarymime.end.annobin_smtp_server_reply_ehlo_add_chunking.start.annobin_smtp_server_reply_ehlo_add_chunking.end.annobin_smtp_server_reply_ehlo_add_dsn.start.annobin_smtp_server_reply_ehlo_add_dsn.end.annobin_smtp_server_reply_ehlo_add_enhancedstatuscodes.start.annobin_smtp_server_reply_ehlo_add_enhancedstatuscodes.end.annobin_smtp_server_reply_ehlo_add_pipelining.start.annobin_smtp_server_reply_ehlo_add_pipelining.end.annobin_smtp_server_reply_ehlo_add_size.start.annobin_smtp_server_reply_ehlo_add_size.end.annobin_smtp_server_reply_ehlo_add_starttls.start.annobin_smtp_server_reply_ehlo_add_starttls.end.annobin_smtp_server_reply_ehlo_add_vrfy.start.annobin_smtp_server_reply_ehlo_add_vrfy.end.annobin_smtp_server_reply_ehlo_add_xclient.start.annobin_smtp_server_reply_ehlo_add_xclient.end.annobin_smtp_server_command.c.annobin_smtp_server_command.c_end.annobin_smtp_server_command.c.hot.annobin_smtp_server_command.c_end.hot.annobin_smtp_server_command.c.unlikely.annobin_smtp_server_command.c_end.unlikely.annobin_smtp_server_command.c.startup.annobin_smtp_server_command.c_end.startup.annobin_smtp_server_command.c.exit.annobin_smtp_server_command.c_end.exit.annobin_smtp_server_command_bsearch.start.annobin_smtp_server_command_bsearch.endsmtp_server_command_bsearch.annobin_smtp_server_command_cmp.start.annobin_smtp_server_command_cmp.endsmtp_server_command_cmp.annobin_smtp_server_command_do_unregister.start.annobin_smtp_server_command_do_unregister.endsmtp_server_command_do_unregister.annobin_smtp_server_command_update_event.start.annobin_smtp_server_command_update_event.endsmtp_server_command_update_event.annobin_smtp_server_command_alloc.start.annobin_smtp_server_command_alloc.endsmtp_server_command_alloc.annobin_smtp_server_command_register.start.annobin_smtp_server_command_register.end.annobin_smtp_server_command_unregister.start.annobin_smtp_server_command_unregister.endsmtp_server_command_unregister.cold.9.annobin_smtp_server_command_override.start.annobin_smtp_server_command_override.end.annobin_smtp_server_commands_init.start.annobin_smtp_server_commands_init.end.annobin_smtp_server_command_new_invalid.start.annobin_smtp_server_command_new_invalid.end.annobin_smtp_server_command_new.start.annobin_smtp_server_command_new.end.annobin_smtp_server_command_ref.start.annobin_smtp_server_command_ref.end.annobin_smtp_server_command_add_hook.start.annobin_smtp_server_command_add_hook.endsmtp_server_command_add_hook.cold.10__func__.7186.annobin_smtp_server_command_remove_hook.start.annobin_smtp_server_command_remove_hook.end__func__.7201.annobin_smtp_server_command_remove_hooks.start.annobin_smtp_server_command_remove_hooks.end.annobin_smtp_server_command_set_reply_count.start.annobin_smtp_server_command_set_reply_count.endsmtp_server_command_set_reply_count.cold.11__func__.7226.annobin_smtp_server_command_get_reply_count.start.annobin_smtp_server_command_get_reply_count.endsmtp_server_command_get_reply_count.cold.12__func__.7230.annobin_smtp_server_command_ready_to_reply.start.annobin_smtp_server_command_ready_to_reply.end.annobin_smtp_server_command_is_replied.start.annobin_smtp_server_command_is_replied.endsmtp_server_command_is_replied.cold.13.annobin_smtp_server_command_reply_is_forwarded.start.annobin_smtp_server_command_reply_is_forwarded.endsmtp_server_command_reply_is_forwarded.cold.14.annobin_smtp_server_command_get_reply.start.annobin_smtp_server_command_get_reply.endsmtp_server_command_get_reply.cold.15__func__.7300.annobin_smtp_server_command_reply_status_equals.start.annobin_smtp_server_command_reply_status_equals.endsmtp_server_command_reply_status_equals.cold.16__func__.7306.annobin_smtp_server_command_replied_success.start.annobin_smtp_server_command_replied_success.endsmtp_server_command_replied_success.cold.17.annobin_smtp_server_command_fail.start.annobin_smtp_server_command_fail.endsmtp_server_command_fail.cold.18__func__.7347.annobin_smtp_server_command_input_lock.start.annobin_smtp_server_command_input_lock.end.annobin_smtp_server_command_input_unlock.start.annobin_smtp_server_command_input_unlock.end.annobin_smtp_server_command_input_capture.start.annobin_smtp_server_command_input_capture.end.annobin_smtp_server_command_pipeline_block.start.annobin_smtp_server_command_pipeline_block.end.annobin_smtp_server_command_pipeline_unblock.start.annobin_smtp_server_command_pipeline_unblock.end.annobin_smtp_server_command_unref.start.annobin_smtp_server_command_unref.endsmtp_server_command_unref.cold.19__func__.7167.annobin_smtp_server_command_execute.start.annobin_smtp_server_command_execute.endsmtp_server_command_execute.cold.20__func__.7158.annobin_smtp_server_command_call_hooks.start.annobin_smtp_server_command_call_hooks.end.annobin_smtp_server_command_next_to_reply.start.annobin_smtp_server_command_next_to_reply.end.annobin_smtp_server_command_submit_reply.start.annobin_smtp_server_command_submit_reply.endsmtp_server_command_submit_reply.cold.21__func__.7269.annobin_smtp_server_command_abort.start.annobin_smtp_server_command_abort.end.annobin_smtp_server_command_completed.start.annobin_smtp_server_command_completed.end.annobin_smtp_server_command_finished.start.annobin_smtp_server_command_finished.endsmtp_server_command_finished.cold.22__func__.7336.annobin_smtp_server_command_send_replies.start.annobin_smtp_server_command_send_replies.endsmtp_server_command_send_replies.cold.23__func__.7322__func__.7330.annobin_smtp_server_recipient.c.annobin_smtp_server_recipient.c_end.annobin_smtp_server_recipient.c.hot.annobin_smtp_server_recipient.c_end.hot.annobin_smtp_server_recipient.c.unlikely.annobin_smtp_server_recipient.c_end.unlikely.annobin_smtp_server_recipient.c.startup.annobin_smtp_server_recipient.c_end.startup.annobin_smtp_server_recipient.c.exit.annobin_smtp_server_recipient.c_end.exit.annobin_smtp_server_recipient_create_event.start.annobin_smtp_server_recipient_create_event.endsmtp_server_recipient_create_event.annobin_smtp_server_recipient_create.start.annobin_smtp_server_recipient_create.end.annobin_smtp_server_recipient_ref.start.annobin_smtp_server_recipient_ref.endsmtp_server_recipient_ref.cold.4__func__.6979.annobin_smtp_server_recipient_get_original.start.annobin_smtp_server_recipient_get_original.end.annobin_smtp_server_recipient_denied.start.annobin_smtp_server_recipient_denied.endsmtp_server_recipient_denied.cold.5__func__.7005.annobin_smtp_server_recipient_data_command.start.annobin_smtp_server_recipient_data_command.end.annobin_smtp_server_recipient_get_reply.start.annobin_smtp_server_recipient_get_reply.end.annobin_smtp_server_recipient_is_replied.start.annobin_smtp_server_recipient_is_replied.endsmtp_server_recipient_is_replied.cold.6__func__.7021.annobin_smtp_server_recipient_replyv.start.annobin_smtp_server_recipient_replyv.endsmtp_server_recipient_replyv.cold.7__func__.7029.annobin_smtp_server_recipient_reply.start.annobin_smtp_server_recipient_reply.end.annobin_smtp_server_recipient_reply_forward.start.annobin_smtp_server_recipient_reply_forward.end.annobin_smtp_server_recipient_reset.start.annobin_smtp_server_recipient_reset.endsmtp_server_recipient_reset.cold.8__func__.7046.annobin_smtp_server_recipient_finished.start.annobin_smtp_server_recipient_finished.endsmtp_server_recipient_finished.cold.9__func__.7053.annobin_smtp_server_recipient_add_hook.start.annobin_smtp_server_recipient_add_hook.endsmtp_server_recipient_add_hook.cold.10__func__.7064.annobin_smtp_server_recipient_remove_hook.start.annobin_smtp_server_recipient_remove_hook.end__func__.7080.annobin_smtp_server_recipient_call_hooks.start.annobin_smtp_server_recipient_call_hooks.end.annobin_smtp_server_recipient_unref.start.annobin_smtp_server_recipient_unref.endsmtp_server_recipient_unref.cold.11__func__.6985.annobin_smtp_server_recipient_destroy.start.annobin_smtp_server_recipient_destroy.end.annobin_smtp_server_recipient_approved.start.annobin_smtp_server_recipient_approved.endsmtp_server_recipient_approved.cold.12__func__.6999.annobin_smtp_server_recipient_data_replied.start.annobin_smtp_server_recipient_data_replied.end.annobin_smtp_server_transaction.c.annobin_smtp_server_transaction.c_end.annobin_smtp_server_transaction.c.hot.annobin_smtp_server_transaction.c_end.hot.annobin_smtp_server_transaction.c.unlikely.annobin_smtp_server_transaction.c_end.unlikely.annobin_smtp_server_transaction.c.startup.annobin_smtp_server_transaction.c_end.startup.annobin_smtp_server_transaction.c.exit.annobin_smtp_server_transaction.c_end.exit.annobin_smtp_server_transaction_create.start.annobin_smtp_server_transaction_create.end.annobin_smtp_server_transaction_free.start.annobin_smtp_server_transaction_free.end.annobin_smtp_server_transaction_find_rcpt_duplicate.start.annobin_smtp_server_transaction_find_rcpt_duplicate.endsmtp_server_transaction_find_rcpt_duplicate.cold.7__func__.7274.annobin_smtp_server_transaction_add_rcpt.start.annobin_smtp_server_transaction_add_rcpt.end.annobin_smtp_server_transaction_has_rcpt.start.annobin_smtp_server_transaction_has_rcpt.end.annobin_smtp_server_transaction_rcpt_count.start.annobin_smtp_server_transaction_rcpt_count.end.annobin_smtp_server_transaction_data_command.start.annobin_smtp_server_transaction_data_command.end.annobin_smtp_server_transaction_received.start.annobin_smtp_server_transaction_received.end.annobin_smtp_server_transaction_reset.start.annobin_smtp_server_transaction_reset.endsmtp_server_transaction_reset.cold.8__func__.7315.annobin_smtp_server_transaction_finished.start.annobin_smtp_server_transaction_finished.endsmtp_server_transaction_finished.cold.9__func__.7334.annobin_smtp_server_transaction_fail_data.start.annobin_smtp_server_transaction_fail_data.end.annobin_smtp_server_transaction_write_trace_record.start.annobin_smtp_server_transaction_write_trace_record.endsmtp_server_transaction_write_trace_record.cold.10.annobin_smtp_server_connection.c.annobin_smtp_server_connection.c_end.annobin_smtp_server_connection.c.hot.annobin_smtp_server_connection.c_end.hot.annobin_smtp_server_connection.c.unlikely.annobin_smtp_server_connection.c_end.unlikely.annobin_smtp_server_connection.c.startup.annobin_smtp_server_connection.c_end.startup.annobin_smtp_server_connection.c.exit.annobin_smtp_server_connection.c_end.exit.annobin_smtp_server_connection_update_rawlog.start.annobin_smtp_server_connection_update_rawlog.endsmtp_server_connection_update_rawlog.annobin_smtp_server_connection_streams_changed.start.annobin_smtp_server_connection_streams_changed.endsmtp_server_connection_streams_changedsmtp_server_connection_output.annobin_smtp_server_connection_event_create.start.annobin_smtp_server_connection_event_create.endsmtp_server_connection_event_create.annobin_smtp_server_connection_check_pipeline.start.annobin_smtp_server_connection_check_pipeline.endsmtp_server_connection_check_pipelinesmtp_server_connection_check_pipeline.cold.21__func__.10003.annobin_smtp_server_connection_update_event.isra.10.start.annobin_smtp_server_connection_update_event.isra.10.endsmtp_server_connection_update_event.isra.10.annobin_smtp_server_connection_alloc.start.annobin_smtp_server_connection_alloc.endsmtp_server_connection_alloc__func__.10193.annobin_smtp_server_connection_get_stats.start.annobin_smtp_server_connection_get_stats.end.annobin_smtp_server_connection_input_halt.start.annobin_smtp_server_connection_input_halt.end.annobin_smtp_server_connection_input_resume.start.annobin_smtp_server_connection_input_resume.end.annobin_smtp_server_connection_input_lock.start.annobin_smtp_server_connection_input_lock.end.annobin_smtp_server_connection_input_unlock.start.annobin_smtp_server_connection_input_unlock.end.annobin_smtp_server_connection_input_capture.start.annobin_smtp_server_connection_input_capture.endsmtp_server_connection_input_capture.cold.22__func__.10027.annobin_smtp_server_connection_set_streams.start.annobin_smtp_server_connection_set_streams.endsmtp_server_connection_set_streams.cold.23__func__.10044.annobin_smtp_server_connection_set_ssl_streams.start.annobin_smtp_server_connection_set_ssl_streams.end.annobin_smtp_server_connection_timeout_stop.start.annobin_smtp_server_connection_timeout_stop.end.annobin_smtp_server_connection_timeout_start.start.annobin_smtp_server_connection_timeout_start.endsmtp_server_connection_idle_timeout.annobin_smtp_server_connection_timeout_update.start.annobin_smtp_server_connection_timeout_update.endsmtp_server_connection_timeout_updatesmtp_server_connection_timeout_update.cold.24.annobin_smtp_server_connection_timeout_reset.start.annobin_smtp_server_connection_timeout_reset.end.annobin_smtp_server_connection_pending_command_data.start.annobin_smtp_server_connection_pending_command_data.end.annobin_smtp_server_connection_cork.start.annobin_smtp_server_connection_cork.end.annobin_smtp_server_connection_trigger_output.start.annobin_smtp_server_connection_trigger_output.end.annobin_smtp_server_connection_list_init.start.annobin_smtp_server_connection_list_init.endsmtp_server_connection_vfuncssmtp_server_connection_set.annobin_smtp_server_connection_ref.start.annobin_smtp_server_connection_ref.end.annobin_smtp_server_connection_send_line.start.annobin_smtp_server_connection_send_line.endsmtp_server_connection_send_line.cold.25.annobin_smtp_server_connection_ready.start.annobin_smtp_server_connection_ready.endsmtp_server_connection_ready.annobin_smtp_server_connection_ssl_init.start.annobin_smtp_server_connection_ssl_init.end.annobin_smtp_server_connection_reply_lines.start.annobin_smtp_server_connection_reply_lines.endsmtp_server_connection_reply_lines.cold.26.annobin_smtp_server_connection_reply_immediate.start.annobin_smtp_server_connection_reply_immediate.endsmtp_server_connection_reply_immediate.cold.27.annobin_smtp_server_connection_login.start.annobin_smtp_server_connection_login.endsmtp_server_connection_login.cold.28__func__.10305.annobin_smtp_server_connection_start_pending.start.annobin_smtp_server_connection_start_pending.endsmtp_server_connection_start_pending.cold.29__func__.10309.annobin_smtp_server_connection_halt.start.annobin_smtp_server_connection_halt.end.annobin_smtp_server_connection_create.start.annobin_smtp_server_connection_create.end.annobin_smtp_server_connection_create_from_streams.start.annobin_smtp_server_connection_create_from_streams.endsmtp_server_connection_create_from_streams.cold.30__func__.10244.annobin_smtp_server_connection_resume.start.annobin_smtp_server_connection_resume.end.annobin_smtp_server_connection_start.start.annobin_smtp_server_connection_start.end.annobin_smtp_server_connection_get_helo_data.start.annobin_smtp_server_connection_get_helo_data.end.annobin_smtp_server_connection_get_state.start.annobin_smtp_server_connection_get_state.end.annobin_smtp_server_connection_set_state.start.annobin_smtp_server_connection_set_state.end.annobin_smtp_server_connection_get_security_string.start.annobin_smtp_server_connection_get_security_string.end.annobin_smtp_server_connection_reset_state.start.annobin_smtp_server_connection_reset_state.end.annobin_smtp_server_connection_disconnect.start.annobin_smtp_server_connection_disconnect.endsmtp_server_connection_disconnect.annobin_smtp_server_connection_unref.start.annobin_smtp_server_connection_unref.endsmtp_server_connection_unref.cold.31__func__.10267.annobin_smtp_server_connection_destroy.start.annobin_smtp_server_connection_destroy.endsmtp_server_connection_destroy.annobin_smtp_server_connection_close.start.annobin_smtp_server_connection_close.end.annobin_smtp_server_connection_handle_output_error.start.annobin_smtp_server_connection_handle_output_error.end.annobin_smtp_server_connection_uncork.start.annobin_smtp_server_connection_uncork.end.annobin_smtp_server_connection_flush.start.annobin_smtp_server_connection_flush.end.annobin_smtp_server_connection_output.start.annobin_smtp_server_connection_output.end.annobin_smtp_server_connection_input.start.annobin_smtp_server_connection_input.endsmtp_server_connection_inputsmtp_server_connection_input.cold.32__func__.10137.annobin_smtp_server_connection_terminate.start.annobin_smtp_server_connection_terminate.endsmtp_server_connection_terminate.cold.33__func__.10340.annobin_smtp_server_connection_idle_timeout.start.annobin_smtp_server_connection_idle_timeout.end.annobin_smtp_server_connection_abort.start.annobin_smtp_server_connection_abort.endsmtp_server_connection_abort.cold.34__func__.10321.annobin_smtp_server_connection_clear.start.annobin_smtp_server_connection_clear.end.annobin_smtp_server_connection_set_capabilities.start.annobin_smtp_server_connection_set_capabilities.end.annobin_smtp_server_connection_add_extra_capability.start.annobin_smtp_server_connection_add_extra_capability.endsmtp_server_connection_add_extra_capability.cold.35__func__.10378.annobin_smtp_server_connection_get_context.start.annobin_smtp_server_connection_get_context.end.annobin_smtp_server_connection_is_ssl_secured.start.annobin_smtp_server_connection_is_ssl_secured.end.annobin_smtp_server_connection_is_trusted.start.annobin_smtp_server_connection_is_trusted.end.annobin_smtp_server_connection_get_protocol.start.annobin_smtp_server_connection_get_protocol.end.annobin_smtp_server_connection_get_protocol_name.start.annobin_smtp_server_connection_get_protocol_name.end.annobin_smtp_server_connection_get_transaction.start.annobin_smtp_server_connection_get_transaction.end.annobin_smtp_server_connection_get_transaction_id.start.annobin_smtp_server_connection_get_transaction_id.end.annobin_smtp_server_connection_get_proxy_data.start.annobin_smtp_server_connection_get_proxy_data.end.annobin_smtp_server_connection_set_proxy_data.start.annobin_smtp_server_connection_set_proxy_data.end.annobin_smtp_server_connection_register_mail_param.start.annobin_smtp_server_connection_register_mail_param.endsmtp_server_connection_register_mail_param.cold.36__func__.10425.annobin_smtp_server_connection_register_rcpt_param.start.annobin_smtp_server_connection_register_rcpt_param.endsmtp_server_connection_register_rcpt_param.cold.37__func__.10431.annobin_smtp_server_connection_switch_ioloop.start.annobin_smtp_server_connection_switch_ioloop.end.annobin_smtp_server_connection_reason_begin.start.annobin_smtp_server_connection_reason_begin.end.annobin_smtp_server.c.annobin_smtp_server.c_end.annobin_smtp_server.c.hot.annobin_smtp_server.c_end.hot.annobin_smtp_server.c.unlikely.annobin_smtp_server.c_end.unlikely.annobin_smtp_server.c.startup.annobin_smtp_server.c_end.startup.annobin_smtp_server.c.exit.annobin_smtp_server.c_end.exit.annobin_smtp_server_event_init.start.annobin_smtp_server_event_init.endevent_category_smtp_server.annobin_smtp_server_init.start.annobin_smtp_server_init.end.annobin_smtp_server_deinit.start.annobin_smtp_server_deinit.end.annobin_smtp_server_switch_ioloop.start.annobin_smtp_server_switch_ioloop.end.annobin_smtp_server_init_ssl_ctx.start.annobin_smtp_server_init_ssl_ctx.end.annobin_smtp_submit_settings.c.annobin_smtp_submit_settings.c_end.annobin_smtp_submit_settings.c.hot.annobin_smtp_submit_settings.c_end.hot.annobin_smtp_submit_settings.c.unlikely.annobin_smtp_submit_settings.c_end.unlikely.annobin_smtp_submit_settings.c.startup.annobin_smtp_submit_settings.c_end.startup.annobin_smtp_submit_settings.c.exit.annobin_smtp_submit_settings.c_end.exit.annobin_smtp_submit_settings_check.start.annobin_smtp_submit_settings_check.endsmtp_submit_settings_checksmtp_submit_setting_definessmtp_submit_default_settings.annobin_smtp_submit.c.annobin_smtp_submit.c_end.annobin_smtp_submit.c.hot.annobin_smtp_submit.c_end.hot.annobin_smtp_submit.c.unlikely.annobin_smtp_submit.c_end.unlikely.annobin_smtp_submit.c.startup.annobin_smtp_submit.c_end.startup.annobin_smtp_submit.c.exit.annobin_smtp_submit.c_end.exit.annobin_data_dummy_callback.start.annobin_data_dummy_callback.enddata_dummy_callback.annobin_smtp_submit_run_callback.start.annobin_smtp_submit_run_callback.endsmtp_submit_run_callback.annobin_smtp_submit_callback.start.annobin_smtp_submit_callback.endsmtp_submit_callback.annobin_smtp_submit_delayed_error_callback.start.annobin_smtp_submit_delayed_error_callback.endsmtp_submit_delayed_error_callback.annobin_smtp_submit_send_host.start.annobin_smtp_submit_send_host.endsmtp_submit_send_hostsmtp_submit_send_host_finishedrcpt_to_callback.annobin_smtp_submit_send_host_finished.start.annobin_smtp_submit_send_host_finished.endsmtp_submit_send_host_finished.cold.15__func__.9454.annobin_smtp_submit_sendmail_callback.start.annobin_smtp_submit_sendmail_callback.endsmtp_submit_sendmail_callback.annobin_smtp_submit_error.start.annobin_smtp_submit_error.endsmtp_submit_errorsmtp_submit_error.cold.16__func__.9447.annobin_data_callback.start.annobin_data_callback.end.annobin_rcpt_to_callback.start.annobin_rcpt_to_callback.end.annobin_smtp_submit_session_init.start.annobin_smtp_submit_session_init.endevent_category_smtp_submit.annobin_smtp_submit_session_deinit.start.annobin_smtp_submit_session_deinit.end.annobin_smtp_submit_init.start.annobin_smtp_submit_init.end.annobin_smtp_submit_init_simple.start.annobin_smtp_submit_init_simple.end.annobin_smtp_submit_deinit.start.annobin_smtp_submit_deinit.end.annobin_smtp_submit_add_rcpt.start.annobin_smtp_submit_add_rcpt.end__func__.9418smtp_submit_add_rcpt.cold.17.annobin_smtp_submit_send.start.annobin_smtp_submit_send.endsmtp_submit_send.cold.18__func__.9422.annobin_smtp_submit_run_async.start.annobin_smtp_submit_run_async.endsmtp_submit_run_async.cold.19__func__.5014__func__.9510.annobin_smtp_submit_run.start.annobin_smtp_submit_run.end.annobin_program_client.c.annobin_program_client.c_end.annobin_program_client.c.hot.annobin_program_client.c_end.hot.annobin_program_client.c.unlikely.annobin_program_client.c_end.unlikely.annobin_program_client.c.startup.annobin_program_client.c_end.startup.annobin_program_client.c.exit.annobin_program_client.c_end.exit.annobin_program_client_do_disconnect.start.annobin_program_client_do_disconnect.endprogram_client_do_disconnect__func__.8235__func__.8228.annobin_program_client_run_callback.start.annobin_program_client_run_callback.endprogram_client_run_callback.annobin_program_client_disconnect.part.4.start.annobin_program_client_disconnect.part.4.endprogram_client_disconnect.part.4.annobin_program_client_input_pending.start.annobin_program_client_input_pending.endprogram_client_input_pending.annobin_program_client_extra_fd_input.start.annobin_program_client_extra_fd_input.endprogram_client_extra_fd_inputprogram_client_extra_fd_input.cold.12__func__.8318.annobin_program_client_set_label.start.annobin_program_client_set_label.end.annobin_program_client_disconnected.start.annobin_program_client_disconnected.end.annobin_program_client_fail.start.annobin_program_client_fail.end.annobin_program_client_output_pump_finished.start.annobin_program_client_output_pump_finished.endprogram_client_output_pump_finishedprogram_client_output_finishprogram_client_output_pump_finished.cold.13__func__.8274.annobin_program_client_output_finish.start.annobin_program_client_output_finish.end.annobin_program_client_input_pump_finished.start.annobin_program_client_input_pump_finished.endprogram_client_input_pump_finishedprogram_client_input_finishprogram_client_input_pump_finished.cold.14__func__.8305.annobin_program_client_input_finish.start.annobin_program_client_input_finish.endprogram_client_input_finish.cold.15__func__.5484.annobin_program_client_timeout.start.annobin_program_client_timeout.endprogram_client_timeout.annobin_program_client_connect_timeout.start.annobin_program_client_connect_timeout.endprogram_client_connect_timeout.annobin_program_client_connected.start.annobin_program_client_connected.endprogram_client_connected.cold.16__func__.8326.annobin_program_client_init.start.annobin_program_client_init.end.annobin_program_client_set_input.start.annobin_program_client_set_input.end.annobin_program_client_set_output.start.annobin_program_client_set_output.end.annobin_program_client_set_output_seekable.start.annobin_program_client_set_output_seekable.end.annobin_program_client_get_output_seekable.start.annobin_program_client_get_output_seekable.endprogram_client_get_output_seekable.cold.17__func__.8356.annobin_program_client_set_extra_fd.start.annobin_program_client_set_extra_fd.endprogram_client_set_extra_fd.cold.18__func__.8367.annobin_program_client_set_env.start.annobin_program_client_set_env.end.annobin_program_client_init_streams.start.annobin_program_client_init_streams.endprogram_client_init_streams.cold.19__func__.8386.annobin_program_client_destroy.start.annobin_program_client_destroy.endprogram_client_destroy.cold.20__func__.8396.annobin_program_client_switch_ioloop.start.annobin_program_client_switch_ioloop.end.annobin_program_client_create.start.annobin_program_client_create.end.annobin_program_client_run_async.start.annobin_program_client_run_async.endprogram_client_run_async.cold.21__func__.8427.annobin_program_client_run.start.annobin_program_client_run.end.annobin_program_client_local.c.annobin_program_client_local.c_end.annobin_program_client_local.c.hot.annobin_program_client_local.c_end.hot.annobin_program_client_local.c.unlikely.annobin_program_client_local.c_end.unlikely.annobin_program_client_local.c.startup.annobin_program_client_local.c_end.startup.annobin_program_client_local.c.exit.annobin_program_client_local.c_end.exit.annobin_program_client_local_exited.start.annobin_program_client_local_exited.endprogram_client_local_exited.annobin_program_client_local_waitchild.start.annobin_program_client_local_waitchild.endprogram_client_local_waitchildprogram_client_local_waitchild.cold.10__func__.8138.annobin_program_client_local_switch_ioloop.start.annobin_program_client_local_switch_ioloop.endprogram_client_local_switch_ioloop.annobin_program_client_local_kill_now.start.annobin_program_client_local_kill_now.endprogram_client_local_kill_now.annobin_program_client_local_destroy.start.annobin_program_client_local_destroy.endprogram_client_local_destroy.annobin_program_client_local_kill.start.annobin_program_client_local_kill.endprogram_client_local_killprogram_client_local_kill.cold.11__func__.8210.annobin_program_client_local_disconnect.start.annobin_program_client_local_disconnect.endprogram_client_local_disconnect__func__.5112.annobin_program_client_local_close_output.start.annobin_program_client_local_close_output.endprogram_client_local_close_output.annobin_program_client_local_connect.start.annobin_program_client_local_connect.endprogram_client_local_connectprogram_client_local_connect.cold.12__func__.8154.annobin_program_client_local_create.start.annobin_program_client_local_create.end.annobin_program_client_remote.c.annobin_program_client_remote.c_end.annobin_program_client_remote.c.hot.annobin_program_client_remote.c_end.hot.annobin_program_client_remote.c.unlikely.annobin_program_client_remote.c_end.unlikely.annobin_program_client_remote.c.startup.annobin_program_client_remote.c_end.startup.annobin_program_client_remote.c.exit.annobin_program_client_remote.c_end.exit.annobin_program_client_remote_switch_ioloop.start.annobin_program_client_remote_switch_ioloop.endprogram_client_remote_switch_ioloop.annobin_program_client_remote_disconnect.start.annobin_program_client_remote_disconnect.endprogram_client_remote_disconnect.annobin_program_client_unix_connect.start.annobin_program_client_unix_connect.endprogram_client_unix_connectprogram_client_remote_connectedprogram_client_unix_reconnect.annobin_program_client_unix_reconnect.start.annobin_program_client_unix_reconnect.end.annobin_program_client_istream_destroy.start.annobin_program_client_istream_destroy.endprogram_client_istream_destroy.annobin_program_client_istream_stat.start.annobin_program_client_istream_stat.endprogram_client_istream_stat.annobin_program_client_istream_sync.start.annobin_program_client_istream_sync.endprogram_client_istream_sync.annobin_program_client_net_connect_init.start.annobin_program_client_net_connect_init.endprogram_client_net_connect_initprogram_client_net_connect_realprogram_client_net_connect_resolved.annobin_program_client_net_connect_real.start.annobin_program_client_net_connect_real.endprogram_client_net_connectedprogram_client_net_connect_againprogram_client_net_connect_timeoutprogram_client_net_connect_real.cold.7__func__.8325.annobin_program_client_net_connect_resolved.start.annobin_program_client_net_connect_resolved.end.annobin_program_client_remote_close_output.start.annobin_program_client_remote_close_output.endprogram_client_remote_close_output__func__.8365.annobin_program_client_istream_parse_result.part.4.start.annobin_program_client_istream_parse_result.part.4.endprogram_client_istream_parse_result.part.4.annobin_program_client_istream_read.start.annobin_program_client_istream_read.endprogram_client_istream_readprogram_client_istream_read.cold.8.annobin_program_client_net_connect_again.start.annobin_program_client_net_connect_again.end.annobin_program_client_net_connect_timeout.start.annobin_program_client_net_connect_timeout.end__func__.8311.annobin_program_client_net_connected.start.annobin_program_client_net_connected.end__func__.8317.annobin_program_client_remote_connected.start.annobin_program_client_remote_connected.end.annobin_program_client_unix_create.start.annobin_program_client_unix_create.end.annobin_program_client_net_create.start.annobin_program_client_net_create.end.annobin_program_client_net_create_ips.start.annobin_program_client_net_create_ips.end__func__.8405program_client_net_create_ips.cold.9.annobin_anvil_client.c.annobin_anvil_client.c_end.annobin_anvil_client.c.hot.annobin_anvil_client.c_end.hot.annobin_anvil_client.c.unlikely.annobin_anvil_client.c_end.unlikely.annobin_anvil_client.c.startup.annobin_anvil_client.c_end.startup.annobin_anvil_client.c.exit.annobin_anvil_client.c_end.exit.annobin_anvil_client_cancel_queries.start.annobin_anvil_client_cancel_queries.endanvil_client_cancel_queries.annobin_anvil_client_disconnect.start.annobin_anvil_client_disconnect.endanvil_client_disconnect.annobin_anvil_client_init.start.annobin_anvil_client_init.end.annobin_anvil_client_deinit.start.annobin_anvil_client_deinit.endanvil_client_deinit.cold.8__func__.6498.annobin_anvil_client_connect.start.annobin_anvil_client_connect.endanvil_inputanvil_reconnectanvil_client_connect.cold.9__func__.6519.annobin_anvil_reconnect.start.annobin_anvil_reconnect.end.annobin_anvil_input.start.annobin_anvil_input.endanvil_input.cold.10.annobin_anvil_client_timeout.start.annobin_anvil_client_timeout.endanvil_client_timeoutanvil_client_timeout.cold.11__func__.6536.annobin_anvil_client_send.start.annobin_anvil_client_send.endanvil_client_send.annobin_anvil_client_query.start.annobin_anvil_client_query.end.annobin_anvil_client_query_abort.start.annobin_anvil_client_query_abort.endanvil_client_query_abort.cold.12__func__.6334.annobin_anvil_client_cmd.start.annobin_anvil_client_cmd.end.annobin_anvil_client_is_connected.start.annobin_anvil_client_is_connected.end.annobin_ipc_client.c.annobin_ipc_client.c_end.annobin_ipc_client.c.hot.annobin_ipc_client.c_end.hot.annobin_ipc_client.c.unlikely.annobin_ipc_client.c_end.unlikely.annobin_ipc_client.c.startup.annobin_ipc_client.c_end.startup.annobin_ipc_client.c.exit.annobin_ipc_client.c_end.exit.annobin_ipc_client_abort_commands.isra.0.start.annobin_ipc_client_abort_commands.isra.0.endipc_client_abort_commands.isra.0.annobin_ipc_client_cmd_connect_failed.start.annobin_ipc_client_cmd_connect_failed.endipc_client_cmd_connect_failed.annobin_ipc_client_disconnect.start.annobin_ipc_client_disconnect.endipc_client_disconnectipc_client_disconnect.cold.3.annobin_ipc_client_input.start.annobin_ipc_client_input.endipc_client_inputipc_client_input.cold.4.annobin_ipc_client_init.start.annobin_ipc_client_init.end.annobin_ipc_client_deinit.start.annobin_ipc_client_deinit.end.annobin_ipc_client_cmd.start.annobin_ipc_client_cmd.endipc_client_cmd.cold.5.annobin_ipc_client_cmd_abort.start.annobin_ipc_client_cmd_abort.end.annobin_ipc_server.c.annobin_ipc_server.c_end.annobin_ipc_server.c.hot.annobin_ipc_server.c_end.hot.annobin_ipc_server.c.unlikely.annobin_ipc_server.c_end.unlikely.annobin_ipc_server.c.startup.annobin_ipc_server.c_end.startup.annobin_ipc_server.c.exit.annobin_ipc_server.c_end.exit.annobin_ipc_server_connect.start.annobin_ipc_server_connect.endipc_server_connectipc_server_inputipc_server_connect.cold.2__func__.7752.annobin_ipc_server_disconnect.part.0.start.annobin_ipc_server_disconnect.part.0.endipc_server_disconnect.part.0ipc_server_disconnect.part.0.cold.3.annobin_ipc_server_input.start.annobin_ipc_server_input.endipc_server_input.cold.4.annobin_ipc_cmd_finish.start.annobin_ipc_cmd_finish.endipc_cmd_finishipc_cmd_finish.cold.5__func__.7777.annobin_ipc_server_init.start.annobin_ipc_server_init.end.annobin_ipc_server_deinit.start.annobin_ipc_server_deinit.endipc_server_deinit.cold.6__func__.7768.annobin_ipc_cmd_send.start.annobin_ipc_cmd_send.end.annobin_ipc_cmd_success_reply.start.annobin_ipc_cmd_success_reply.end.annobin_ipc_cmd_success.start.annobin_ipc_cmd_success.end.annobin_ipc_cmd_fail.start.annobin_ipc_cmd_fail.endipc_cmd_fail.cold.7__func__.7791.annobin_master_auth.c.annobin_master_auth.c_end.annobin_master_auth.c.hot.annobin_master_auth.c_end.hot.annobin_master_auth.c.unlikely.annobin_master_auth.c_end.unlikely.annobin_master_auth.c.startup.annobin_master_auth.c_end.startup.annobin_master_auth.c.exit.annobin_master_auth.c_end.exit.annobin_master_auth_connection_deinit.start.annobin_master_auth_connection_deinit.endmaster_auth_connection_deinitmaster_auth_connection_deinit.cold.0.annobin_conn_error.start.annobin_conn_error.endconn_error.annobin_master_auth_connection_input.start.annobin_master_auth_connection_input.endmaster_auth_connection_input.annobin_master_auth_connection_timeout.start.annobin_master_auth_connection_timeout.endmaster_auth_connection_timeout.annobin_master_auth_init.start.annobin_master_auth_init.end.annobin_master_auth_deinit.start.annobin_master_auth_deinit.end.annobin_master_auth_request_full.start.annobin_master_auth_request_full.endmaster_auth_request_full.cold.1.annobin_master_auth_request.start.annobin_master_auth_request.end.annobin_master_auth_request_abort.start.annobin_master_auth_request_abort.endmaster_auth_request_abort.cold.2.annobin_master_instance.c.annobin_master_instance.c_end.annobin_master_instance.c.hot.annobin_master_instance.c_end.hot.annobin_master_instance.c.unlikely.annobin_master_instance.c_end.unlikely.annobin_master_instance.c.startup.annobin_master_instance.c_end.startup.annobin_master_instance.c.exit.annobin_master_instance.c_end.exit.annobin_master_instance_find.isra.6.start.annobin_master_instance_find.isra.6.endmaster_instance_find.isra.6.annobin_master_instance_update_config_path.isra.8.start.annobin_master_instance_update_config_path.isra.8.endmaster_instance_update_config_path.isra.8master_instance_update_config_path.isra.8.cold.14.annobin_master_instance_write_finish.start.annobin_master_instance_write_finish.endmaster_instance_write_finishmaster_instance_write_finish.cold.15__func__.6765.annobin_master_instance_list_refresh.start.annobin_master_instance_list_refresh.endmaster_instance_list_refreshmaster_instance_list_refresh.cold.16.annobin_master_instance_write_init.start.annobin_master_instance_write_init.endmaster_instance_write_initdotlock_setmaster_instance_write_init.cold.17__func__.6757.annobin_master_instance_list_refresh_and_update.start.annobin_master_instance_list_refresh_and_update.endmaster_instance_list_refresh_and_update.annobin_master_instance_list_init.start.annobin_master_instance_list_init.end.annobin_master_instance_list_deinit.start.annobin_master_instance_list_deinit.end.annobin_master_instance_list_update.start.annobin_master_instance_list_update.end.annobin_master_instance_list_remove.start.annobin_master_instance_list_remove.end.annobin_master_instance_list_find_by_name.start.annobin_master_instance_list_find_by_name.endmaster_instance_list_find_by_name.cold.18.annobin_master_instance_list_set_name.start.annobin_master_instance_list_set_name.endmaster_instance_list_set_name.cold.19__func__.6792.annobin_master_instance_list_iterate_init.start.annobin_master_instance_list_iterate_init.end.annobin_master_instance_iterate_list_next.start.annobin_master_instance_iterate_list_next.endmaster_instance_iterate_list_next.cold.20__func__.4725.annobin_master_instance_iterate_list_deinit.start.annobin_master_instance_iterate_list_deinit.end.annobin_master_login.c.annobin_master_login.c_end.annobin_master_login.c.hot.annobin_master_login.c_end.hot.annobin_master_login.c.unlikely.annobin_master_login.c_end.unlikely.annobin_master_login.c.startup.annobin_master_login.c_end.startup.annobin_master_login.c.exit.annobin_master_login.c_end.exit.annobin_master_login_conn_close.part.2.start.annobin_master_login_conn_close.part.2.endmaster_login_conn_close.part.2master_login_conn_close.part.2.cold.5.annobin_login_server_proctitle_refresh.part.3.start.annobin_login_server_proctitle_refresh.part.3.endlogin_server_proctitle_refresh.part.3.annobin_master_login_conn_unref.start.annobin_master_login_conn_unref.endmaster_login_conn_unrefmaster_login_conn_unref.cold.6.annobin_master_login_client_free.start.annobin_master_login_client_free.endmaster_login_client_freemaster_login_client_free.cold.7__func__.8145.annobin_master_login_postlogin_free.start.annobin_master_login_postlogin_free.endmaster_login_postlogin_freemaster_login_postlogin_free.cold.8__func__.8157.annobin_master_login_postlogin_timeout.start.annobin_master_login_postlogin_timeout.endmaster_login_postlogin_timeout.annobin_master_login_conn_input.start.annobin_master_login_conn_input.endmaster_login_conn_input__func__.8218master_login_auth_callback.annobin_master_login_init.start.annobin_master_login_init.endmaster_login_init.cold.9__func__.8114.annobin_master_login_deinit.start.annobin_master_login_deinit.endmaster_login_deinit.cold.10__func__.8121.annobin_master_login_add.start.annobin_master_login_add.end.annobin_master_login_stop.start.annobin_master_login_stop.end.annobin_master_login_auth_finish.start.annobin_master_login_auth_finish.endmaster_login_auth_finishmaster_login_auth_finish.cold.11__func__.8153.annobin_master_login_auth_callback.start.annobin_master_login_auth_callback.endmaster_login_postlogin_input__func__.8187master_login_auth_callback.cold.12__func__.8206.annobin_master_login_postlogin_input.start.annobin_master_login_postlogin_input.end.annobin_master_login_auth.c.annobin_master_login_auth.c_end.annobin_master_login_auth.c.hot.annobin_master_login_auth.c_end.hot.annobin_master_login_auth.c.unlikely.annobin_master_login_auth.c_end.unlikely.annobin_master_login_auth.c.startup.annobin_master_login_auth.c_end.startup.annobin_master_login_auth.c.exit.annobin_master_login_auth.c_end.exit.annobin_request_failure.start.annobin_request_failure.endrequest_failure.annobin_request_free.start.annobin_request_free.end.annobin_master_login_auth_fail.start.annobin_master_login_auth_fail.endmaster_login_auth_fail.annobin_auth_request_check_spid.isra.3.part.4.start.annobin_auth_request_check_spid.isra.3.part.4.endauth_request_check_spid.isra.3.part.4.annobin_master_login_auth_handshake_line.start.annobin_master_login_auth_handshake_line.endmaster_login_auth_handshake_line.annobin_auth_get_next_timeout_msecs.isra.5.start.annobin_auth_get_next_timeout_msecs.isra.5.endauth_get_next_timeout_msecs.isra.5.annobin_master_login_auth_update_timeout.start.annobin_master_login_auth_update_timeout.endmaster_login_auth_update_timeoutmaster_login_auth_timeoutmaster_login_auth_update_timeout.cold.12__func__.8698.annobin_master_login_auth_request_remove.start.annobin_master_login_auth_request_remove.endmaster_login_auth_request_removemaster_login_auth_request_remove.cold.13.annobin_master_login_auth_timeout.start.annobin_master_login_auth_timeout.endmaster_login_auth_timeout.cold.14.annobin_master_login_auth_lookup_request.start.annobin_master_login_auth_lookup_request.endmaster_login_auth_lookup_request.annobin_master_login_auth_unref.start.annobin_master_login_auth_unref.endmaster_login_auth_unrefmaster_login_auth_unref.cold.15__func__.8663.annobin_master_login_auth_input_args.start.annobin_master_login_auth_input_args.endmaster_login_auth_input_args.annobin_master_login_auth_destroy.start.annobin_master_login_auth_destroy.endmaster_login_auth_destroy.annobin_master_login_auth_connect.start.annobin_master_login_auth_connect.endmaster_login_auth_connectmaster_login_auth_connect.cold.16__func__.8759.annobin_master_login_auth_init.start.annobin_master_login_auth_init.endmaster_login_auth_vfuncsmaster_login_auth_set.annobin_master_login_auth_disconnect.start.annobin_master_login_auth_disconnect.end.annobin_master_login_auth_deinit.start.annobin_master_login_auth_deinit.end.annobin_master_login_auth_set_timeout.start.annobin_master_login_auth_set_timeout.end.annobin_master_login_auth_request.start.annobin_master_login_auth_request.endmaster_login_auth_request.cold.17__func__.8788.annobin_master_login_auth_request_count.start.annobin_master_login_auth_request_count.end.annobin_master_service.c.annobin_master_service.c_end.annobin_master_service.c.hot.annobin_master_service.c_end.hot.annobin_master_service.c.unlikely.annobin_master_service.c_end.unlikely.annobin_master_service.c.startup.annobin_master_service.c_end.startup.annobin_master_service.c.exit.annobin_master_service.c_end.exit.annobin_master_service_free.start.annobin_master_service_free.endmaster_service_free.annobin_sig_close_listeners.start.annobin_sig_close_listeners.endsig_close_listeners.annobin_master_service_get_login_state.start.annobin_master_service_get_login_state.endmaster_service_get_login_statemaster_service_get_login_state.cold.18.annobin_master_service_stop.start.annobin_master_service_stop.end.annobin_master_status_send.start.annobin_master_status_send.endmaster_status_sendmaster_status_send.cold.19.annobin_sig_die.start.annobin_sig_die.endsig_die.annobin_master_status_update.start.annobin_master_status_update.endmaster_status_update.cold.20__func__.9576.annobin_master_service_io_listeners_close.isra.7.start.annobin_master_service_io_listeners_close.isra.7.endmaster_service_io_listeners_close.isra.7master_service_io_listeners_close.isra.7.cold.21.annobin_master_service_getopt_string.start.annobin_master_service_getopt_string.end.annobin_master_getopt_str_is_valid.start.annobin_master_getopt_str_is_valid.end.annobin_master_service_init_log_with_prefix.start.annobin_master_service_init_log_with_prefix.end.annobin_master_service_init_log.start.annobin_master_service_init_log.end.annobin_master_service_init_log_with_pid.start.annobin_master_service_init_log_with_pid.end.annobin_master_service_init_stats_client.start.annobin_master_service_init_stats_client.endmaster_service_init_stats_client.cold.22.annobin_master_service_set_die_with_master.start.annobin_master_service_set_die_with_master.end.annobin_master_service_set_die_callback.start.annobin_master_service_set_die_callback.end.annobin_master_service_set_idle_die_callback.start.annobin_master_service_set_idle_die_callback.end.annobin_master_service_parse_option.start.annobin_master_service_parse_option.endmaster_service_parse_option.cold.23.annobin_master_getopt.start.annobin_master_getopt.endmaster_getopt.cold.24__func__.9270.annobin_master_service_import_environment.start.annobin_master_service_import_environment.endmaster_service_import_environment.cold.25__func__.5698.annobin_master_service_env_clean.start.annobin_master_service_env_clean.endmaster_service_env_clean.cold.26.annobin_master_service_set_client_limit.start.annobin_master_service_set_client_limit.endmaster_service_set_client_limit.cold.27__func__.9384.annobin_master_service_get_client_limit.start.annobin_master_service_get_client_limit.end.annobin_master_service_get_process_limit.start.annobin_master_service_get_process_limit.end.annobin_master_service_get_process_min_avail.start.annobin_master_service_get_process_min_avail.end.annobin_master_service_get_idle_kill_secs.start.annobin_master_service_get_idle_kill_secs.end.annobin_master_service_set_service_count.start.annobin_master_service_set_service_count.endmaster_service_set_service_count.cold.28__func__.9402.annobin_master_service_init.start.annobin_master_service_init.endmaster_service_event_callbackmaster_service_category_namemaster_service_categorymaster_service_init.cold.29__func__.9261.annobin_master_service_get_service_count.start.annobin_master_service_get_service_count.end.annobin_master_service_get_socket_count.start.annobin_master_service_get_socket_count.end.annobin_master_service_get_socket_name.start.annobin_master_service_get_socket_name.endmaster_service_get_socket_name.cold.30__func__.9414.annobin_master_service_set_avail_overflow_callback.start.annobin_master_service_set_avail_overflow_callback.end.annobin_master_service_get_config_path.start.annobin_master_service_get_config_path.end.annobin_master_service_get_version_string.start.annobin_master_service_get_version_string.end.annobin_master_service_get_name.start.annobin_master_service_get_name.end.annobin_master_service_get_configured_name.start.annobin_master_service_get_configured_name.end.annobin_master_service_run.start.annobin_master_service_run.end.annobin_master_service_is_killed.start.annobin_master_service_is_killed.end.annobin_master_service_is_master_stopped.start.annobin_master_service_is_master_stopped.end.annobin_master_service_anvil_send.start.annobin_master_service_anvil_send.endmaster_service_anvil_send.cold.31__func__.9453.annobin_master_service_client_connection_created.start.annobin_master_service_client_connection_created.endmaster_service_client_connection_created.cold.32__func__.9457.annobin_master_service_client_connection_accept.start.annobin_master_service_client_connection_accept.end.annobin_master_service_close_config_fd.start.annobin_master_service_close_config_fd.end__func__.9495.annobin_master_service_io_listeners_add.start.annobin_master_service_io_listeners_add.endmaster_service_listen.annobin_master_service_init_finish.start.annobin_master_service_init_finish.endmaster_status_errorsig_state_changedmaster_service_init_finish.cold.33__func__.9358.annobin_master_service_refresh_login_state.start.annobin_master_service_refresh_login_state.endmaster_service_refresh_login_state.annobin_sig_state_changed.start.annobin_sig_state_changed.end.annobin_master_service_client_connection_destroyed.start.annobin_master_service_client_connection_destroyed.endmaster_service_client_connection_destroyed.cold.34__func__.9476.annobin_master_service_overflow.start.annobin_master_service_overflow.endmaster_service_overflowmaster_service_overflow.cold.35__func__.9520.annobin_master_service_io_listeners_remove.start.annobin_master_service_io_listeners_remove.end.annobin_master_service_stop_new_connections.start.annobin_master_service_stop_new_connections.end.annobin_master_service_event_callback.start.annobin_master_service_event_callback.end.annobin_master_status_error.start.annobin_master_status_error.end.annobin_master_service_client_connection_handled.start.annobin_master_service_client_connection_handled.endmaster_service_client_connection_handled.cold.36__func__.9465.annobin_master_service_client_connection_callback.start.annobin_master_service_client_connection_callback.end.annobin_master_service_listen.start.annobin_master_service_listen.endmaster_service_listen.cold.37__func__.9540__func__.9533.annobin_master_service_ssl_io_listeners_remove.start.annobin_master_service_ssl_io_listeners_remove.end.annobin_version_string_verify_full.start.annobin_version_string_verify_full.endversion_string_verify_full.cold.38.annobin_version_string_verify.start.annobin_version_string_verify.end.annobin_master_service_unset_process_shutdown_filter.start.annobin_master_service_unset_process_shutdown_filter.end.annobin_master_service_deinit_real.start.annobin_master_service_deinit_real.endmaster_service_deinit_realmaster_service_deinit_real.cold.39.annobin_master_service_deinit.start.annobin_master_service_deinit.end.annobin_master_service_deinit_forked.start.annobin_master_service_deinit_forked.end.annobin_master_service_set_process_shutdown_filter.start.annobin_master_service_set_process_shutdown_filter.end.annobin_master_service_haproxy.c.annobin_master_service_haproxy.c_end.annobin_master_service_haproxy.c.hot.annobin_master_service_haproxy.c_end.hot.annobin_master_service_haproxy.c.unlikely.annobin_master_service_haproxy.c_end.unlikely.annobin_master_service_haproxy.c.startup.annobin_master_service_haproxy.c_end.startup.annobin_master_service_haproxy.c.exit.annobin_master_service_haproxy.c_end.exit.annobin_master_service_haproxy_conn_free.start.annobin_master_service_haproxy_conn_free.endmaster_service_haproxy_conn_free.annobin_master_service_haproxy_conn_failure.start.annobin_master_service_haproxy_conn_failure.endmaster_service_haproxy_conn_failure.annobin_master_service_haproxy_timeout.start.annobin_master_service_haproxy_timeout.endmaster_service_haproxy_timeout.annobin_master_service_haproxy_recv.start.annobin_master_service_haproxy_recv.endmaster_service_haproxy_recv.annobin_master_service_haproxy_read.start.annobin_master_service_haproxy_read.endmaster_service_haproxy_readbuf.7554haproxy_v2sigmaster_service_haproxy_read.cold.2__func__.7569.annobin_master_service_haproxy_input.start.annobin_master_service_haproxy_input.endmaster_service_haproxy_input.annobin_master_service_haproxy_new.start.annobin_master_service_haproxy_new.endmaster_service_haproxy_new.cold.3.annobin_master_service_haproxy_abort.start.annobin_master_service_haproxy_abort.end__func__.7610.annobin_master_service_settings.c.annobin_master_service_settings.c_end.annobin_master_service_settings.c.hot.annobin_master_service_settings.c_end.hot.annobin_master_service_settings.c.unlikely.annobin_master_service_settings.c_end.unlikely.annobin_master_service_settings.c.startup.annobin_master_service_settings.c_end.startup.annobin_master_service_settings.c.exit.annobin_master_service_settings.c_end.exit.annobin_master_service_set_process_shutdown_filter_wrapper.start.annobin_master_service_set_process_shutdown_filter_wrapper.endmaster_service_set_process_shutdown_filter_wrapper.annobin_setting_filter_parse.part.7.start.annobin_setting_filter_parse.part.7.endsetting_filter_parse.part.7.annobin_master_service_settings_check.start.annobin_master_service_settings_check.endmaster_service_settings_check.annobin_array_idx_i.isra.11.part.12.start.annobin_array_idx_i.isra.11.part.12.endarray_idx_i.isra.11.part.12.annobin_config_exec_fallback.start.annobin_config_exec_fallback.endconfig_exec_fallbackconfig_exec_fallback.cold.14.annobin_master_service_open_config.start.annobin_master_service_open_config.endmaster_service_open_config.annobin_master_service_config_socket_try_open.start.annobin_master_service_config_socket_try_open.end.annobin_master_service_settings_get_filters.start.annobin_master_service_settings_get_filters.end__func__.8410master_service_settings_get_filters.cold.15.annobin_master_service_settings_read.start.annobin_master_service_settings_read.end__func__.8442master_service_settings_read.cold.16.annobin_master_service_settings_read_simple.start.annobin_master_service_settings_read_simple.end.annobin_master_service_settings_detach.start.annobin_master_service_settings_detach.end.annobin_master_service_settings_get.start.annobin_master_service_settings_get.end.annobin_master_service_settings_parser_get_others.start.annobin_master_service_settings_parser_get_others.end.annobin_master_service_settings_get_others.start.annobin_master_service_settings_get_others.end.annobin_master_service_get_settings_parser.start.annobin_master_service_get_settings_parser.end.annobin_master_service_set.start.annobin_master_service_set.end.annobin_master_service_set_has_config_override.start.annobin_master_service_set_has_config_override.endmaster_service_set_has_config_override.cold.17master_service_setting_definesmaster_service_default_settings.annobin_master_service_settings_cache.c.annobin_master_service_settings_cache.c_end.annobin_master_service_settings_cache.c.hot.annobin_master_service_settings_cache.c_end.hot.annobin_master_service_settings_cache.c.unlikely.annobin_master_service_settings_cache.c_end.unlikely.annobin_master_service_settings_cache.c.startup.annobin_master_service_settings_cache.c_end.startup.annobin_master_service_settings_cache.c.exit.annobin_master_service_settings_cache.c_end.exit.annobin_cache_find.start.annobin_cache_find.endcache_find.annobin_master_service_settings_cache_init.start.annobin_master_service_settings_cache_init.end.annobin_master_service_settings_cache_init_filter.start.annobin_master_service_settings_cache_init_filter.endmaster_service_settings_cache_init_filter.cold.2.annobin_master_service_settings_cache_deinit.start.annobin_master_service_settings_cache_deinit.endmaster_service_settings_cache_deinit.cold.3__func__.7531.annobin_master_service_settings_cache_read.start.annobin_master_service_settings_cache_read.endmaster_service_settings_cache_read.cold.4__func__.7585__func__.7568.annobin_master_service_ssl.c.annobin_master_service_ssl.c_end.annobin_master_service_ssl.c.hot.annobin_master_service_ssl.c_end.hot.annobin_master_service_ssl.c.unlikely.annobin_master_service_ssl.c_end.unlikely.annobin_master_service_ssl.c.startup.annobin_master_service_ssl.c_end.startup.annobin_master_service_ssl.c.exit.annobin_master_service_ssl.c_end.exit.annobin_master_service_ssl_init.start.annobin_master_service_ssl_init.endmaster_service_ssl_init.cold.0__func__.7733.annobin_master_service_ssl_is_enabled.start.annobin_master_service_ssl_is_enabled.end.annobin_master_service_ssl_ctx_init.start.annobin_master_service_ssl_ctx_init.endmaster_service_ssl_ctx_init.cold.1__func__.7744.annobin_master_service_ssl_ctx_deinit.start.annobin_master_service_ssl_ctx_deinit.end.annobin_master_service_ssl_settings.c.annobin_master_service_ssl_settings.c_end.annobin_master_service_ssl_settings.c.hot.annobin_master_service_ssl_settings.c_end.hot.annobin_master_service_ssl_settings.c.unlikely.annobin_master_service_ssl_settings.c_end.unlikely.annobin_master_service_ssl_settings.c.startup.annobin_master_service_ssl_settings.c_end.startup.annobin_master_service_ssl_settings.c.exit.annobin_master_service_ssl_settings.c_end.exit.annobin_master_service_ssl_common_settings_to_iostream_set.start.annobin_master_service_ssl_common_settings_to_iostream_set.endmaster_service_ssl_common_settings_to_iostream_set.annobin_master_service_ssl_settings_check.start.annobin_master_service_ssl_settings_check.endmaster_service_ssl_settings_check.annobin_master_service_ssl_settings_get_from_parser.start.annobin_master_service_ssl_settings_get_from_parser.end.annobin_master_service_ssl_settings_get.start.annobin_master_service_ssl_settings_get.end.annobin_master_service_ssl_server_settings_get.start.annobin_master_service_ssl_server_settings_get.endmaster_service_ssl_server_settings_get.cold.1__func__.7423.annobin_master_service_ssl_client_settings_to_iostream_set.start.annobin_master_service_ssl_client_settings_to_iostream_set.end.annobin_master_service_ssl_server_settings_to_iostream_set.start.annobin_master_service_ssl_server_settings_to_iostream_set.endmaster_service_ssl_server_setting_definesmaster_service_ssl_server_default_settingsmaster_service_ssl_server_setting_dependenciesmaster_service_ssl_setting_definesmaster_service_ssl_default_settings.annobin_stats_client.c.annobin_stats_client.c_end.annobin_stats_client.c.hot.annobin_stats_client.c_end.hot.annobin_stats_client.c.unlikely.annobin_stats_client.c_end.unlikely.annobin_stats_client.c.startup.annobin_stats_client.c_end.startup.annobin_stats_client.c.exit.annobin_stats_client.c_end.exit.annobin_stats_event_write.start.annobin_stats_event_write.endstats_event_writestats_event_write.cold.8__func__.6664.annobin_stats_client_timeout.start.annobin_stats_client_timeout.endstats_client_timeout.annobin_stats_client_input_args.start.annobin_stats_client_input_args.endstats_client_input_args.annobin_stats_client_destroy.start.annobin_stats_client_destroy.endstats_client_destroystats_client_reconnect.annobin_stats_client_wait.start.annobin_stats_client_wait.endstats_client_waitstats_client_wait.cold.9__func__.6716.annobin_stats_category_append.isra.2.start.annobin_stats_category_append.isra.2.endstats_category_append.isra.2.annobin_stats_category_registered.start.annobin_stats_category_registered.endstats_category_registeredstats_clients.annobin_stats_event_callback.start.annobin_stats_event_callback.endstats_event_callbackrecursion.6671stats_event_callback.cold.10__func__.6674.annobin_stats_client_deinit_callback.start.annobin_stats_client_deinit_callback.endstats_client_deinit_callback.annobin_stats_client_connect.start.annobin_stats_client_connect.endstats_client_connect.annobin_stats_client_reconnect.start.annobin_stats_client_reconnect.end.annobin_stats_client_init.start.annobin_stats_client_init.endstats_client_vfuncsstats_client_set.annobin_stats_client_deinit.start.annobin_stats_client_deinit.end.annobin_syslog_util.c.annobin_syslog_util.c_end.annobin_syslog_util.c.hot.annobin_syslog_util.c_end.hot.annobin_syslog_util.c.unlikely.annobin_syslog_util.c_end.unlikely.annobin_syslog_util.c.startup.annobin_syslog_util.c_end.startup.annobin_syslog_util.c.exit.annobin_syslog_util.c_end.exit.annobin_syslog_facility_find.start.annobin_syslog_facility_find.end.annobin_settings.c.annobin_settings.c_end.annobin_settings.c.hot.annobin_settings.c_end.hot.annobin_settings.c.unlikely.annobin_settings.c_end.unlikely.annobin_settings.c.startup.annobin_settings.c_end.startup.annobin_settings.c.exit.annobin_settings.c_end.exit.annobin_parse_setting_from_defs.start.annobin_parse_setting_from_defs.end.annobin_settings_read_i.start.annobin_settings_read_i.endsettings_read_i.cold.2__func__.5855.annobin_settings_parser.c.annobin_settings_parser.c_end.annobin_settings_parser.c.hot.annobin_settings_parser.c_end.hot.annobin_settings_parser.c.unlikely.annobin_settings_parser.c_end.unlikely.annobin_settings_parser.c.startup.annobin_settings_parser.c_end.startup.annobin_settings_parser.c.exit.annobin_settings_parser.c_end.exit.annobin_settings_get_time_full.start.annobin_settings_get_time_full.endsettings_get_time_full.annobin_environ_cmp.start.annobin_environ_cmp.endenviron_cmp.annobin_settings_var_expand_info.start.annobin_settings_var_expand_info.endsettings_var_expand_info__func__.8869settings_var_expand_info.cold.24.annobin_setting_copy.start.annobin_setting_copy.endsetting_copysetting_copy.cold.25__func__.8995.annobin_settings_changes_init.isra.9.start.annobin_settings_changes_init.isra.9.endsettings_changes_init.isra.9settings_changes_init.isra.9.cold.26__func__.9223.annobin_settings_dup_full.start.annobin_settings_dup_full.endsettings_dup_fullsettings_dup_full.cold.27.annobin_settings_changes_dup.isra.8.start.annobin_settings_changes_dup.isra.8.endsettings_changes_dup.isra.8settings_changes_dup.isra.8.cold.28.annobin_settings_link_get_new.start.annobin_settings_link_get_new.endsettings_link_get_new__func__.9179settings_link_get_new.cold.29.annobin_settings_parser_deinit.start.annobin_settings_parser_deinit.end.annobin_settings_parser_get.start.annobin_settings_parser_get.endsettings_parser_get.cold.30__func__.8425.annobin_settings_parser_get_list.start.annobin_settings_parser_get_list.end.annobin_settings_parser_get_changes.start.annobin_settings_parser_get_changes.endsettings_parser_get_changes.cold.31__func__.8437.annobin_settings_parser_get_roots.start.annobin_settings_parser_get_roots.end.annobin_settings_parser_get_error.start.annobin_settings_parser_get_error.end.annobin_settings_get_time.start.annobin_settings_get_time.end.annobin_settings_get_time_msecs.start.annobin_settings_get_time_msecs.end.annobin_settings_get_size.start.annobin_settings_get_size.end.annobin_settings_parse_get_prev_info.start.annobin_settings_parse_get_prev_info.end.annobin_settings_check.start.annobin_settings_check.endsettings_check.localalias.23settings_check.cold.32.annobin_settings_parser_check.start.annobin_settings_parser_check.end.annobin_settings_parse_set_expanded.start.annobin_settings_parse_set_expanded.end.annobin_settings_var_expand_with_funcs.start.annobin_settings_var_expand_with_funcs.endsettings_var_expand_with_funcs.cold.33.annobin_settings_var_expand.start.annobin_settings_var_expand.end.annobin_settings_parse_var_skip.start.annobin_settings_parse_var_skip.end.annobin_settings_vars_have_key.start.annobin_settings_vars_have_key.endsettings_vars_have_key.localalias.22settings_vars_have_key.cold.34__func__.8939.annobin_settings_dup.start.annobin_settings_dup.end.annobin_settings_apply.start.annobin_settings_apply.endsettings_applysettings_apply.cold.35__func__.9274__func__.9293.annobin_settings_dup_with_pointers.start.annobin_settings_dup_with_pointers.end.annobin_settings_parser_info_update.start.annobin_settings_parser_info_update.endsettings_parser_info_update.cold.36__func__.9096.annobin_settings_parser_dyn_update.start.annobin_settings_parser_dyn_update.endsettings_parser_dyn_update.cold.37.annobin_settings_find_dynamic.start.annobin_settings_find_dynamic.end.annobin_settings_parser_dup.start.annobin_settings_parser_dup.endsettings_parser_dup.cold.38__func__.9196.annobin_settings_parser_apply_changes.start.annobin_settings_parser_apply_changes.endsettings_parser_apply_changes.cold.39__func__.9304.annobin_settings_section_escape.start.annobin_settings_section_escape.end.annobin_setting_parser_copy_defaults.start.annobin_setting_parser_copy_defaults.endsetting_parser_copy_defaultssetting_parser_copy_defaults.cold.40__func__.8377.annobin_settings_parser_init_list.start.annobin_settings_parser_init_list.endsettings_parser_init_list.cold.41__func__.8407.annobin_settings_parser_init.start.annobin_settings_parser_init.end.annobin_setting_link_init_set_struct.start.annobin_setting_link_init_set_struct.endsetting_link_init_set_structsetting_link_init_set_struct.cold.42.annobin_setting_link_add.start.annobin_setting_link_add.endsetting_link_addsetting_link_add.cold.43__func__.8552.annobin_get_deflist.start.annobin_get_deflist.endget_defliststrlist_info__func__.8566.annobin_settings_parse_keyvalue.start.annobin_settings_parse_keyvalue.endsettings_find_key_nthsettings_parse_keyvalue.cold.44__func__.8587__func__.8654.annobin_settings_find_key_nth.start.annobin_settings_find_key_nth.endsettings_find_key_nth.cold.45__func__.8624.annobin_settings_parse_is_valid_key.start.annobin_settings_parse_is_valid_key.end.annobin_settings_parse_unalias.start.annobin_settings_parse_unalias.endsettings_parse_unalias.cold.46__func__.8669.annobin_settings_parse_get_value.start.annobin_settings_parse_get_value.end.annobin_settings_parse_is_changed.start.annobin_settings_parse_is_changed.end.annobin_settings_parse_set_key_expanded.start.annobin_settings_parse_set_key_expanded.end__func__.8828settings_parse_set_key_expanded.cold.47.annobin_settings_parse_set_keys_expanded.start.annobin_settings_parse_set_keys_expanded.end.annobin_settings_parse_line.start.annobin_settings_parse_line.endsettings_parse_line.cold.48.annobin_settings_parse_stream.start.annobin_settings_parse_stream.endsettings_parse_stream.cold.49.annobin_settings_parse_stream_read.start.annobin_settings_parse_stream_read.end.annobin_settings_parse_file.start.annobin_settings_parse_file.end.annobin_settings_parse_exec.start.annobin_settings_parse_exec.end__func__.8774argv.8775settings_parse_exec.cold.50.annobin_settings_parse_environ.start.annobin_settings_parse_environ.endsettings_parse_environ.cold.51.annobin_stats.c.annobin_stats.c_end.annobin_stats.c.hot.annobin_stats.c_end.hot.annobin_stats.c.unlikely.annobin_stats.c_end.unlikely.annobin_stats.c.startup.annobin_stats.c_end.startup.annobin_stats.c.exit.annobin_stats.c_end.exit.annobin_stats_register.start.annobin_stats_register.endstats_allocatedstats_itemsstats_total_sizestats_register.cold.5.annobin_stats_unregister.start.annobin_stats_unregister.end.annobin_stats_alloc_size.start.annobin_stats_alloc_size.end.annobin_stats_alloc.start.annobin_stats_alloc.endstats_alloc.cold.6.annobin_stats_copy.start.annobin_stats_copy.end.annobin_stats_field_count.start.annobin_stats_field_count.end.annobin_stats_field_name.start.annobin_stats_field_name.endstats_field_name.cold.7.annobin_stats_field_value.start.annobin_stats_field_value.endstats_field_value.cold.8.annobin_stats_diff.start.annobin_stats_diff.end.annobin_stats_add.start.annobin_stats_add.end.annobin_stats_have_changed.start.annobin_stats_have_changed.end.annobin_stats_export.start.annobin_stats_export.end.annobin_stats_import.start.annobin_stats_import.endstats_import.cold.9__func__.4979.annobin_stats_fill_ptr.start.annobin_stats_fill_ptr.end.annobin_stats_reset.start.annobin_stats_reset.end.annobin_stats_connection.c.annobin_stats_connection.c_end.annobin_stats_connection.c.hot.annobin_stats_connection.c_end.hot.annobin_stats_connection.c.unlikely.annobin_stats_connection.c_end.unlikely.annobin_stats_connection.c.startup.annobin_stats_connection.c_end.startup.annobin_stats_connection.c.exit.annobin_stats_connection.c_end.exit.annobin_stats_connection_open.start.annobin_stats_connection_open.endstats_connection_openstats_connection_open.cold.4.annobin_stats_connection_create.start.annobin_stats_connection_create.end.annobin_stats_connection_ref.start.annobin_stats_connection_ref.end.annobin_stats_connection_unref.start.annobin_stats_connection_unref.end__func__.7535stats_connection_unref.cold.5.annobin_stats_connection_send.start.annobin_stats_connection_send.endpipe_warned.7540stats_connection_send.cold.6__func__.7542.annobin_stats_parser.c.annobin_stats_parser.c_end.annobin_stats_parser.c.hot.annobin_stats_parser.c_end.hot.annobin_stats_parser.c.unlikely.annobin_stats_parser.c_end.unlikely.annobin_stats_parser.c.startup.annobin_stats_parser.c_end.startup.annobin_stats_parser.c.exit.annobin_stats_parser.c_end.exit.annobin_stats_parser_diff.start.annobin_stats_parser_diff.end.annobin_stats_parser_add.start.annobin_stats_parser_add.end.annobin_stats_parser_value.start.annobin_stats_parser_value.end.annobin_http_date.c.annobin_http_date.c_end.annobin_http_date.c.hot.annobin_http_date.c_end.hot.annobin_http_date.c.unlikely.annobin_http_date.c_end.unlikely.annobin_http_date.c.startup.annobin_http_date.c_end.startup.annobin_http_date.c.exit.annobin_http_date.c_end.exit.annobin_http_date_parse_time_of_day.start.annobin_http_date_parse_time_of_day.endhttp_date_parse_time_of_day.annobin_http_date_parse.start.annobin_http_date_parse.endweekday_names_longweekday_namesmonth_names.annobin_http_date_parse_tm.start.annobin_http_date_parse_tm.end.annobin_http_date_create_tm.start.annobin_http_date_create_tm.end.annobin_http_date_create.start.annobin_http_date_create.end.annobin_http_url.c.annobin_http_url.c_end.annobin_http_url.c.hot.annobin_http_url.c_end.hot.annobin_http_url.c.unlikely.annobin_http_url.c_end.unlikely.annobin_http_url.c.startup.annobin_http_url.c_end.startup.annobin_http_url.c.exit.annobin_http_url.c_end.exit.annobin_http_url_add_scheme.start.annobin_http_url_add_scheme.endhttp_url_add_scheme.annobin_http_url_parse_authority.start.annobin_http_url_parse_authority.endhttp_url_parse_authority.annobin_http_url_add_target.isra.2.start.annobin_http_url_add_target.isra.2.endhttp_url_add_target.isra.2.annobin_http_url_do_parse.start.annobin_http_url_do_parse.endhttp_url_do_parsehttp_url_do_parse.cold.5__func__.5946__func__.5987.annobin_http_url_parse.start.annobin_http_url_parse.end__func__.5997.annobin_http_url_request_target_parse.start.annobin_http_url_request_target_parse.end.annobin_http_url_init_authority_from.start.annobin_http_url_init_authority_from.end.annobin_http_url_copy_authority.start.annobin_http_url_copy_authority.end.annobin_http_url_clone_authority.start.annobin_http_url_clone_authority.end.annobin_http_url_copy.start.annobin_http_url_copy.end.annobin_http_url_copy_with_userinfo.start.annobin_http_url_copy_with_userinfo.end.annobin_http_url_clone.start.annobin_http_url_clone.end.annobin_http_url_clone_with_userinfo.start.annobin_http_url_clone_with_userinfo.end.annobin_http_url_create.start.annobin_http_url_create.end.annobin_http_url_create_host.start.annobin_http_url_create_host.end.annobin_http_url_create_authority.start.annobin_http_url_create_authority.end.annobin_http_url_create_target.start.annobin_http_url_create_target.end.annobin_http_url_escape_path.start.annobin_http_url_escape_path.end.annobin_http_url_escape_param.start.annobin_http_url_escape_param.end.annobin_http_parser.c.annobin_http_parser.c_end.annobin_http_parser.c.hot.annobin_http_parser.c_end.hot.annobin_http_parser.c.unlikely.annobin_http_parser.c_end.unlikely.annobin_http_parser.c.startup.annobin_http_parser.c_end.startup.annobin_http_parser.c.exit.annobin_http_parser.c_end.exit.annobin_http_parser_init.start.annobin_http_parser_init.end.annobin_http_parse_ows.start.annobin_http_parse_ows.end.annobin_http_parser_skip_token.start.annobin_http_parser_skip_token.end.annobin_http_parse_token.start.annobin_http_parse_token.end.annobin_http_parse_token_list_next.start.annobin_http_parse_token_list_next.end.annobin_http_parse_quoted_string.start.annobin_http_parse_quoted_string.end.annobin_http_parse_token_or_qstring.start.annobin_http_parse_token_or_qstring.end.annobin_http_header.c.annobin_http_header.c_end.annobin_http_header.c.hot.annobin_http_header.c_end.hot.annobin_http_header.c.unlikely.annobin_http_header.c_end.unlikely.annobin_http_header.c.startup.annobin_http_header.c_end.startup.annobin_http_header.c.exit.annobin_http_header.c_end.exit.annobin_http_header_create.start.annobin_http_header_create.end.annobin_http_header_field_add.start.annobin_http_header_field_add.endhttp_header_field_add.cold.5.annobin_http_header_field_delete.start.annobin_http_header_field_delete.end.annobin_http_header_get_fields.start.annobin_http_header_get_fields.end.annobin_http_header_field_find.start.annobin_http_header_field_find.end.annobin_http_header_field_get.start.annobin_http_header_field_get.end.annobin_http_header_field_find_unique.start.annobin_http_header_field_find_unique.end.annobin_http_header_parser.c.annobin_http_header_parser.c_end.annobin_http_header_parser.c.hot.annobin_http_header_parser.c_end.hot.annobin_http_header_parser.c.unlikely.annobin_http_header_parser.c_end.unlikely.annobin_http_header_parser.c.startup.annobin_http_header_parser.c_end.startup.annobin_http_header_parser.c.exit.annobin_http_header_parser.c_end.exit.annobin_http_header_parser_init.start.annobin_http_header_parser_init.end.annobin_http_header_parser_deinit.start.annobin_http_header_parser_deinit.end.annobin_http_header_parser_reset.start.annobin_http_header_parser_reset.end.annobin_http_header_parse_next_field.start.annobin_http_header_parse_next_field.endhttp_header_parse_next_field.cold.5__func__.4912__func__.5231.annobin_http_transfer_chunked.c.annobin_http_transfer_chunked.c_end.annobin_http_transfer_chunked.c.hot.annobin_http_transfer_chunked.c_end.hot.annobin_http_transfer_chunked.c.unlikely.annobin_http_transfer_chunked.c_end.unlikely.annobin_http_transfer_chunked.c.startup.annobin_http_transfer_chunked.c_end.startup.annobin_http_transfer_chunked.c.exit.annobin_http_transfer_chunked.c_end.exit.annobin_http_transfer_chunked_skip_token.start.annobin_http_transfer_chunked_skip_token.endhttp_transfer_chunked_skip_token.annobin_http_transfer_chunked_istream_destroy.start.annobin_http_transfer_chunked_istream_destroy.endhttp_transfer_chunked_istream_destroy.annobin_http_transfer_chunked_ostream_flush.start.annobin_http_transfer_chunked_ostream_flush.endhttp_transfer_chunked_ostream_flushhttp_transfer_chunked_ostream_flush.cold.5__func__.5771.annobin_http_transfer_chunked_ostream_close.start.annobin_http_transfer_chunked_ostream_close.endhttp_transfer_chunked_ostream_closehttp_transfer_chunked_ostream_close.cold.6__func__.5777.annobin_http_transfer_chunked_ostream_sendv.start.annobin_http_transfer_chunked_ostream_sendv.endhttp_transfer_chunked_ostream_sendvhttp_transfer_chunked_ostream_sendv.cold.7__func__.5796.annobin_http_transfer_chunked_istream_read.start.annobin_http_transfer_chunked_istream_read.endhttp_transfer_chunked_istream_readhttp_transfer_chunked_istream_read.cold.8__func__.5715__func__.4786.annobin_http_transfer_chunked_istream_create.start.annobin_http_transfer_chunked_istream_create.end.annobin_http_transfer_chunked_ostream_create.start.annobin_http_transfer_chunked_ostream_create.end.annobin_http_auth.c.annobin_http_auth.c_end.annobin_http_auth.c.hot.annobin_http_auth.c_end.hot.annobin_http_auth.c.unlikely.annobin_http_auth.c_end.unlikely.annobin_http_auth.c.startup.annobin_http_auth.c_end.startup.annobin_http_auth.c.exit.annobin_http_auth.c_end.exit.annobin_http_auth_check_token68.start.annobin_http_auth_check_token68.endhttp_auth_check_token68http_auth_check_token68.cold.12__func__.5239.annobin_http_parse_token68.isra.3.start.annobin_http_parse_token68.isra.3.endhttp_parse_token68.isra.3.annobin_http_parse_auth_params.start.annobin_http_parse_auth_params.endhttp_parse_auth_params.annobin_http_auth_create_params.start.annobin_http_auth_create_params.endhttp_auth_create_params.annobin_http_auth_params_clone.part.6.start.annobin_http_auth_params_clone.part.6.endhttp_auth_params_clone.part.6.annobin_http_auth_parse_challenges.start.annobin_http_auth_parse_challenges.end.annobin_http_auth_parse_credentials.start.annobin_http_auth_parse_credentials.end.annobin_http_auth_create_challenge.start.annobin_http_auth_create_challenge.end.annobin_http_auth_create_challenges.start.annobin_http_auth_create_challenges.end.annobin_http_auth_create_credentials.start.annobin_http_auth_create_credentials.end.annobin_http_auth_challenge_copy.start.annobin_http_auth_challenge_copy.end.annobin_http_auth_challenge_clone.start.annobin_http_auth_challenge_clone.end.annobin_http_auth_credentials_copy.start.annobin_http_auth_credentials_copy.end.annobin_http_auth_credentials_clone.start.annobin_http_auth_credentials_clone.end.annobin_http_auth_basic_challenge_init.start.annobin_http_auth_basic_challenge_init.end.annobin_http_auth_basic_credentials_init.start.annobin_http_auth_basic_credentials_init.endhttp_auth_basic_credentials_init.cold.13__func__.5307.annobin_http_message_parser.c.annobin_http_message_parser.c_end.annobin_http_message_parser.c.hot.annobin_http_message_parser.c_end.hot.annobin_http_message_parser.c.unlikely.annobin_http_message_parser.c_end.unlikely.annobin_http_message_parser.c.startup.annobin_http_message_parser.c_end.startup.annobin_http_message_parser.c.exit.annobin_http_message_parser.c_end.exit.annobin_http_istream_error_callback.start.annobin_http_istream_error_callback.endhttp_istream_error_callbackhttp_istream_error_callback.cold.11__func__.5571.annobin_http_message_parser_init.start.annobin_http_message_parser_init.end.annobin_http_message_parser_deinit.start.annobin_http_message_parser_deinit.end.annobin_http_message_parser_restart.start.annobin_http_message_parser_restart.endhttp_message_parser_restart.cold.12__func__.5463.annobin_http_message_parser_get_pool.start.annobin_http_message_parser_get_pool.end.annobin_http_message_parse_version.start.annobin_http_message_parse_version.end.annobin_http_message_parse_finish_payload.start.annobin_http_message_parse_finish_payload.endhttp_message_parse_finish_payload.cold.13__func__.5047.annobin_http_message_parse_headers.start.annobin_http_message_parse_headers.end.annobin_http_message_parse_body.start.annobin_http_message_parse_body.endhttp_message_parse_body.cold.14__func__.5601.annobin_http_request.c.annobin_http_request.c_end.annobin_http_request.c.hot.annobin_http_request.c_end.hot.annobin_http_request.c.unlikely.annobin_http_request.c_end.unlikely.annobin_http_request.c.startup.annobin_http_request.c_end.startup.annobin_http_request.c.exit.annobin_http_request.c_end.exit.annobin_http_request_has_connection_option.start.annobin_http_request_has_connection_option.end.annobin_http_request_get_payload_size.start.annobin_http_request_get_payload_size.end.annobin_http_request_parser.c.annobin_http_request_parser.c_end.annobin_http_request_parser.c.hot.annobin_http_request_parser.c_end.hot.annobin_http_request_parser.c.unlikely.annobin_http_request_parser.c_end.unlikely.annobin_http_request_parser.c.startup.annobin_http_request_parser.c_end.startup.annobin_http_request_parser.c.exit.annobin_http_request_parser.c_end.exit.annobin_http_request_parser_message_error.isra.0.part.1.start.annobin_http_request_parser_message_error.isra.0.part.1.endhttp_request_parser_message_error.isra.0.part.1.annobin_http_request_parser_init.start.annobin_http_request_parser_init.end.annobin_http_request_parser_deinit.start.annobin_http_request_parser_deinit.end.annobin_http_request_parser_pending_payload.start.annobin_http_request_parser_pending_payload.end.annobin_http_request_parse_finish_payload.start.annobin_http_request_parse_finish_payload.endCSWTCH.12http_request_parse_finish_payload.cold.7.annobin_http_request_parse_next.start.annobin_http_request_parse_next.endhttp_request_parse_next.cold.8__func__.4779.annobin_http_response.c.annobin_http_response.c_end.annobin_http_response.c.hot.annobin_http_response.c_end.hot.annobin_http_response.c.unlikely.annobin_http_response.c_end.unlikely.annobin_http_response.c.startup.annobin_http_response.c_end.startup.annobin_http_response.c.exit.annobin_http_response.c_end.exit.annobin_http_response_init.start.annobin_http_response_init.end.annobin_http_response_has_connection_option.start.annobin_http_response_has_connection_option.end.annobin_http_response_get_payload_size.start.annobin_http_response_get_payload_size.end.annobin_http_response_parser.c.annobin_http_response_parser.c_end.annobin_http_response_parser.c.hot.annobin_http_response_parser.c_end.hot.annobin_http_response_parser.c.unlikely.annobin_http_response_parser.c_end.unlikely.annobin_http_response_parser.c.startup.annobin_http_response_parser.c_end.startup.annobin_http_response_parser.c.exit.annobin_http_response_parser.c_end.exit.annobin__reply_sanitize.isra.0.start.annobin__reply_sanitize.isra.0.end_reply_sanitize.isra.0_reply_sanitize.isra.0.cold.2__func__.5548.annobin_http_response_parser_init.start.annobin_http_response_parser_init.end.annobin_http_response_parser_deinit.start.annobin_http_response_parser_deinit.end.annobin_http_response_parser_get_last_offset.start.annobin_http_response_parser_get_last_offset.end.annobin_http_response_parse_next.start.annobin_http_response_parse_next.endhttp_response_parse_next.cold.3__func__.4985.annobin_http_client_request.c.annobin_http_client_request.c_end.annobin_http_client_request.c.hot.annobin_http_client_request.c_end.hot.annobin_http_client_request.c.unlikely.annobin_http_client_request.c_end.unlikely.annobin_http_client_request.c.startup.annobin_http_client_request.c_end.startup.annobin_http_client_request.c.exit.annobin_http_client_request.c_end.exit.annobin_http_client_request_do_submit.start.annobin_http_client_request_do_submit.endhttp_client_request_do_submithttp_client_request_do_submit.cold.8__func__.9404.annobin_http_client_request_payload_input.start.annobin_http_client_request_payload_input.endhttp_client_request_payload_input.annobin_http_client_request_result_event.start.annobin_http_client_request_result_event.endhttp_client_request_result_eventhttp_client_request_result_event.cold.9__func__.9106.annobin_http_client_request_reset.start.annobin_http_client_request_reset.endhttp_client_request_reset.annobin_http_client_request_remove.start.annobin_http_client_request_remove.endhttp_client_request_removehttp_client_request_remove.cold.10__func__.9175.annobin_http_client_request_lookup_header_pos.isra.4.start.annobin_http_client_request_lookup_header_pos.isra.4.endhttp_client_request_lookup_header_pos.isra.4.annobin_http_client_request_add_header_full.start.annobin_http_client_request_add_header_full.endhttp_client_request_add_header_full__func__.9239http_client_request_add_header_full.cold.11.annobin_http_client_request_finish_payload_out.start.annobin_http_client_request_finish_payload_out.endhttp_client_request_finish_payload_outhttp_client_request_finish_payload_out.cold.12__func__.9426.annobin_http_client_request_new.start.annobin_http_client_request_new.endhttp_client_request_newid_counter.9114.annobin_http_client_request_label.start.annobin_http_client_request_label.end.annobin_http_client_request_update_event.start.annobin_http_client_request_update_event.endhttp_client_request_update_event.annobin_http_client_request.start.annobin_http_client_request.end.annobin_http_client_request_url.start.annobin_http_client_request_url.end.annobin_http_client_request_connect.start.annobin_http_client_request_connect.end.annobin_http_client_request_connect_ip.start.annobin_http_client_request_connect_ip.endhttp_client_request_connect_ip.cold.13__func__.9162.annobin_http_client_request_set_event.start.annobin_http_client_request_set_event.end.annobin_http_client_request_ref.start.annobin_http_client_request_ref.endhttp_client_request_ref.cold.14.annobin_http_client_request_unref.start.annobin_http_client_request_unref.endhttp_client_request_unref.cold.15__func__.9185.annobin_http_client_request_destroy.start.annobin_http_client_request_destroy.end.annobin_http_client_request_set_port.start.annobin_http_client_request_set_port.endhttp_client_request_set_port.cold.16__func__.9202.annobin_http_client_request_set_ssl.start.annobin_http_client_request_set_ssl.endhttp_client_request_set_ssl.cold.17__func__.9207.annobin_http_client_request_set_urgent.start.annobin_http_client_request_set_urgent.endhttp_client_request_set_urgent.cold.18__func__.9211.annobin_http_client_request_set_preserve_exact_reason.start.annobin_http_client_request_set_preserve_exact_reason.end.annobin_http_client_request_add_header.start.annobin_http_client_request_add_header.end.annobin_http_client_request_add_missing_header.start.annobin_http_client_request_add_missing_header.end.annobin_http_client_request_remove_header.start.annobin_http_client_request_remove_header.end__func__.9275.annobin_http_client_request_lookup_header.start.annobin_http_client_request_lookup_header.end.annobin_http_client_request_set_date.start.annobin_http_client_request_set_date.endhttp_client_request_set_date.cold.19__func__.9287.annobin_http_client_request_set_payload.start.annobin_http_client_request_set_payload.endhttp_client_request_set_payload.cold.20__func__.9294.annobin_http_client_request_set_payload_data.start.annobin_http_client_request_set_payload_data.endhttp_client_request_set_payload_data.cold.21.annobin_http_client_request_set_payload_empty.start.annobin_http_client_request_set_payload_empty.end.annobin_http_client_request_set_timeout_msecs.start.annobin_http_client_request_set_timeout_msecs.endhttp_client_request_set_timeout_msecs.cold.22__func__.9309.annobin_http_client_request_set_timeout.start.annobin_http_client_request_set_timeout.endhttp_client_request_set_timeout.cold.23__func__.9314.annobin_http_client_request_set_attempt_timeout_msecs.start.annobin_http_client_request_set_attempt_timeout_msecs.endhttp_client_request_set_attempt_timeout_msecs.cold.24__func__.9319.annobin_http_client_request_set_max_attempts.start.annobin_http_client_request_set_max_attempts.endhttp_client_request_set_max_attempts.cold.25__func__.9324.annobin_http_client_request_set_event_headers.start.annobin_http_client_request_set_event_headers.end.annobin_http_client_request_set_auth_simple.start.annobin_http_client_request_set_auth_simple.end.annobin_http_client_request_set_proxy_url.start.annobin_http_client_request_set_proxy_url.endhttp_client_request_set_proxy_url.cold.26__func__.9338.annobin_http_client_request_set_proxy_socket.start.annobin_http_client_request_set_proxy_socket.endhttp_client_request_set_proxy_socket.cold.27__func__.9343.annobin_http_client_request_delay_until.start.annobin_http_client_request_delay_until.end.annobin_http_client_request_delay.start.annobin_http_client_request_delay.end.annobin_http_client_request_delay_msecs.start.annobin_http_client_request_delay_msecs.end.annobin_http_client_request_delay_from_response.start.annobin_http_client_request_delay_from_response.endhttp_client_request_delay_from_response.cold.28__func__.9362.annobin_http_client_request_get_method.start.annobin_http_client_request_get_method.end.annobin_http_client_request_get_target.start.annobin_http_client_request_get_target.end.annobin_http_client_request_get_origin_url.start.annobin_http_client_request_get_origin_url.end.annobin_http_client_request_get_state.start.annobin_http_client_request_get_state.end.annobin_http_client_request_get_attempts.start.annobin_http_client_request_get_attempts.end.annobin_http_client_request_get_stats.start.annobin_http_client_request_get_stats.endhttp_client_request_get_stats.cold.29__func__.9385.annobin_http_client_request_append_stats_text.start.annobin_http_client_request_append_stats_text.end.annobin_http_client_request_get_payload_type.start.annobin_http_client_request_get_payload_type.end.annobin_http_client_request_submit.start.annobin_http_client_request_submit.endhttp_client_request_submit.cold.30__func__.9408.annobin_http_client_request_get_peer_addr.start.annobin_http_client_request_get_peer_addr.end.annobin_http_client_request_abort.start.annobin_http_client_request_abort.endhttp_client_request_abort.cold.31__func__.9549.annobin_http_client_request_finish.start.annobin_http_client_request_finish.endhttp_client_request_finish.cold.32__func__.9553.annobin_http_client_request_resubmit.start.annobin_http_client_request_resubmit.endhttp_client_request_resubmit.cold.33__func__.9575.annobin_http_client_request_callback.start.annobin_http_client_request_callback.end.annobin_http_client_request_send_error.start.annobin_http_client_request_send_error.endhttp_client_request_send_errorhttp_client_request_send_error.cold.34__func__.9526.annobin_http_client_request_error_delayed.start.annobin_http_client_request_error_delayed.end__func__.9534http_client_request_error_delayed.cold.35.annobin_http_client_request_continue_payload.start.annobin_http_client_request_continue_payload.endhttp_client_request_continue_payloadhttp_client_request_continue_payload.cold.36__func__.9441.annobin_http_client_request_send_payload.start.annobin_http_client_request_send_payload.endhttp_client_request_send_payload.cold.37__func__.9459.annobin_http_client_request_finish_payload.start.annobin_http_client_request_finish_payload.endhttp_client_request_finish_payload.cold.38.annobin_http_client_request_error.start.annobin_http_client_request_error.endhttp_client_request_error.cold.39__func__.9541.annobin_http_client_request_url_str.start.annobin_http_client_request_url_str.end.annobin_http_client_request_send_more.start.annobin_http_client_request_send_more.endhttp_client_request_send_more.cold.40__func__.9480.annobin_http_client_request_send.start.annobin_http_client_request_send.endhttp_client_request_send.cold.41__func__.9498.annobin_http_client_request_redirect.start.annobin_http_client_request_redirect.endhttp_client_request_redirect.cold.42__func__.9569.annobin_http_client_request_try_retry.start.annobin_http_client_request_try_retry.end.annobin_http_client_request_retry.start.annobin_http_client_request_retry.end.annobin_http_client_request_set_destroy_callback.start.annobin_http_client_request_set_destroy_callback.end.annobin_http_client_request_start_tunnel.start.annobin_http_client_request_start_tunnel.endhttp_client_request_start_tunnel.cold.43__func__.9597.annobin_http_client_connection.c.annobin_http_client_connection.c_end.annobin_http_client_connection.c.hot.annobin_http_client_connection.c_end.hot.annobin_http_client_connection.c.unlikely.annobin_http_client_connection.c_end.unlikely.annobin_http_client_connection.c.startup.annobin_http_client_connection.c_end.startup.annobin_http_client_connection.c.exit.annobin_http_client_connection.c_end.exit.annobin_http_client_connection_continue_timeout.start.annobin_http_client_connection_continue_timeout.endhttp_client_connection_continue_timeouthttp_client_connection_continue_timeout.cold.24__func__.9315.annobin_http_client_connection_unlist_pending.start.annobin_http_client_connection_unlist_pending.endhttp_client_connection_unlist_pending.annobin_http_client_connection_stop_idle.start.annobin_http_client_connection_stop_idle.endhttp_client_connection_stop_idle.annobin_http_client_connection_detach_peer.start.annobin_http_client_connection_detach_peer.endhttp_client_connection_detach_peer__func__.9233.annobin_http_client_connection_disconnect.start.annobin_http_client_connection_disconnect.endhttp_client_connection_disconnecthttp_client_payload_destroyed.annobin_http_client_connection_start_idle.start.annobin_http_client_connection_start_idle.endhttp_client_connection_start_idlehttp_client_connection_idle_timeouthttp_client_connection_start_idle.cold.25__func__.9254.annobin_http_client_connection_ssl_handshaked.start.annobin_http_client_connection_ssl_handshaked.endhttp_client_connection_ssl_handshaked.annobin_http_client_connection_tunnel_response.start.annobin_http_client_connection_tunnel_response.endhttp_client_connection_tunnel_response.annobin_array_idx_i.isra.7.part.8.start.annobin_array_idx_i.isra.7.part.8.endarray_idx_i.isra.7.part.8__func__.5695.annobin_http_client_connection_unref_request.part.9.start.annobin_http_client_connection_unref_request.part.9.endhttp_client_connection_unref_request.part.9__func__.9109.annobin_http_client_connection_ref_request.part.14.start.annobin_http_client_connection_ref_request.part.14.endhttp_client_connection_ref_request.part.14__func__.9103.annobin_http_client_connection_connect.start.annobin_http_client_connection_connect.endhttp_client_connection_connecthttp_client_connect_timeouthttp_client_connection_delayed_connect_error.annobin_http_client_connection_abort_any_requests.start.annobin_http_client_connection_abort_any_requests.endhttp_client_connection_abort_any_requestshttp_client_connection_abort_any_requests.cold.26__func__.9188.annobin_http_client_connection_count_pending.start.annobin_http_client_connection_count_pending.end.annobin_http_client_connection_is_idle.start.annobin_http_client_connection_is_idle.end.annobin_http_client_connection_is_active.start.annobin_http_client_connection_is_active.end.annobin_http_client_connection_check_idle.start.annobin_http_client_connection_check_idle.endhttp_client_connection_check_idle.cold.27.annobin_http_client_connection_claim_idle.start.annobin_http_client_connection_claim_idle.endhttp_client_connection_claim_idle.cold.28__func__.9291.annobin_http_client_connection_start_request_timeout.start.annobin_http_client_connection_start_request_timeout.endhttp_client_connection_request_timeouthttp_client_connection_start_request_timeout.cold.29.annobin_http_client_connection_reset_request_timeout.start.annobin_http_client_connection_reset_request_timeout.end.annobin_http_client_connection_stop_request_timeout.start.annobin_http_client_connection_stop_request_timeout.end.annobin_http_client_payload_finished.start.annobin_http_client_payload_finished.endhttp_client_payload_finished.annobin_http_client_connection_list_init.start.annobin_http_client_connection_list_init.endhttp_client_connection_vfuncshttp_client_connection_set.annobin_http_client_connection_create.start.annobin_http_client_connection_create.endhttp_client_connect_tunnel_timeout.annobin_http_client_connection_ref.start.annobin_http_client_connection_ref.endhttp_client_connection_ref.cold.30__func__.9565.annobin_http_client_connection_unref.start.annobin_http_client_connection_unref.endhttp_client_connection_unref.cold.31__func__.9586.annobin_http_client_connection_return_response.start.annobin_http_client_connection_return_response.endhttp_client_connection_return_responsehttp_client_connection_return_response.cold.32__func__.9370.annobin_http_client_connection_lost_peer.start.annobin_http_client_connection_lost_peer.endhttp_client_connection_lost_peer.cold.33.annobin_http_client_connection_start_tunnel.start.annobin_http_client_connection_start_tunnel.endhttp_client_connection_start_tunnel.cold.34__func__.9444.annobin_http_client_connection_close.start.annobin_http_client_connection_close.end.annobin_http_client_connection_abort_temp_error.start.annobin_http_client_connection_abort_temp_error.endhttp_client_connection_abort_temp_errorhttp_client_connection_abort_temp_error.cold.35.annobin_http_client_connection_request_timeout.start.annobin_http_client_connection_request_timeout.end.annobin_http_client_connection_server_close.start.annobin_http_client_connection_server_close.endhttp_client_connection_server_closehttp_client_connection_server_close.cold.36.annobin_http_client_connection_ready.start.annobin_http_client_connection_ready.endhttp_client_connection_readyhttp_client_connection_ready.cold.37.annobin_http_client_connection_idle_timeout.start.annobin_http_client_connection_idle_timeout.endhttp_client_connection_idle_timeout.cold.38__func__.9243.annobin_http_client_connection_connected.start.annobin_http_client_connection_connected.endhttp_client_connection_connectedhttp_client_connection_connected.cold.39__func__.9479.annobin_http_client_connect_tunnel_timeout.start.annobin_http_client_connect_tunnel_timeout.end.annobin_http_client_connection_delayed_connect_error.start.annobin_http_client_connection_delayed_connect_error.end.annobin_http_client_connection_abort_error.constprop.22.start.annobin_http_client_connection_abort_error.constprop.22.endhttp_client_connection_abort_error.constprop.22http_client_connection_abort_error.constprop.22.cold.40__func__.9177.annobin_http_client_connection_lost.start.annobin_http_client_connection_lost.end.annobin_http_client_connection_handle_output_error.start.annobin_http_client_connection_handle_output_error.end.annobin_http_client_connection_check_ready.start.annobin_http_client_connection_check_ready.endhttp_client_connection_check_ready.cold.41__func__.9221.annobin_http_client_payload_destroyed.start.annobin_http_client_payload_destroyed.endhttp_client_payload_destroyed_timeouthttp_client_payload_destroyed.cold.42__func__.9352.annobin_http_client_connection_request_destroyed.start.annobin_http_client_connection_request_destroyed.endhttp_client_connection_request_destroyed.cold.43__func__.9360.annobin_http_client_connection_next_request.start.annobin_http_client_connection_next_request.endhttp_client_connection_next_request.cold.44__func__.9327.annobin_http_client_connection_output.start.annobin_http_client_connection_output.endhttp_client_connection_output.cold.45__func__.9431__func__.9438.annobin_http_client_connection_input.start.annobin_http_client_connection_input.endhttp_client_connection_inputhttp_client_connection_input.cold.46__func__.9399.annobin_http_client_payload_destroyed_timeout.start.annobin_http_client_payload_destroyed_timeout.end.annobin_http_client_connection_destroy.start.annobin_http_client_connection_destroy.endhttp_client_connection_destroyhttp_client_connection_destroy.cold.47__func__.9340.annobin_http_client_connect_timeout.start.annobin_http_client_connect_timeout.end.annobin_http_client_connection_switch_ioloop.start.annobin_http_client_connection_switch_ioloop.end.annobin_http_client_peer.c.annobin_http_client_peer.c_end.annobin_http_client_peer.c.hot.annobin_http_client_peer.c_end.hot.annobin_http_client_peer.c.unlikely.annobin_http_client_peer.c_end.unlikely.annobin_http_client_peer.c.startup.annobin_http_client_peer.c_end.startup.annobin_http_client_peer.c.exit.annobin_http_client_peer.c_end.exit.annobin_array_copy.isra.3.part.4.start.annobin_array_copy.isra.3.part.4.endarray_copy.isra.3.part.4__func__.5790.annobin_http_client_peer_shared_start_backoff_timer.part.6.start.annobin_http_client_peer_shared_start_backoff_timer.part.6.endhttp_client_peer_shared_start_backoff_timer.part.6http_client_peer_shared_connect_backoff.annobin_http_client_peer_requests_pending.isra.7.start.annobin_http_client_peer_requests_pending.isra.7.endhttp_client_peer_requests_pending.isra.7.annobin_http_client_peer_disconnect.start.annobin_http_client_peer_disconnect.endhttp_client_peer_disconnecthttp_client_peer_disconnect.cold.14__func__.8324.annobin_http_client_peer_addr_hash.start.annobin_http_client_peer_addr_hash.end.annobin_http_client_peer_addr_cmp.start.annobin_http_client_peer_addr_cmp.end.annobin_http_client_peer_pool_ref.start.annobin_http_client_peer_pool_ref.end.annobin_http_client_peer_shared_ref.start.annobin_http_client_peer_shared_ref.end.annobin_http_client_peer_shared_unref.start.annobin_http_client_peer_shared_unref.endhttp_client_peer_shared_unref.cold.15__func__.8224.annobin_http_client_peer_pool_unref.start.annobin_http_client_peer_pool_unref.endhttp_client_peer_pool_unref.cold.16.annobin_http_client_peer_pool_close.start.annobin_http_client_peer_pool_close.endhttp_client_peer_pool_close.cold.17__func__.8164.annobin_http_client_peer_shared_close.start.annobin_http_client_peer_shared_close.end.annobin_http_client_peer_shared_label.start.annobin_http_client_peer_shared_label.end.annobin_http_client_peer_shared_switch_ioloop.start.annobin_http_client_peer_shared_switch_ioloop.end.annobin_http_client_peer_shared_max_connections.start.annobin_http_client_peer_shared_max_connections.end.annobin_http_client_peer_ref.start.annobin_http_client_peer_ref.end.annobin_http_client_peer_unref.start.annobin_http_client_peer_unref.endhttp_client_peer_unref.cold.18__func__.8336.annobin_http_client_peer_close.start.annobin_http_client_peer_close.end.annobin_http_client_peer_get.start.annobin_http_client_peer_get.end__func__.8179http_client_peer_get.cold.19.annobin_http_client_peer_is_connected.start.annobin_http_client_peer_is_connected.end.annobin_http_client_peer_trigger_request_handler.start.annobin_http_client_peer_trigger_request_handler.endhttp_client_peer_handle_requests.annobin_http_client_peer_have_queue.start.annobin_http_client_peer_have_queue.end.annobin_http_client_peer_link_queue.start.annobin_http_client_peer_link_queue.end.annobin_http_client_peer_claim_request.start.annobin_http_client_peer_claim_request.end.annobin_http_client_peer_connection_success.start.annobin_http_client_peer_connection_success.end.annobin_http_client_peer_do_connect.start.annobin_http_client_peer_do_connect.endhttp_client_peer_do_connect.annobin_http_client_peer_shared_connect_backoff.start.annobin_http_client_peer_shared_connect_backoff.endhttp_client_peer_shared_connect_backoff.cold.20__func__.8251.annobin_http_client_peer_connection_failure.start.annobin_http_client_peer_connection_failure.endhttp_client_peer_connection_failure.cold.21.annobin_http_client_peer_connection_lost.start.annobin_http_client_peer_connection_lost.end.annobin_http_client_peer_active_connections.start.annobin_http_client_peer_active_connections.end.annobin_http_client_peer_drop.start.annobin_http_client_peer_drop.endhttp_client_peer_drop.annobin_http_client_peer_check_idle.start.annobin_http_client_peer_check_idle.endhttp_client_peer_check_idle.annobin_http_client_peer_unlink_queue.start.annobin_http_client_peer_unlink_queue.end.annobin_http_client_peer_handle_requests.start.annobin_http_client_peer_handle_requests.endhttp_client_peer_handle_requests.cold.22__func__.8409__func__.8482.annobin_http_client_peer_pending_connections.start.annobin_http_client_peer_pending_connections.end.annobin_http_client_peer_switch_ioloop.start.annobin_http_client_peer_switch_ioloop.end.annobin_http_client_queue.c.annobin_http_client_queue.c_end.annobin_http_client_queue.c.hot.annobin_http_client_queue.c_end.hot.annobin_http_client_queue.c.unlikely.annobin_http_client_queue.c_end.unlikely.annobin_http_client_queue.c.startup.annobin_http_client_queue.c_end.startup.annobin_http_client_queue.c.exit.annobin_http_client_queue.c_end.exit.annobin_http_client_queue_is_last_connect_ip.start.annobin_http_client_queue_is_last_connect_ip.endhttp_client_queue_is_last_connect_iphttp_client_queue_is_last_connect_ip.cold.18__func__.8142.annobin_http_client_queue_set_delay_timer.start.annobin_http_client_queue_set_delay_timer.endhttp_client_queue_set_delay_timerhttp_client_queue_delay_timeout.annobin_http_client_queue_delayed_cmp.start.annobin_http_client_queue_delayed_cmp.endhttp_client_queue_delayed_cmp.annobin_http_client_queue_set_request_timer.start.annobin_http_client_queue_set_request_timer.endhttp_client_queue_set_request_timerhttp_client_queue_request_timeouthttp_client_queue_set_request_timer.cold.19__func__.8291.annobin_http_client_queue_request_timeout.start.annobin_http_client_queue_request_timeout.endhttp_client_queue_request_timeout.cold.20__func__.8277.annobin_array_copy.isra.9.part.10.start.annobin_array_copy.isra.9.part.10.endarray_copy.isra.9.part.10__func__.5741.annobin_http_client_queue_recover_from_lookup.start.annobin_http_client_queue_recover_from_lookup.endhttp_client_queue_recover_from_lookuphttp_client_queue_recover_from_lookup.cold.21__func__.8148.annobin_http_client_queue_request_timeout_cmp.start.annobin_http_client_queue_request_timeout_cmp.endhttp_client_queue_request_timeout_cmp.annobin_http_client_queue_fail_full.start.annobin_http_client_queue_fail_full.endhttp_client_queue_fail_fullhttp_client_queue_fail_full.cold.22__func__.8127.annobin_http_client_queue_connection_attempt.start.annobin_http_client_queue_connection_attempt.endhttp_client_queue_connection_attempthttp_client_queue_soft_connect_timeouthttp_client_queue_connection_attempt.cold.23__func__.8169__func__.8031.annobin_http_client_queue_get.start.annobin_http_client_queue_get.endhttp_client_queue_get.cold.24.annobin_http_client_queue_free.start.annobin_http_client_queue_free.endhttp_client_queue_free.cold.25.annobin_http_client_queue_connection_setup.start.annobin_http_client_queue_connection_setup.end.annobin_http_client_queue_soft_connect_timeout.start.annobin_http_client_queue_soft_connect_timeout.endhttp_client_queue_soft_connect_timeout.cold.26.annobin_http_client_queue_submit_now.start.annobin_http_client_queue_submit_now.endhttp_client_queue_submit_now.annobin_http_client_queue_delay_timeout.start.annobin_http_client_queue_delay_timeout.end.annobin_http_client_queue_host_lookup_failure.start.annobin_http_client_queue_host_lookup_failure.end.annobin_http_client_queue_connection_success.start.annobin_http_client_queue_connection_success.endhttp_client_queue_connection_success.cold.27__func__.8209.annobin_http_client_queue_connection_failure.start.annobin_http_client_queue_connection_failure.end__func__.8227http_client_queue_connection_failure.cold.28.annobin_http_client_queue_peer_disconnected.start.annobin_http_client_queue_peer_disconnected.end.annobin_http_client_queue_drop_request.start.annobin_http_client_queue_drop_request.end__func__.8262http_client_queue_drop_request.cold.29.annobin_http_client_queue_submit_request.start.annobin_http_client_queue_submit_request.end.annobin_http_client_queue_claim_request.start.annobin_http_client_queue_claim_request.end.annobin_http_client_queue_requests_pending.start.annobin_http_client_queue_requests_pending.end.annobin_http_client_queue_host_lookup_done.start.annobin_http_client_queue_host_lookup_done.end.annobin_http_client_queue_requests_active.start.annobin_http_client_queue_requests_active.end.annobin_http_client_queue_switch_ioloop.start.annobin_http_client_queue_switch_ioloop.end.annobin_http_client_host.c.annobin_http_client_host.c_end.annobin_http_client_host.c.hot.annobin_http_client_host.c_end.hot.annobin_http_client_host.c.unlikely.annobin_http_client_host.c_end.unlikely.annobin_http_client_host.c.startup.annobin_http_client_host.c_end.startup.annobin_http_client_host.c.exit.annobin_http_client_host.c_end.exit.annobin_http_client_host_shared_lookup_success.start.annobin_http_client_host_shared_lookup_success.endhttp_client_host_shared_lookup_successhttp_client_host_shared_lookup_success.cold.12__func__.8072.annobin_http_client_host_shared_check_idle.start.annobin_http_client_host_shared_check_idle.endhttp_client_host_shared_check_idlehttp_client_host_shared_idle_timeout.annobin_http_client_host_shared_lookup_failure.start.annobin_http_client_host_shared_lookup_failure.endhttp_client_host_shared_lookup_failure.annobin_http_client_host_shared_dns_callback.start.annobin_http_client_host_shared_dns_callback.endhttp_client_host_shared_dns_callback.annobin_http_client_host_free_shared.start.annobin_http_client_host_free_shared.endhttp_client_host_free_sharedhttp_client_host_free_shared.cold.13__func__.5727.annobin_http_client_host_shared_create.start.annobin_http_client_host_shared_create.endhttp_client_host_shared_create.annobin_http_client_host_shared_free.start.annobin_http_client_host_shared_free.endhttp_client_host_shared_free.cold.14.annobin_http_client_host_shared_idle_timeout.start.annobin_http_client_host_shared_idle_timeout.end.annobin_http_client_host_shared_switch_ioloop.start.annobin_http_client_host_shared_switch_ioloop.end.annobin_http_client_host_get.start.annobin_http_client_host_get.end.annobin_http_client_host_free.start.annobin_http_client_host_free.end.annobin_http_client_host_submit_request.start.annobin_http_client_host_submit_request.end.annobin_http_client_host_check_idle.start.annobin_http_client_host_check_idle.end.annobin_http_client_host_refresh.start.annobin_http_client_host_refresh.endhttp_client_host_refresh.cold.15__func__.8088.annobin_http_client_host_get_ip_idx.start.annobin_http_client_host_get_ip_idx.end.annobin_http_client_host_switch_ioloop.start.annobin_http_client_host_switch_ioloop.end.annobin_http_client.c.annobin_http_client.c_end.annobin_http_client.c.hot.annobin_http_client.c_end.hot.annobin_http_client.c.unlikely.annobin_http_client.c_end.unlikely.annobin_http_client.c.startup.annobin_http_client.c_end.startup.annobin_http_client.c.exit.annobin_http_client.c_end.exit.annobin_http_client_context_update_settings.start.annobin_http_client_context_update_settings.endhttp_client_context_update_settingshttp_client_context_update_settings.cold.10.annobin_http_client_handle_request_errors.start.annobin_http_client_handle_request_errors.endhttp_client_handle_request_errorshttp_client_handle_request_errors.cold.11__func__.8190.annobin_http_client_get_pending_request_count.start.annobin_http_client_get_pending_request_count.end.annobin_http_client_init_ssl_ctx.start.annobin_http_client_init_ssl_ctx.end.annobin_http_client_delay_request_error.start.annobin_http_client_delay_request_error.end.annobin_http_client_remove_request_error.start.annobin_http_client_remove_request_error.end.annobin_http_client_context_create.start.annobin_http_client_context_create.endevent_category_http_client.annobin_http_client_context_ref.start.annobin_http_client_context_ref.end.annobin_http_client_init_shared.start.annobin_http_client_init_shared.endid.8119http_client_init_shared.cold.12__func__.8124.annobin_http_client_init_private.start.annobin_http_client_init_private.end.annobin_http_client_context_unref.start.annobin_http_client_context_unref.endhttp_client_context_unref.cold.13__func__.8236.annobin_http_client_global_context_free.start.annobin_http_client_global_context_free.endhttp_client_global_context_freehttp_client_global_context_ioloop_switchedhttp_client_global_context.annobin_http_client_context_switch_ioloop.start.annobin_http_client_context_switch_ioloop.end.annobin_http_client_deinit.start.annobin_http_client_deinit.endhttp_client_deinit.cold.14.annobin_http_client_switch_ioloop.start.annobin_http_client_switch_ioloop.end.annobin_http_client_wait.start.annobin_http_client_wait.endhttp_client_wait.cold.15__func__.8171.annobin_http_client_global_context_ioloop_switched.start.annobin_http_client_global_context_ioloop_switched.endhttp_client_global_context_ioloop_switched.cold.16__func__.8272__func__.8306.annobin_http_client_get_global_context.start.annobin_http_client_get_global_context.end.annobin_http_client_init.start.annobin_http_client_init.end.annobin_http_server_ostream.c.annobin_http_server_ostream.c_end.annobin_http_server_ostream.c.hot.annobin_http_server_ostream.c_end.hot.annobin_http_server_ostream.c.unlikely.annobin_http_server_ostream.c_end.unlikely.annobin_http_server_ostream.c.startup.annobin_http_server_ostream.c_end.startup.annobin_http_server_ostream.c.exit.annobin_http_server_ostream.c_end.exit.annobin_http_server_ostream_wait_end.start.annobin_http_server_ostream_wait_end.endhttp_server_ostream_wait_end.annobin_http_server_ostream_output_ready.start.annobin_http_server_ostream_output_ready.endhttp_server_ostream_output_readyhttp_server_ostream_output_ready.cold.12__func__.7303.annobin_http_server_ostream_destroy.start.annobin_http_server_ostream_destroy.endhttp_server_ostream_destroyhttp_server_ostream_destroy.cold.13__func__.7345.annobin_http_server_ostream_close.start.annobin_http_server_ostream_close.endhttp_server_ostream_closehttp_server_ostream_close.cold.14__func__.7337.annobin_http_server_ostream_output_finish.start.annobin_http_server_ostream_output_finish.endhttp_server_ostream_output_finishhttp_server_ostream_output_finish.cold.15__func__.7309.annobin_http_server_ostream_switch_ioloop_to.start.annobin_http_server_ostream_switch_ioloop_to.endhttp_server_ostream_switch_ioloop_tohttp_server_ostream_switch_ioloop_to.cold.16__func__.7378.annobin_http_server_ostream_wait_begin.start.annobin_http_server_ostream_wait_begin.endhttp_server_ostream_wait_beginhttp_server_ostream_wait_begin.cold.17__func__.7353.annobin_http_server_ostream_output_update_timeouts.start.annobin_http_server_ostream_output_update_timeouts.endhttp_server_ostream_output_update_timeoutshttp_server_ostream_output_update_timeouts.cold.18.annobin_http_server_ostream_output_resume.start.annobin_http_server_ostream_output_resume.endhttp_server_ostream_output_resumehttp_server_ostream_output_resume.cold.19__func__.7323.annobin_http_server_ostream_output_halt.start.annobin_http_server_ostream_output_halt.endhttp_server_ostream_output_halt__func__.7317.annobin_http_server_ostream_output_error.start.annobin_http_server_ostream_output_error.endhttp_server_ostream_output_errorhttp_server_ostream_output_error.cold.20__func__.7286.annobin_http_server_ostream_output_start.start.annobin_http_server_ostream_output_start.endhttp_server_ostream_output_starthttp_server_ostream_output_start.cold.21__func__.7292.annobin_http_server_ostream_output_available.start.annobin_http_server_ostream_output_available.endhttp_server_ostream_output_available.cold.22__func__.7297.annobin_http_server_ostream_continue.start.annobin_http_server_ostream_continue.endhttp_server_ostream_continue.cold.23__func__.7367.annobin_http_server_ostream_get_size.start.annobin_http_server_ostream_get_size.end.annobin_http_server_ostream_create.start.annobin_http_server_ostream_create.endhttp_server_ostream_create.cold.24__func__.7385.annobin_http_server_ostream_response_finished.start.annobin_http_server_ostream_response_finished.end.annobin_http_server_ostream_response_destroyed.start.annobin_http_server_ostream_response_destroyed.endhttp_server_ostream_response_destroyed.cold.25__func__.7393.annobin_http_server_ostream_get_output.start.annobin_http_server_ostream_get_output.end.annobin_http_server_ostream_set_error.start.annobin_http_server_ostream_set_error.end.annobin_http_server_response.c.annobin_http_server_response.c_end.annobin_http_server_response.c.hot.annobin_http_server_response.c_end.hot.annobin_http_server_response.c.unlikely.annobin_http_server_response.c_end.unlikely.annobin_http_server_response.c.startup.annobin_http_server_response.c_end.startup.annobin_http_server_response.c.exit.annobin_http_server_response.c_end.exit.annobin_http_server_response_payload_input.start.annobin_http_server_response_payload_input.endhttp_server_response_payload_input.annobin_http_server_response_do_submit.start.annobin_http_server_response_do_submit.endhttp_server_response_do_submithttp_server_response_do_submit.cold.12__func__.7633.annobin_http_server_response_request_free.start.annobin_http_server_response_request_free.endhttp_server_response_request_free.cold.13__func__.7546.annobin_http_server_response_request_destroy.start.annobin_http_server_response_request_destroy.end.annobin_http_server_response_request_abort.start.annobin_http_server_response_request_abort.end.annobin_http_server_response_ref.start.annobin_http_server_response_ref.end.annobin_http_server_response_unref.start.annobin_http_server_response_unref.end.annobin_http_server_response_add_header.start.annobin_http_server_response_add_header.endhttp_server_response_add_header.cold.14__func__.7576.annobin_http_server_response_create.start.annobin_http_server_response_create.endhttp_server_response_create.cold.15__func__.7534.annobin_http_server_response_update_status.start.annobin_http_server_response_update_status.endhttp_server_response_update_status.cold.16__func__.7589.annobin_http_server_response_set_date.start.annobin_http_server_response_set_date.endhttp_server_response_set_date.cold.17__func__.7594.annobin_http_server_response_set_payload.start.annobin_http_server_response_set_payload.endhttp_server_response_set_payload.cold.18__func__.7600.annobin_http_server_response_set_payload_data.start.annobin_http_server_response_set_payload_data.endhttp_server_response_set_payload_data.cold.19__func__.7609.annobin_http_server_response_get_payload_output.start.annobin_http_server_response_get_payload_output.endhttp_server_response_get_payload_output.cold.20__func__.7618.annobin_http_server_response_output_payload.start.annobin_http_server_response_output_payload.endhttp_server_response_output_payload__func__.7677http_server_response_output_payload.cold.21.annobin_http_server_response_add_auth.start.annobin_http_server_response_add_auth.end.annobin_http_server_response_add_auth_basic.start.annobin_http_server_response_add_auth_basic.end.annobin_http_server_response_submit.start.annobin_http_server_response_submit.end.annobin_http_server_response_submit_close.start.annobin_http_server_response_submit_close.end.annobin_http_server_response_submit_tunnel.start.annobin_http_server_response_submit_tunnel.end.annobin_http_server_response_request_finished.start.annobin_http_server_response_request_finished.end.annobin_http_server_response_finish_payload_out.start.annobin_http_server_response_finish_payload_out.end.annobin_http_server_response_send_payload.start.annobin_http_server_response_send_payload.endhttp_server_response_send_payload.cold.22__func__.7690.annobin_http_server_response_finish_payload.start.annobin_http_server_response_finish_payload.endhttp_server_response_finish_payload.cold.23__func__.7696.annobin_http_server_response_abort_payload.start.annobin_http_server_response_abort_payload.end.annobin_http_server_response_send_more.start.annobin_http_server_response_send_more.endhttp_server_response_send_more.cold.24__func__.7713.annobin_http_server_response_send.start.annobin_http_server_response_send.endhttp_server_response_send.cold.25__func__.7736.annobin_http_server_response_get_status.start.annobin_http_server_response_get_status.endhttp_server_response_get_status.cold.26__func__.7754.annobin_http_server_response_get_total_size.start.annobin_http_server_response_get_total_size.endhttp_server_response_get_total_size.cold.27__func__.7758.annobin_http_server_response_add_permanent_header.start.annobin_http_server_response_add_permanent_header.end.annobin_http_server_request.c.annobin_http_server_request.c_end.annobin_http_server_request.c.hot.annobin_http_server_request.c_end.hot.annobin_http_server_request.c.unlikely.annobin_http_server_request.c_end.unlikely.annobin_http_server_request.c.startup.annobin_http_server_request.c_end.startup.annobin_http_server_request.c.exit.annobin_http_server_request.c_end.exit.annobin_http_server_request_create_fail_response.start.annobin_http_server_request_create_fail_response.endhttp_server_request_create_fail_responsehttp_server_request_create_fail_response.cold.10__func__.7627.annobin_http_server_request_fail_full.start.annobin_http_server_request_fail_full.endhttp_server_request_fail_full.annobin_http_server_istream_destroy.start.annobin_http_server_istream_destroy.endhttp_server_istream_destroy.annobin_http_server_istream_read_any.start.annobin_http_server_istream_read_any.endhttp_server_istream_read_any.annobin_payload_handler_raw_destroy.start.annobin_payload_handler_raw_destroy.endpayload_handler_raw_destroy.annobin_http_server_request_client_error.start.annobin_http_server_request_client_error.endhttp_server_request_client_error.annobin_payload_handler_pump_destroy.start.annobin_payload_handler_pump_destroy.endpayload_handler_pump_destroy.annobin_payload_handler_pump_switch_ioloop.start.annobin_payload_handler_pump_switch_ioloop.endpayload_handler_pump_switch_ioloop.annobin_payload_handler_raw_switch_ioloop.start.annobin_payload_handler_raw_switch_ioloop.endpayload_handler_raw_switch_ioloop.annobin_http_server_payload_handler_init.start.annobin_http_server_payload_handler_init.endhttp_server_payload_handler_inithttp_server_payload_handler_init.cold.11__func__.7719.annobin_http_server_istream_switch_ioloop_to.start.annobin_http_server_istream_switch_ioloop_to.endhttp_server_istream_switch_ioloop_tohttp_server_istream_switch_ioloop_to.cold.12__func__.7679.annobin_http_server_request_label.start.annobin_http_server_request_label.end.annobin_http_server_request_update_event.start.annobin_http_server_request_update_event.end.annobin_http_server_request_new.start.annobin_http_server_request_new.endid_counter.7492.annobin_http_server_request_ref.start.annobin_http_server_request_ref.endhttp_server_request_ref.cold.13__func__.7498.annobin_http_server_request_unref.start.annobin_http_server_request_unref.endhttp_server_request_unref.cold.14__func__.7504.annobin_http_server_istream_read.start.annobin_http_server_istream_read.endhttp_server_istream_readhttp_server_istream_read.cold.15__func__.7697.annobin_http_server_request_connection_close.start.annobin_http_server_request_connection_close.endhttp_server_request_connection_close.cold.16__func__.7510.annobin_http_server_request_destroy.start.annobin_http_server_request_destroy.end.annobin_http_server_request_set_destroy_callback.start.annobin_http_server_request_set_destroy_callback.end.annobin_http_server_request_abort.start.annobin_http_server_request_abort.end.annobin_http_server_request_immune_ref.start.annobin_http_server_request_immune_ref.end.annobin_http_server_request_immune_unref.start.annobin_http_server_request_immune_unref.endhttp_server_request_immune_unref.cold.17__func__.7541.annobin_http_server_request_get.start.annobin_http_server_request_get.end.annobin_http_server_request_get_pool.start.annobin_http_server_request_get_pool.end.annobin_http_server_request_get_response.start.annobin_http_server_request_get_response.end.annobin_http_server_request_get_auth.start.annobin_http_server_request_get_auth.end.annobin_http_server_request_is_finished.start.annobin_http_server_request_is_finished.end.annobin_http_server_request_is_complete.start.annobin_http_server_request_is_complete.end.annobin_http_server_request_halt_payload.start.annobin_http_server_request_halt_payload.endhttp_server_request_halt_payload.cold.18__func__.7565.annobin_http_server_request_continue_payload.start.annobin_http_server_request_continue_payload.endhttp_server_request_continue_payload.cold.19.annobin_http_server_request_received.start.annobin_http_server_request_received.end.annobin_http_server_request_ready_to_respond.start.annobin_http_server_request_ready_to_respond.end.annobin_http_server_request_finished.start.annobin_http_server_request_finished.endhttp_server_request_finished.cold.20__func__.7615.annobin_http_server_request_fail.start.annobin_http_server_request_fail.end.annobin_http_server_request_callback.start.annobin_http_server_request_callback.end.annobin_http_server_request_fail_close.start.annobin_http_server_request_fail_close.end.annobin_http_server_request_fail_text.start.annobin_http_server_request_fail_text.end.annobin_http_server_request_fail_auth.start.annobin_http_server_request_fail_auth.end.annobin_http_server_request_fail_auth_basic.start.annobin_http_server_request_fail_auth_basic.end.annobin_http_server_request_fail_bad_method.start.annobin_http_server_request_fail_bad_method.end.annobin_http_server_request_get_payload_input.start.annobin_http_server_request_get_payload_input.endhttp_server_request_get_payload_input.cold.21.annobin_http_server_payload_handler_destroy.start.annobin_http_server_payload_handler_destroy.endhttp_server_payload_handler_destroy.cold.22__func__.7725.annobin_http_server_request_submit_response.start.annobin_http_server_request_submit_response.endhttp_server_request_submit_response.cold.23__func__.7597.annobin_payload_handler_pump_callback.start.annobin_payload_handler_pump_callback.endpayload_handler_pump_callbackpayload_handler_pump_callback.cold.24__func__.7756.annobin_payload_handler_raw_input.start.annobin_payload_handler_raw_input.endpayload_handler_raw_inputpayload_handler_raw_input.cold.25__func__.7810.annobin_http_server_payload_handler_switch_ioloop.start.annobin_http_server_payload_handler_switch_ioloop.end.annobin_http_server_request_forward_payload.start.annobin_http_server_request_forward_payload.endhttp_server_request_forward_payload.cold.26__func__.7774.annobin_http_server_request_buffer_payload.start.annobin_http_server_request_buffer_payload.end.annobin_http_server_request_handle_payload.start.annobin_http_server_request_handle_payload.end.annobin_http_server_request_add_response_header.start.annobin_http_server_request_add_response_header.end.annobin_http_server_connection.c.annobin_http_server_connection.c_end.annobin_http_server_connection.c.hot.annobin_http_server_connection.c_end.hot.annobin_http_server_connection.c.unlikely.annobin_http_server_connection.c_end.unlikely.annobin_http_server_connection.c.startup.annobin_http_server_connection.c_end.startup.annobin_http_server_connection.c.exit.annobin_http_server_connection.c_end.exit.annobin_http_server_connection_client_error.start.annobin_http_server_connection_client_error.endhttp_server_connection_client_error.annobin_http_server_connection_ready.start.annobin_http_server_connection_ready.endhttp_server_connection_ready.annobin_http_server_connection_disconnect.part.1.start.annobin_http_server_connection_disconnect.part.1.endhttp_server_connection_disconnect.part.1http_server_payload_destroyed.annobin_http_server_connection_get_stats.start.annobin_http_server_connection_get_stats.end.annobin_http_server_connection_input_set_pending.start.annobin_http_server_connection_input_set_pending.end.annobin_http_server_connection_input_halt.start.annobin_http_server_connection_input_halt.end.annobin_http_server_connection_pipeline_handle_full.start.annobin_http_server_connection_pipeline_handle_full.endhttp_server_connection_pipeline_handle_full.annobin_http_server_connection_start_idle_timeout.start.annobin_http_server_connection_start_idle_timeout.endhttp_server_connection_idle_timeout.annobin_http_server_connection_reset_idle_timeout.start.annobin_http_server_connection_reset_idle_timeout.end.annobin_http_server_connection_stop_idle_timeout.start.annobin_http_server_connection_stop_idle_timeout.end.annobin_http_server_connection_output_trigger.start.annobin_http_server_connection_output_trigger.end.annobin_http_server_connection_output_halt.start.annobin_http_server_connection_output_halt.end.annobin_http_server_connection_output_resume.start.annobin_http_server_connection_output_resume.end.annobin_http_server_connection_pending_payload.start.annobin_http_server_connection_pending_payload.end.annobin_http_server_connection_input_resume.start.annobin_http_server_connection_input_resume.end.annobin_http_server_payload_destroyed.start.annobin_http_server_payload_destroyed.endhttp_server_payload_destroyed.cold.4__func__.9420.annobin_http_server_connection_list_init.start.annobin_http_server_connection_list_init.endhttp_server_connection_vfuncshttp_server_connection_set.annobin_http_server_connection_create.start.annobin_http_server_connection_create.endhttp_server_connection_create.cold.5__func__.9587.annobin_http_server_connection_ref.start.annobin_http_server_connection_ref.endhttp_server_connection_ref.cold.6__func__.9594.annobin_http_server_connection_unref.start.annobin_http_server_connection_unref.endhttp_server_connection_unref.cold.7__func__.9609.annobin_http_server_connection_destroy.start.annobin_http_server_connection_destroy.endhttp_server_connection_destroy.annobin_http_server_connection_close.start.annobin_http_server_connection_close.end.annobin_http_server_connection_idle_timeout.start.annobin_http_server_connection_idle_timeout.end.annobin_http_server_connection_shut_down.start.annobin_http_server_connection_shut_down.end.annobin_http_server_connection_handle_output_error.start.annobin_http_server_connection_handle_output_error.end.annobin_http_server_connection_flush.start.annobin_http_server_connection_flush.end.annobin_http_server_connection_send_responses.start.annobin_http_server_connection_send_responses.endhttp_server_connection_send_responseshttp_server_connection_send_responses.cold.8__func__.9529.annobin_http_server_connection_output.start.annobin_http_server_connection_output.endhttp_server_connection_output.cold.9__func__.9555.annobin_http_server_connection_check_input.start.annobin_http_server_connection_check_input.endhttp_server_connection_check_input.annobin_http_server_connection_finish_request.start.annobin_http_server_connection_finish_request.endhttp_server_connection_finish_request.annobin_http_server_connection_input.start.annobin_http_server_connection_input.endhttp_server_connection_inputhttp_server_connection_input.cold.10__func__.9442__func__.9490.annobin_http_server_connection_tunnel.start.annobin_http_server_connection_tunnel.end.annobin_http_server_connection_switch_ioloop_to.start.annobin_http_server_connection_switch_ioloop_to.end.annobin_http_server_connection_switch_ioloop.start.annobin_http_server_connection_switch_ioloop.end.annobin_http_server_resource.c.annobin_http_server_resource.c_end.annobin_http_server_resource.c.hot.annobin_http_server_resource.c_end.hot.annobin_http_server_resource.c.unlikely.annobin_http_server_resource.c_end.unlikely.annobin_http_server_resource.c.startup.annobin_http_server_resource.c_end.startup.annobin_http_server_resource.c.exit.annobin_http_server_resource.c_end.exit.annobin_http_server_location_cmp.start.annobin_http_server_location_cmp.endhttp_server_location_cmp.annobin_array_idx_i.isra.2.part.3.start.annobin_array_idx_i.isra.2.part.3.endarray_idx_i.isra.2.part.3.annobin_http_server_resource_update_event.start.annobin_http_server_resource_update_event.endhttp_server_resource_update_event.annobin_http_server_resource_create.start.annobin_http_server_resource_create.endevent_category_http_server_resource.annobin_http_server_resource_free.start.annobin_http_server_resource_free.end.annobin_http_server_resource_get_pool.start.annobin_http_server_resource_get_pool.end.annobin_http_server_resource_get_path.start.annobin_http_server_resource_get_path.endhttp_server_resource_get_path.cold.9__func__.6838.annobin_http_server_resource_get_event.start.annobin_http_server_resource_get_event.end.annobin_http_server_resource_add_location.start.annobin_http_server_resource_add_location.end__func__.6847http_server_resource_add_location.cold.10.annobin_http_server_resource_find.start.annobin_http_server_resource_find.endhttp_server_resource_find.cold.11__func__.6856.annobin_http_server_resource_callback.start.annobin_http_server_resource_callback.endhttp_server_resource_callback.cold.12__func__.6869.annobin_http_server_resource_set_destroy_callback.start.annobin_http_server_resource_set_destroy_callback.end.annobin_http_server.c.annobin_http_server.c_end.annobin_http_server.c.hot.annobin_http_server.c_end.hot.annobin_http_server.c.unlikely.annobin_http_server.c_end.unlikely.annobin_http_server.c.startup.annobin_http_server.c_end.startup.annobin_http_server.c.exit.annobin_http_server.c_end.exit.annobin_http_server_init.start.annobin_http_server_init.endevent_category_http_server.annobin_http_server_deinit.start.annobin_http_server_deinit.endhttp_server_deinit.cold.3__func__.7890.annobin_http_server_switch_ioloop.start.annobin_http_server_switch_ioloop.end.annobin_http_server_shut_down.start.annobin_http_server_shut_down.end.annobin_http_server_init_ssl_ctx.start.annobin_http_server_init_ssl_ctx.end.annobin_fs_api.c.annobin_fs_api.c_end.annobin_fs_api.c.hot.annobin_fs_api.c_end.hot.annobin_fs_api.c.unlikely.annobin_fs_api.c_end.unlikely.annobin_fs_api.c.startup.annobin_fs_api.c_end.startup.annobin_fs_api.c.exit.annobin_fs_api.c_end.exit.annobin_fs_classes_deinit.start.annobin_fs_classes_deinit.endfs_classes_deinitfs_classes.annobin_fs_class_deinit_modules.start.annobin_fs_class_deinit_modules.endfs_class_deinit_modulesfs_modules.annobin_fs_timing_end.start.annobin_fs_timing_end.endfs_timing_end.annobin_fs_file_istream_destroyed.start.annobin_fs_file_istream_destroyed.endfs_file_istream_destroyedfs_file_istream_destroyed.cold.19__func__.6661.annobin_fs_create_event.isra.4.start.annobin_fs_create_event.isra.4.endfs_create_event.isra.4event_category_fs.annobin_fs_metadata_find_md.isra.7.start.annobin_fs_metadata_find_md.isra.7.endfs_metadata_find_md.isra.7.annobin_fs_file_timing_start.part.9.start.annobin_fs_file_timing_start.part.9.endfs_file_timing_start.part.9.annobin_fs_class_register.start.annobin_fs_class_register.endfs_classes_init.annobin_fs_classes_init.start.annobin_fs_classes_init.end.annobin_fs_class_find.start.annobin_fs_class_find.endfs_class_find.annobin_fs_ref.start.annobin_fs_ref.endfs_ref.cold.20__func__.6462.annobin_fs_get_parent.start.annobin_fs_get_parent.end.annobin_fs_get_driver.start.annobin_fs_get_driver.end.annobin_fs_get_root_driver.start.annobin_fs_get_root_driver.end.annobin_fs_file_set_flags.start.annobin_fs_file_set_flags.end.annobin_fs_get_properties.start.annobin_fs_get_properties.end.annobin_fs_metadata_init.start.annobin_fs_metadata_init.endfs_metadata_init.cold.21__func__.6526.annobin_fs_metadata_init_or_clear.start.annobin_fs_metadata_init_or_clear.endfs_metadata_init_or_clear.cold.22__func__.4670.annobin_fs_default_set_metadata.start.annobin_fs_default_set_metadata.end.annobin_fs_metadata_find.start.annobin_fs_metadata_find.end.annobin_fs_set_metadata.start.annobin_fs_set_metadata.endfs_set_metadata.cold.23__func__.6562.annobin_fs_file_init_with_event.start.annobin_fs_file_init_with_event.endfs_file_init_with_event.cold.24.annobin_fs_file_init.start.annobin_fs_file_init.end.annobin_fs_file_timing_end.start.annobin_fs_file_timing_end.end.annobin_fs_write_stream_finish_int.start.annobin_fs_write_stream_finish_int.endfs_write_stream_finish_intfs_write_stream_finish_int.cold.25__func__.6705.annobin_fs_write_stream_abort.start.annobin_fs_write_stream_abort.endfs_write_stream_abortfs_write_stream_abort.cold.26.annobin_fs_file_path.start.annobin_fs_file_path.end.annobin_fs_unref.start.annobin_fs_unref.endfs_unref.cold.27__func__.6469.annobin_fs_init.start.annobin_fs_init.endfs_init.cold.28.annobin_fs_init_from_string.start.annobin_fs_init_from_string.end.annobin_fs_deinit.start.annobin_fs_deinit.end.annobin_fs_set_verror.start.annobin_fs_set_verror.endfs_set_verrorfs_set_verror.cold.29__func__.6623.annobin_fs_file_fs.start.annobin_fs_file_fs.end.annobin_fs_file_event.start.annobin_fs_file_event.end.annobin_fs_file_last_error.start.annobin_fs_file_last_error.end.annobin_fs_prefetch.start.annobin_fs_prefetch.endfs_prefetch.cold.30.annobin_fs_write_stream.start.annobin_fs_write_stream.endfs_write_stream.cold.31__func__.6698.annobin_fs_write_stream_finish_async.start.annobin_fs_write_stream_finish_async.end.annobin_fs_write_stream_abort_error.start.annobin_fs_write_stream_abort_error.end.annobin_fs_file_close.start.annobin_fs_file_close.endfs_file_close.cold.32__func__.6518.annobin_fs_file_deinit.start.annobin_fs_file_deinit.endfs_file_deinit.cold.33__func__.6504.annobin_fs_file_free.start.annobin_fs_file_free.end.annobin_fs_write_stream_abort_parent.start.annobin_fs_write_stream_abort_parent.endfs_write_stream_abort_parent.cold.34__func__.6733.annobin_fs_write_set_hash.start.annobin_fs_write_set_hash.end.annobin_fs_file_set_async_callback.start.annobin_fs_file_set_async_callback.end.annobin_fs_wait_async.start.annobin_fs_wait_async.endfs_wait_async.cold.35__func__.6747.annobin_fs_read_stream.start.annobin_fs_read_stream.endfs_read_stream.cold.36__func__.5219__func__.6672.annobin_fs_switch_ioloop.start.annobin_fs_switch_ioloop.endfs_switch_ioloop.localalias.16fs_switch_ioloop.cold.37.annobin_fs_lock.start.annobin_fs_lock.endfs_lock.cold.38.annobin_fs_unlock.start.annobin_fs_unlock.endfs_unlock.cold.39.annobin_fs_copy_finish_async.start.annobin_fs_copy_finish_async.endfs_copy_finish_async.cold.40.annobin_fs_rename.start.annobin_fs_rename.endfs_rename.cold.41__func__.6814.annobin_fs_delete.start.annobin_fs_delete.endfs_delete.cold.42__func__.6820.annobin_fs_iter_init_with_event.start.annobin_fs_iter_init_with_event.endfs_iter_init_with_event.cold.43__func__.6835.annobin_fs_iter_init.start.annobin_fs_iter_init.end.annobin_fs_iter_set_async_callback.start.annobin_fs_iter_set_async_callback.end.annobin_fs_iter_have_more.start.annobin_fs_iter_have_more.end.annobin_fs_iter_next.start.annobin_fs_iter_next.endfs_iter_next.cold.44.annobin_fs_get_stats.start.annobin_fs_get_stats.end.annobin_fs_set_error.start.annobin_fs_set_error.endfs_set_error.cold.45__func__.6868.annobin_fs_get_metadata_full.start.annobin_fs_get_metadata_full.endfs_get_metadata_full.cold.46.annobin_fs_get_metadata.start.annobin_fs_get_metadata.end.annobin_fs_lookup_metadata.start.annobin_fs_lookup_metadata.end.annobin_fs_lookup_loaded_metadata.start.annobin_fs_lookup_loaded_metadata.endfs_lookup_loaded_metadata.cold.47.annobin_fs_write_stream_finish.start.annobin_fs_write_stream_finish.end__func__.6713fs_write_stream_finish.cold.48.annobin_fs_stat.start.annobin_fs_stat.endfs_stat.cold.49.annobin_fs_exists.start.annobin_fs_exists.endfs_exists.cold.50.annobin_fs_get_nlinks.start.annobin_fs_get_nlinks.endfs_get_nlinks.cold.51.annobin_fs_copy.start.annobin_fs_copy.endfs_copy.cold.52__func__.6802.annobin_fs_iter_deinit.start.annobin_fs_iter_deinit.endfs_iter_deinit.cold.53.annobin_fs_set_error_errno.start.annobin_fs_set_error_errno.endfs_set_error_errno.cold.54__func__.6874.annobin_fs_file_set_error_async.start.annobin_fs_file_set_error_async.end.annobin_fs_read_via_stream.start.annobin_fs_read_via_stream.endfs_read_via_stream.cold.55__func__.6650.annobin_fs_read.start.annobin_fs_read.endfs_read.cold.56.annobin_fs_write_via_stream.start.annobin_fs_write_via_stream.endfs_write_via_stream.cold.57__func__.6687.annobin_fs_write.start.annobin_fs_write.endfs_write.cold.58.annobin_fs_default_copy.start.annobin_fs_default_copy.end__func__.6790fs_default_copy.cold.59.annobin_fs_stats_get_read_usecs.start.annobin_fs_stats_get_read_usecs.end.annobin_fs_stats_get_write_usecs.start.annobin_fs_stats_get_write_usecs.end.annobin_fs_file_init_parent.start.annobin_fs_file_init_parent.end.annobin_fs_iter_init_parent.start.annobin_fs_iter_init_parent.end.annobin_fs_get_event.start.annobin_fs_get_event.end.annobin_fs_dict.c.annobin_fs_dict.c_end.annobin_fs_dict.c.hot.annobin_fs_dict.c_end.hot.annobin_fs_dict.c.unlikely.annobin_fs_dict.c_end.unlikely.annobin_fs_dict.c.startup.annobin_fs_dict.c_end.startup.annobin_fs_dict.c.exit.annobin_fs_dict.c_end.exit.annobin_fs_dict_get_properties.start.annobin_fs_dict_get_properties.endfs_dict_get_properties.annobin_fs_dict_prefetch.start.annobin_fs_dict_prefetch.endfs_dict_prefetch.annobin_fs_dict_iter_deinit.start.annobin_fs_dict_iter_deinit.endfs_dict_iter_deinit.annobin_fs_dict_iter_next.start.annobin_fs_dict_iter_next.endfs_dict_iter_next.annobin_fs_dict_iter_init.start.annobin_fs_dict_iter_init.endfs_dict_iter_init.annobin_fs_dict_alloc.start.annobin_fs_dict_alloc.endfs_dict_allocfs_dict_freefs_dict_file_allocfs_dict_file_initfs_dict_file_deinitfs_dict_read_streamfs_dict_write_streamfs_dict_write_stream_finishfs_dict_statfs_dict_deletefs_dict_iter_alloc.annobin_fs_dict_delete.start.annobin_fs_dict_delete.end.annobin_fs_dict_file_init.start.annobin_fs_dict_file_init.endfs_dict_file_init.cold.4__func__.6626.annobin_fs_dict_free.start.annobin_fs_dict_free.end.annobin_fs_dict_stat.start.annobin_fs_dict_stat.end.annobin_fs_dict_read_stream.start.annobin_fs_dict_read_stream.end.annobin_fs_dict_write_stream.start.annobin_fs_dict_write_stream.endfs_dict_write_stream.cold.5__func__.6653.annobin_fs_dict_file_deinit.start.annobin_fs_dict_file_deinit.endfs_dict_file_deinit.cold.6__func__.6631.annobin_fs_dict_write_stream_finish.start.annobin_fs_dict_write_stream_finish.end.annobin_fs_dict_iter_alloc.start.annobin_fs_dict_iter_alloc.end.annobin_fs_dict_file_alloc.start.annobin_fs_dict_file_alloc.end.annobin_fs_metawrap.c.annobin_fs_metawrap.c_end.annobin_fs_metawrap.c.hot.annobin_fs_metawrap.c_end.hot.annobin_fs_metawrap.c.unlikely.annobin_fs_metawrap.c_end.unlikely.annobin_fs_metawrap.c.startup.annobin_fs_metawrap.c_end.startup.annobin_fs_metawrap.c.exit.annobin_fs_metawrap.c_end.exit.annobin_fs_metawrap_free.start.annobin_fs_metawrap_free.endfs_metawrap_free.annobin_fs_metawrap_copy.start.annobin_fs_metawrap_copy.endfs_metawrap_copy.annobin_fs_metawrap_stat.start.annobin_fs_metawrap_stat.endfs_metawrap_statfs_metawrap_stat.cold.9__func__.6580.annobin_fs_metawrap_alloc.start.annobin_fs_metawrap_alloc.endfs_metawrap_allocfs_metawrap_initfs_metawrap_get_propertiesfs_metawrap_file_allocfs_metawrap_file_initfs_metawrap_file_deinitfs_metawrap_file_closefs_metawrap_set_metadatafs_metawrap_get_metadatafs_metawrap_prefetchfs_metawrap_readfs_metawrap_read_streamfs_metawrap_writefs_metawrap_write_streamfs_metawrap_write_stream_finish.annobin_fs_metawrap_get_metadata.start.annobin_fs_metawrap_get_metadata.endfs_metawrap_get_metadata.cold.10.annobin_fs_metawrap_set_metadata.start.annobin_fs_metawrap_set_metadata.end.annobin_fs_metawrap_file_close.start.annobin_fs_metawrap_file_close.end.annobin_fs_metawrap_file_deinit.start.annobin_fs_metawrap_file_deinit.end.annobin_fs_metawrap_file_init.start.annobin_fs_metawrap_file_init.end.annobin_fs_metawrap_get_properties.start.annobin_fs_metawrap_get_properties.end.annobin_fs_metawrap_init.start.annobin_fs_metawrap_init.end.annobin_fs_metawrap_append_metadata.isra.2.start.annobin_fs_metawrap_append_metadata.isra.2.endfs_metawrap_append_metadata.isra.2.annobin_fs_metawrap_write_stream_finish.start.annobin_fs_metawrap_write_stream_finish.endfs_metawrap_write_stream_finish.cold.11__func__.6570.annobin_fs_metawrap_write_metadata.start.annobin_fs_metawrap_write_metadata.endfs_metawrap_write_metadatafs_metawrap_write_metadata.cold.12__func__.6547.annobin_fs_metawrap_write_stream.start.annobin_fs_metawrap_write_stream.endfs_metawrap_write_stream.cold.13__func__.6556.annobin_fs_metawrap_write.start.annobin_fs_metawrap_write.end.annobin_fs_metawrap_read_stream.start.annobin_fs_metawrap_read_stream.endfs_metawrap_callback.annobin_fs_metawrap_callback.start.annobin_fs_metawrap_callback.endfs_metawrap_callback.cold.14.annobin_fs_metawrap_read.start.annobin_fs_metawrap_read.end.annobin_fs_metawrap_prefetch.start.annobin_fs_metawrap_prefetch.end.annobin_fs_metawrap_file_alloc.start.annobin_fs_metawrap_file_alloc.end.annobin_fs_randomfail.c.annobin_fs_randomfail.c_end.annobin_fs_randomfail.c.hot.annobin_fs_randomfail.c_end.hot.annobin_fs_randomfail.c.unlikely.annobin_fs_randomfail.c_end.unlikely.annobin_fs_randomfail.c.startup.annobin_fs_randomfail.c_end.startup.annobin_fs_randomfail.c.exit.annobin_fs_randomfail.c_end.exit.annobin_fs_randomfail_free.start.annobin_fs_randomfail_free.endfs_randomfail_free.annobin_fs_randomfail_iter_next.start.annobin_fs_randomfail_iter_next.endfs_randomfail_iter_next.annobin_fs_randomfail_alloc.start.annobin_fs_randomfail_alloc.endfs_randomfail_allocfs_randomfail_initfs_randomfail_get_propertiesfs_randomfail_file_allocfs_randomfail_file_initfs_randomfail_file_deinitfs_randomfail_get_metadatafs_randomfail_prefetchfs_randomfail_readfs_randomfail_read_streamfs_randomfail_writefs_randomfail_write_streamfs_randomfail_write_stream_finishfs_randomfail_lockfs_randomfail_unlockfs_randomfail_existsfs_randomfail_statfs_randomfail_copyfs_randomfail_renamefs_randomfail_deletefs_randomfail_iter_allocfs_randomfail_iter_initfs_randomfail_iter_deinitfs_randomfail_get_nlinks.annobin_fs_randomfail_unlock.start.annobin_fs_randomfail_unlock.end.annobin_fs_randomfail_file_deinit.start.annobin_fs_randomfail_file_deinit.end.annobin_fs_randomfail_file_init.start.annobin_fs_randomfail_file_init.end.annobin_fs_randomfail_get_properties.start.annobin_fs_randomfail_get_properties.end.annobin_fs_randomfail_init.start.annobin_fs_randomfail_init.endfs_op_names.annobin_fs_random_fail.start.annobin_fs_random_fail.endfs_random_fail.annobin_fs_file_random_fail_begin.start.annobin_fs_file_random_fail_begin.endfs_file_random_fail_begin.annobin_fs_file_random_fail_end.start.annobin_fs_file_random_fail_end.endfs_file_random_fail_end.annobin_fs_randomfail_get_nlinks.start.annobin_fs_randomfail_get_nlinks.end.annobin_fs_randomfail_delete.start.annobin_fs_randomfail_delete.end.annobin_fs_randomfail_rename.start.annobin_fs_randomfail_rename.end.annobin_fs_randomfail_copy.start.annobin_fs_randomfail_copy.end.annobin_fs_randomfail_stat.start.annobin_fs_randomfail_stat.end.annobin_fs_randomfail_exists.start.annobin_fs_randomfail_exists.end.annobin_fs_randomfail_write.start.annobin_fs_randomfail_write.end.annobin_fs_randomfail_read.start.annobin_fs_randomfail_read.end.annobin_fs_randomfail_get_metadata.start.annobin_fs_randomfail_get_metadata.end.annobin_fs_randomfail_lock.start.annobin_fs_randomfail_lock.end.annobin_fs_randomfail_iter_deinit.start.annobin_fs_randomfail_iter_deinit.end.annobin_fs_random_fail_range.start.annobin_fs_random_fail_range.endfs_random_fail_rangefs_random_fail_range.cold.6__func__.4504.annobin_fs_randomfail_iter_init.start.annobin_fs_randomfail_iter_init.end.annobin_fs_randomfail_read_stream.start.annobin_fs_randomfail_read_stream.end.annobin_fs_randomfail_write_stream_finish.start.annobin_fs_randomfail_write_stream_finish.end.annobin_fs_randomfail_write_stream.start.annobin_fs_randomfail_write_stream.endfs_randomfail_write_stream.cold.7__func__.6443.annobin_fs_randomfail_prefetch.start.annobin_fs_randomfail_prefetch.end.annobin_fs_randomfail_file_alloc.start.annobin_fs_randomfail_file_alloc.end.annobin_fs_randomfail_iter_alloc.start.annobin_fs_randomfail_iter_alloc.end.annobin_fs_posix.c.annobin_fs_posix.c_end.annobin_fs_posix.c.hot.annobin_fs_posix.c_end.hot.annobin_fs_posix.c.unlikely.annobin_fs_posix.c_end.unlikely.annobin_fs_posix.c.startup.annobin_fs_posix.c_end.startup.annobin_fs_posix.c.exit.annobin_fs_posix.c_end.exit.annobin_fs_posix_free.start.annobin_fs_posix_free.endfs_posix_free.annobin_fs_posix_get_properties.start.annobin_fs_posix_get_properties.endfs_posix_get_properties.annobin_fs_posix_iter_deinit.start.annobin_fs_posix_iter_deinit.endfs_posix_iter_deinit.annobin_fs_posix_iter_init.start.annobin_fs_posix_iter_init.endfs_posix_iter_init.annobin_fs_posix_write_rename_if_needed.start.annobin_fs_posix_write_rename_if_needed.endfs_posix_write_rename_if_needed.annobin_fs_posix_unlock.start.annobin_fs_posix_unlock.endfs_posix_unlock.annobin_fs_posix_file_close.start.annobin_fs_posix_file_close.endfs_posix_file_close.annobin_fs_posix_file_deinit.start.annobin_fs_posix_file_deinit.endfs_posix_file_deinitfs_posix_file_deinit.cold.10.annobin_fs_posix_file_init.start.annobin_fs_posix_file_init.endfs_posix_file_init.annobin_fs_posix_init.start.annobin_fs_posix_init.endfs_posix_init.annobin_fs_posix_stat.start.annobin_fs_posix_stat.endfs_posix_stat.annobin_fs_posix_exists.start.annobin_fs_posix_exists.endfs_posix_exists.annobin_fs_posix_iter_next.start.annobin_fs_posix_iter_next.endfs_posix_iter_nextfs_posix_iter_next.cold.11.annobin_fs_posix_get_mode.isra.3.start.annobin_fs_posix_get_mode.isra.3.endfs_posix_get_mode.isra.3.annobin_fs_posix_mkdir_parents.start.annobin_fs_posix_mkdir_parents.endfs_posix_mkdir_parents.annobin_fs_posix_copy.start.annobin_fs_posix_copy.endfs_posix_copy.annobin_fs_posix_write_finish.start.annobin_fs_posix_write_finish.endfs_posix_write_finish.annobin_fs_posix_open.start.annobin_fs_posix_open.endfs_posix_openfs_posix_open.cold.12__func__.8044__func__.8052.annobin_fs_posix_write_stream.start.annobin_fs_posix_write_stream.endfs_posix_write_streamfs_posix_write_stream.cold.13.annobin_fs_posix_write.start.annobin_fs_posix_write.endfs_posix_writefs_posix_write.cold.14__func__.8151.annobin_fs_posix_delete.start.annobin_fs_posix_delete.endfs_posix_delete.annobin_fs_posix_rename.start.annobin_fs_posix_rename.endfs_posix_rename.annobin_fs_posix_lock.start.annobin_fs_posix_lock.endfs_posix_lock.annobin_fs_posix_open_for_read.start.annobin_fs_posix_open_for_read.endfs_posix_open_for_readfs_posix_open_for_read.cold.15__func__.8094.annobin_fs_posix_read_stream.start.annobin_fs_posix_read_stream.endfs_posix_read_stream.annobin_fs_posix_read.start.annobin_fs_posix_read.endfs_posix_read.annobin_fs_posix_prefetch.start.annobin_fs_posix_prefetch.endfs_posix_prefetch.annobin_fs_posix_write_stream_finish.start.annobin_fs_posix_write_stream_finish.endfs_posix_write_stream_finish.annobin_fs_posix_iter_alloc.start.annobin_fs_posix_iter_alloc.endfs_posix_iter_alloc.annobin_fs_posix_file_alloc.start.annobin_fs_posix_file_alloc.endfs_posix_file_alloc.annobin_fs_posix_alloc.start.annobin_fs_posix_alloc.endfs_posix_alloc.annobin_fs_test.c.annobin_fs_test.c_end.annobin_fs_test.c.hot.annobin_fs_test.c_end.hot.annobin_fs_test.c.unlikely.annobin_fs_test.c_end.unlikely.annobin_fs_test.c.startup.annobin_fs_test.c_end.startup.annobin_fs_test.c.exit.annobin_fs_test.c_end.exit.annobin_fs_test_init.start.annobin_fs_test_init.endfs_test_init.annobin_fs_test_get_properties.start.annobin_fs_test_get_properties.endfs_test_get_properties.annobin_fs_test_file_close.start.annobin_fs_test_file_close.endfs_test_file_close.annobin_fs_test_file_get_path.start.annobin_fs_test_file_get_path.endfs_test_file_get_path.annobin_fs_test_set_async_callback.start.annobin_fs_test_set_async_callback.endfs_test_set_async_callback.annobin_fs_test_wait_async.start.annobin_fs_test_wait_async.endfs_test_wait_async.annobin_fs_test_prefetch.start.annobin_fs_test_prefetch.endfs_test_prefetch.annobin_fs_test_unlock.start.annobin_fs_test_unlock.endfs_test_unlock.annobin_fs_test_iter_deinit.start.annobin_fs_test_iter_deinit.endfs_test_iter_deinit.annobin_fs_test_iter_next.start.annobin_fs_test_iter_next.endfs_test_iter_next.annobin_fs_test_iter_init.start.annobin_fs_test_iter_init.endfs_test_iter_init.annobin_fs_test_write_stream_finish.start.annobin_fs_test_write_stream_finish.endfs_test_write_stream_finish.annobin_fs_test_file_deinit.start.annobin_fs_test_file_deinit.endfs_test_file_deinit.annobin_fs_test_free.start.annobin_fs_test_free.endfs_test_free.annobin_fs_test_file_init.start.annobin_fs_test_file_init.endfs_test_file_init.annobin_fs_test_alloc.start.annobin_fs_test_alloc.endfs_test_allocfs_test_file_allocfs_test_set_metadatafs_test_get_metadatafs_test_read_streamfs_test_write_streamfs_test_lockfs_test_existsfs_test_statfs_test_copyfs_test_renamefs_test_deletefs_test_iter_alloc.annobin_fs_test_stream_destroyed.start.annobin_fs_test_stream_destroyed.endfs_test_stream_destroyedfs_test_stream_destroyed.cold.13__func__.6314.annobin_fs_test_delete.start.annobin_fs_test_delete.end.annobin_fs_test_stat.start.annobin_fs_test_stat.end.annobin_fs_test_write_stream.start.annobin_fs_test_write_stream.endfs_test_write_stream.cold.14__func__.6327.annobin_fs_test_read_stream.start.annobin_fs_test_read_stream.endfs_test_read_stream.cold.15__func__.6321.annobin_fs_test_set_metadata.start.annobin_fs_test_set_metadata.end.annobin_fs_test_exists.start.annobin_fs_test_exists.end.annobin_fs_test_get_metadata.start.annobin_fs_test_get_metadata.end.annobin_fs_test_iter_alloc.start.annobin_fs_test_iter_alloc.end.annobin_fs_test_file_alloc.start.annobin_fs_test_file_alloc.end.annobin_fs_test_lock.start.annobin_fs_test_lock.end.annobin_test_fs_get.start.annobin_test_fs_get.endtest_fs_get.cold.16__func__.6406.annobin_test_fs_file_get.start.annobin_test_fs_file_get.endtest_fs_file_get.cold.17.annobin_fs_test_copy.start.annobin_fs_test_copy.end.annobin_fs_test_rename.start.annobin_fs_test_rename.end.annobin_fs_test_async.c.annobin_fs_test_async.c_end.annobin_fs_test_async.c.hot.annobin_fs_test_async.c_end.hot.annobin_fs_test_async.c.unlikely.annobin_fs_test_async.c_end.unlikely.annobin_fs_test_async.c.startup.annobin_fs_test_async.c_end.startup.annobin_fs_test_async.c.exit.annobin_fs_test_async.c_end.exit.annobin_test_fs_async.start.annobin_test_fs_async.endtest_fs_async.cold.0.annobin_fs_sis.c.annobin_fs_sis.c_end.annobin_fs_sis.c.hot.annobin_fs_sis.c_end.hot.annobin_fs_sis.c.unlikely.annobin_fs_sis.c_end.unlikely.annobin_fs_sis.c.startup.annobin_fs_sis.c_end.startup.annobin_fs_sis.c.exit.annobin_fs_sis.c_end.exit.annobin_fs_sis_free.start.annobin_fs_sis_free.endfs_sis_free.annobin_fs_sis_alloc.start.annobin_fs_sis_alloc.endfs_sis_allocfs_sis_initfs_sis_file_allocfs_sis_file_initfs_sis_file_deinitfs_sis_file_closefs_sis_writefs_sis_write_streamfs_sis_write_stream_finishfs_sis_delete.annobin_fs_sis_delete.start.annobin_fs_sis_delete.endfs_sis_delete.cold.2.annobin_fs_sis_try_link.start.annobin_fs_sis_try_link.endfs_sis_try_link.annobin_fs_sis_replace_hash_file.start.annobin_fs_sis_replace_hash_file.endfs_sis_replace_hash_file.annobin_fs_sis_write.start.annobin_fs_sis_write.endfs_sis_write.cold.3.annobin_fs_sis_file_close.start.annobin_fs_sis_file_close.end.annobin_fs_sis_file_deinit.start.annobin_fs_sis_file_deinit.end.annobin_fs_sis_file_init.start.annobin_fs_sis_file_init.end.annobin_fs_sis_init.start.annobin_fs_sis_init.end.annobin_fs_sis_write_stream_finish.start.annobin_fs_sis_write_stream_finish.endfs_sis_write_stream_finish.cold.4.annobin_fs_sis_write_stream.start.annobin_fs_sis_write_stream.endfs_sis_write_stream.cold.5__func__.6274.annobin_fs_sis_file_alloc.start.annobin_fs_sis_file_alloc.end.annobin_fs_sis_common.c.annobin_fs_sis_common.c_end.annobin_fs_sis_common.c.hot.annobin_fs_sis_common.c_end.hot.annobin_fs_sis_common.c.unlikely.annobin_fs_sis_common.c_end.unlikely.annobin_fs_sis_common.c.startup.annobin_fs_sis_common.c_end.startup.annobin_fs_sis_common.c.exit.annobin_fs_sis_common.c_end.exit.annobin_fs_sis_path_parse.start.annobin_fs_sis_path_parse.end.annobin_fs_sis_try_unlink_hash_file.start.annobin_fs_sis_try_unlink_hash_file.end.annobin_fs_sis_queue.c.annobin_fs_sis_queue.c_end.annobin_fs_sis_queue.c.hot.annobin_fs_sis_queue.c_end.hot.annobin_fs_sis_queue.c.unlikely.annobin_fs_sis_queue.c_end.unlikely.annobin_fs_sis_queue.c.startup.annobin_fs_sis_queue.c_end.startup.annobin_fs_sis_queue.c.exit.annobin_fs_sis_queue.c_end.exit.annobin_fs_sis_queue_free.start.annobin_fs_sis_queue_free.endfs_sis_queue_free.annobin_fs_sis_queue_alloc.start.annobin_fs_sis_queue_alloc.endfs_sis_queue_allocfs_sis_queue_initfs_sis_queue_file_allocfs_sis_queue_file_initfs_sis_queue_file_deinitfs_sis_queue_writefs_sis_queue_write_streamfs_sis_queue_write_stream_finishfs_sis_queue_delete.annobin_fs_sis_queue_delete.start.annobin_fs_sis_queue_delete.endfs_sis_queue_delete.cold.3.annobin_fs_sis_queue_add.start.annobin_fs_sis_queue_add.endfs_sis_queue_add.annobin_fs_sis_queue_write.start.annobin_fs_sis_queue_write.endfs_sis_queue_write.cold.4.annobin_fs_sis_queue_file_deinit.start.annobin_fs_sis_queue_file_deinit.end.annobin_fs_sis_queue_init.start.annobin_fs_sis_queue_init.end.annobin_fs_sis_queue_write_stream_finish.start.annobin_fs_sis_queue_write_stream_finish.endfs_sis_queue_write_stream_finish.cold.5.annobin_fs_sis_queue_write_stream.start.annobin_fs_sis_queue_write_stream.endfs_sis_queue_write_stream.cold.6__func__.6240.annobin_fs_sis_queue_file_init.start.annobin_fs_sis_queue_file_init.end.annobin_fs_sis_queue_file_alloc.start.annobin_fs_sis_queue_file_alloc.end.annobin_fs_wrapper.c.annobin_fs_wrapper.c_end.annobin_fs_wrapper.c.hot.annobin_fs_wrapper.c_end.hot.annobin_fs_wrapper.c.unlikely.annobin_fs_wrapper.c_end.unlikely.annobin_fs_wrapper.c.startup.annobin_fs_wrapper.c_end.startup.annobin_fs_wrapper.c.exit.annobin_fs_wrapper.c_end.exit.annobin_fs_wrapper_get_properties.start.annobin_fs_wrapper_get_properties.end.annobin_fs_wrapper_file_close.start.annobin_fs_wrapper_file_close.end.annobin_fs_wrapper_file_get_path.start.annobin_fs_wrapper_file_get_path.end.annobin_fs_wrapper_set_async_callback.start.annobin_fs_wrapper_set_async_callback.end.annobin_fs_wrapper_wait_async.start.annobin_fs_wrapper_wait_async.end.annobin_fs_wrapper_set_metadata.start.annobin_fs_wrapper_set_metadata.end.annobin_fs_wrapper_get_metadata.start.annobin_fs_wrapper_get_metadata.end.annobin_fs_wrapper_prefetch.start.annobin_fs_wrapper_prefetch.end.annobin_fs_wrapper_read.start.annobin_fs_wrapper_read.end.annobin_fs_wrapper_read_stream.start.annobin_fs_wrapper_read_stream.end.annobin_fs_wrapper_write.start.annobin_fs_wrapper_write.end.annobin_fs_wrapper_write_stream.start.annobin_fs_wrapper_write_stream.endfs_wrapper_write_stream.cold.1__func__.5845.annobin_fs_wrapper_write_stream_finish.start.annobin_fs_wrapper_write_stream_finish.end.annobin_fs_wrapper_lock.start.annobin_fs_wrapper_lock.end.annobin_fs_wrapper_unlock.start.annobin_fs_wrapper_unlock.end.annobin_fs_wrapper_exists.start.annobin_fs_wrapper_exists.end.annobin_fs_wrapper_stat.start.annobin_fs_wrapper_stat.end.annobin_fs_wrapper_get_nlinks.start.annobin_fs_wrapper_get_nlinks.end.annobin_fs_wrapper_copy.start.annobin_fs_wrapper_copy.end.annobin_fs_wrapper_rename.start.annobin_fs_wrapper_rename.end.annobin_fs_wrapper_delete.start.annobin_fs_wrapper_delete.end.annobin_fs_wrapper_iter_alloc.start.annobin_fs_wrapper_iter_alloc.end.annobin_fs_wrapper_iter_init.start.annobin_fs_wrapper_iter_init.end.annobin_fs_wrapper_iter_next.start.annobin_fs_wrapper_iter_next.end.annobin_fs_wrapper_iter_deinit.start.annobin_fs_wrapper_iter_deinit.end.annobin_istream_fs_file.c.annobin_istream_fs_file.c_end.annobin_istream_fs_file.c.hot.annobin_istream_fs_file.c_end.hot.annobin_istream_fs_file.c.unlikely.annobin_istream_fs_file.c_end.unlikely.annobin_istream_fs_file.c.startup.annobin_istream_fs_file.c_end.startup.annobin_istream_fs_file.c.exit.annobin_istream_fs_file.c_end.exit.annobin_i_stream_fs_file_read.start.annobin_i_stream_fs_file_read.endi_stream_fs_file_read.annobin_i_stream_fs_file_close.start.annobin_i_stream_fs_file_close.endi_stream_fs_file_close.annobin_i_stream_create_fs_file.start.annobin_i_stream_create_fs_file.end.annobin_istream_fs_stats.c.annobin_istream_fs_stats.c_end.annobin_istream_fs_stats.c.hot.annobin_istream_fs_stats.c_end.hot.annobin_istream_fs_stats.c.unlikely.annobin_istream_fs_stats.c_end.unlikely.annobin_istream_fs_stats.c.startup.annobin_istream_fs_stats.c_end.startup.annobin_istream_fs_stats.c.exit.annobin_istream_fs_stats.c_end.exit.annobin_i_stream_fs_stats_read.start.annobin_i_stream_fs_stats_read.endi_stream_fs_stats_read.annobin_i_stream_create_fs_stats.start.annobin_i_stream_create_fs_stats.end.annobin_istream_metawrap.c.annobin_istream_metawrap.c_end.annobin_istream_metawrap.c.hot.annobin_istream_metawrap.c_end.hot.annobin_istream_metawrap.c.unlikely.annobin_istream_metawrap.c_end.unlikely.annobin_istream_metawrap.c.startup.annobin_istream_metawrap.c_end.startup.annobin_istream_metawrap.c.exit.annobin_istream_metawrap.c_end.exit.annobin_i_stream_metawrap_seek.start.annobin_i_stream_metawrap_seek.endi_stream_metawrap_seek.annobin_i_stream_metawrap_stat.start.annobin_i_stream_metawrap_stat.endi_stream_metawrap_stati_stream_metawrap_stat.cold.1__func__.5028.annobin_i_stream_metawrap_read.start.annobin_i_stream_metawrap_read.endi_stream_metawrap_readi_stream_metawrap_read.cold.2__func__.5007.annobin_i_stream_create_metawrap.start.annobin_i_stream_create_metawrap.end.annobin_ostream_metawrap.c.annobin_ostream_metawrap.c_end.annobin_ostream_metawrap.c.hot.annobin_ostream_metawrap.c_end.hot.annobin_ostream_metawrap.c.unlikely.annobin_ostream_metawrap.c_end.unlikely.annobin_ostream_metawrap.c.startup.annobin_ostream_metawrap.c_end.startup.annobin_ostream_metawrap.c.exit.annobin_ostream_metawrap.c_end.exit.annobin_o_stream_metawrap_send_istream.start.annobin_o_stream_metawrap_send_istream.endo_stream_metawrap_send_istream.annobin_o_stream_metawrap_sendv.start.annobin_o_stream_metawrap_sendv.endo_stream_metawrap_sendv.annobin_o_stream_create_metawrap.start.annobin_o_stream_create_metawrap.end.annobin_ostream_cmp.c.annobin_ostream_cmp.c_end.annobin_ostream_cmp.c.hot.annobin_ostream_cmp.c_end.hot.annobin_ostream_cmp.c.unlikely.annobin_ostream_cmp.c_end.unlikely.annobin_ostream_cmp.c.startup.annobin_ostream_cmp.c_end.startup.annobin_ostream_cmp.c.exit.annobin_ostream_cmp.c_end.exit.annobin_o_stream_cmp_close.start.annobin_o_stream_cmp_close.endo_stream_cmp_close.annobin_stream_cmp_block.start.annobin_stream_cmp_block.end.annobin_o_stream_cmp_sendv.start.annobin_o_stream_cmp_sendv.endo_stream_cmp_sendv.annobin_o_stream_create_cmp.start.annobin_o_stream_create_cmp.end.annobin_o_stream_cmp_equals.start.annobin_o_stream_cmp_equals.end.annobin_dict.c.annobin_dict.c_end.annobin_dict.c.hot.annobin_dict.c_end.hot.annobin_dict.c.unlikely.annobin_dict.c_end.unlikely.annobin_dict.c.startup.annobin_dict.c_end.startup.annobin_dict.c.exit.annobin_dict.c_end.exit.annobin_dict_transaction_commit_async_noop_callback.start.annobin_dict_transaction_commit_async_noop_callback.end.annobin_dict_driver_lookup.start.annobin_dict_driver_lookup.enddict_driver_lookupdict_drivers.annobin_dict_unref.start.annobin_dict_unref.enddict_unrefdict_unref.cold.12.annobin_dict_transaction_finished.start.annobin_dict_transaction_finished.enddict_transaction_finished__func__.5597.annobin_dict_lookup_finished.start.annobin_dict_lookup_finished.enddict_lookup_finished__func__.5588.annobin_dict_transaction_commit_sync_callback.start.annobin_dict_transaction_commit_sync_callback.enddict_transaction_commit_sync_callback.annobin_dict_ref.isra.4.part.5.start.annobin_dict_ref.isra.4.part.5.enddict_ref.isra.4.part.5__func__.5542.annobin_dict_event_create.isra.7.start.annobin_dict_event_create.isra.7.enddict_event_create.isra.7.annobin_dict_key_prefix_is_valid.start.annobin_dict_key_prefix_is_valid.enddict_key_prefix_is_validdict_key_prefix_is_valid.cold.13__func__.5576.annobin_dict_driver_register.start.annobin_dict_driver_register.enddict_driver_register.cold.14.annobin_dict_driver_unregister.start.annobin_dict_driver_unregister.end__func__.5524.annobin_dict_init.start.annobin_dict_init.endevent_category_dictdict_init.cold.15__func__.5537.annobin_dict_deinit.start.annobin_dict_deinit.end__func__.5554.annobin_dict_switch_ioloop.start.annobin_dict_switch_ioloop.end.annobin_dict_pre_api_callback.start.annobin_dict_pre_api_callback.end.annobin_dict_post_api_callback.start.annobin_dict_post_api_callback.end.annobin_dict_lookup_callback.start.annobin_dict_lookup_callback.end.annobin_dict_lookup.start.annobin_dict_lookup.enddict_lookup.cold.17__func__.5630.annobin_dict_lookup_async.start.annobin_dict_lookup_async.enddict_lookup_async.cold.18__func__.5639.annobin_dict_iterate_values.start.annobin_dict_iterate_values.enddict_iterate_values.cold.19__func__.5665.annobin_dict_iterate.start.annobin_dict_iterate.end.annobin_dict_iterate_set_async_callback.start.annobin_dict_iterate_set_async_callback.end.annobin_dict_iterate_set_limit.start.annobin_dict_iterate_set_limit.end.annobin_dict_iterate_has_more.start.annobin_dict_iterate_has_more.end.annobin_dict_transaction_no_slowness_warning.start.annobin_dict_transaction_no_slowness_warning.end.annobin_dict_transaction_set_hide_log_values.start.annobin_dict_transaction_set_hide_log_values.end.annobin_dict_transaction_set_timestamp.start.annobin_dict_transaction_set_timestamp.enddict_transaction_set_timestamp.cold.20__func__.5708.annobin_dict_transaction_commit.start.annobin_dict_transaction_commit.enddict_commit_callbackdict_transaction_commit.cold.21.annobin_dict_transaction_commit_async.start.annobin_dict_transaction_commit_async.enddict_transaction_commit_async.cold.22__func__.5736.annobin_dict_transaction_commit_async_nocallback.start.annobin_dict_transaction_commit_async_nocallback.end.annobin_dict_set.start.annobin_dict_set.enddict_set.cold.23__func__.5752.annobin_dict_unset.start.annobin_dict_unset.enddict_unset.cold.24__func__.5760.annobin_dict_atomic_inc.start.annobin_dict_atomic_inc.enddict_atomic_inc.cold.25__func__.5769.annobin_dict_escape_string.start.annobin_dict_escape_string.end.annobin_dict_unescape_string.start.annobin_dict_unescape_string.end.annobin_dict_op_settings_dup.start.annobin_dict_op_settings_dup.end.annobin_dict_iterate_init.start.annobin_dict_iterate_init.enddict_iterate_init.cold.26__func__.5651.annobin_dict_transaction_begin.start.annobin_dict_transaction_begin.end.annobin_dict_op_settings_private_free.start.annobin_dict_op_settings_private_free.end.annobin_dict_commit_async_timeout.start.annobin_dict_commit_async_timeout.enddict_commit_async_timeout.annobin_dict_wait.start.annobin_dict_wait.end.annobin_dict_commit_callback.start.annobin_dict_commit_callback.enddict_commit_callback.cold.27__func__.5613.annobin_dict_iterate_deinit.start.annobin_dict_iterate_deinit.enddict_iterate_deinit.cold.28__func__.5686.annobin_dict_transaction_rollback.start.annobin_dict_transaction_rollback.enddict_transaction_rollback.cold.29__func__.5745.annobin_dict_client.c.annobin_dict_client.c_end.annobin_dict_client.c.hot.annobin_dict_client.c_end.hot.annobin_dict_client.c.unlikely.annobin_dict_client.c_end.unlikely.annobin_dict_client.c.startup.annobin_dict_client.c_end.startup.annobin_dict_client.c.exit.annobin_dict_client.c_end.exit.annobin_client_dict_transaction_free.start.annobin_client_dict_transaction_free.endclient_dict_transaction_free.annobin_dict_wait_warnings.start.annobin_dict_wait_warnings.enddict_wait_warnings.annobin_client_dict_switch_ioloop.start.annobin_client_dict_switch_ioloop.endclient_dict_switch_ioloop.annobin_dict_warnings_sec.start.annobin_dict_warnings_sec.enddict_warnings_sec.annobin_client_dict_iter_api_callback.start.annobin_client_dict_iter_api_callback.endclient_dict_iter_api_callback.annobin_client_dict_init.start.annobin_client_dict_init.endclient_dict_initdict_connectionsdict_conn_vfuncsdict_conn_set.annobin_client_dict_lookup_callback.start.annobin_client_dict_lookup_callback.endclient_dict_lookup_callback.annobin_dict_cmd_callback_error.start.annobin_dict_cmd_callback_error.enddict_cmd_callback_errordict_cmd_callback_error.cold.24.annobin_client_dict_cmd_unref.start.annobin_client_dict_cmd_unref.endclient_dict_cmd_unrefclient_dict_cmd_unref.cold.25__func__.7866.annobin_client_dict_iterate_unref.start.annobin_client_dict_iterate_unref.endclient_dict_iterate_unrefclient_dict_iterate_unref.cold.26__func__.8173.annobin_client_dict_add_timeout.start.annobin_client_dict_add_timeout.endclient_dict_add_timeoutclient_dict_timeout.annobin_client_dict_iterate_deinit.start.annobin_client_dict_iterate_deinit.endclient_dict_iterate_deinitclient_dict_iterate_deinit.cold.27__func__.8231.annobin_client_dict_connect.start.annobin_client_dict_connect.endclient_dict_connect.annobin_client_dict_cmd_query_send.isra.14.start.annobin_client_dict_cmd_query_send.isra.14.endclient_dict_cmd_query_send.isra.14client_dict_cmd_query_send.isra.14.cold.28__func__.7905.annobin_client_dict_wait.start.annobin_client_dict_wait.endclient_dict_waitclient_dict_wait.cold.29.annobin_client_dict_lookup.start.annobin_client_dict_lookup.endclient_dict_lookupclient_dict_lookup.cold.30__func__.8168.annobin_dict_conn_input_line.start.annobin_dict_conn_input_line.enddict_conn_input_linedict_conn_input_line.cold.31__func__.7998__func__.7862.annobin_client_dict_disconnect.start.annobin_client_dict_disconnect.endclient_dict_disconnectclient_dict_disconnect.cold.32.annobin_client_dict_timeout.start.annobin_client_dict_timeout.end.annobin_client_dict_reconnect.start.annobin_client_dict_reconnect.endclient_dict_reconnectclient_dict_cmd_sendclient_dict_reconnect.cold.33.annobin_client_dict_cmd_send.start.annobin_client_dict_cmd_send.endclient_dict_input_timeoutclient_dict_cmd_send.cold.34__func__.7915.annobin_client_dict_input_timeout.start.annobin_client_dict_input_timeout.end__func__.7896.annobin_client_dict_lookup_async_callback.start.annobin_client_dict_lookup_async_callback.endclient_dict_lookup_async_callback.annobin_client_dict_transaction_commit_callback.start.annobin_client_dict_transaction_commit_callback.endclient_dict_transaction_commit_callbackclient_dict_transaction_commit_callback.cold.35.annobin_client_dict_iter_async_callback.start.annobin_client_dict_iter_async_callback.endclient_dict_iter_async_callbackclient_dict_iter_async_callback.cold.36.annobin_client_dict_deinit.start.annobin_client_dict_deinit.endclient_dict_deinitclient_dict_deinit.cold.37__func__.8084.annobin_dict_conn_destroy.start.annobin_dict_conn_destroy.enddict_conn_destroy.annobin_client_dict_transaction_init.start.annobin_client_dict_transaction_init.endclient_dict_transaction_init.annobin_client_dict_cmd_init.start.annobin_client_dict_cmd_init.endclient_dict_cmd_init.annobin_client_dict_send_transaction_query.start.annobin_client_dict_send_transaction_query.endclient_dict_send_transaction_query.annobin_client_dict_set_hide_log_values.start.annobin_client_dict_set_hide_log_values.endclient_dict_set_hide_log_values.annobin_client_dict_atomic_inc.start.annobin_client_dict_atomic_inc.endclient_dict_atomic_inc.annobin_client_dict_unset.start.annobin_client_dict_unset.endclient_dict_unset.annobin_client_dict_set.start.annobin_client_dict_set.endclient_dict_set.annobin_client_dict_transaction_rollback.start.annobin_client_dict_transaction_rollback.endclient_dict_transaction_rollback.annobin_client_dict_set_timestamp.start.annobin_client_dict_set_timestamp.endclient_dict_set_timestamp.annobin_client_dict_lookup_async.start.annobin_client_dict_lookup_async.endclient_dict_lookup_async.annobin_client_dict_iterate.start.annobin_client_dict_iterate.endclient_dict_iterate.annobin_client_dict_transaction_commit.start.annobin_client_dict_transaction_commit.endclient_dict_transaction_commit.annobin_client_dict_iterate_init.start.annobin_client_dict_iterate_init.endclient_dict_iterate_init.annobin_dict_file.c.annobin_dict_file.c_end.annobin_dict_file.c.hot.annobin_dict_file.c_end.hot.annobin_dict_file.c.unlikely.annobin_dict_file.c_end.unlikely.annobin_dict_file.c.startup.annobin_dict_file.c_end.startup.annobin_dict_file.c.exit.annobin_dict_file.c_end.exit.annobin_file_dict_need_refresh.start.annobin_file_dict_need_refresh.endfile_dict_need_refresh.annobin_file_dict_iterate_deinit.start.annobin_file_dict_iterate_deinit.endfile_dict_iterate_deinit.annobin_file_dict_iterate.start.annobin_file_dict_iterate.endfile_dict_iterate.annobin_file_dict_deinit.start.annobin_file_dict_deinit.endfile_dict_deinit__func__.7721.annobin_file_dict_init.start.annobin_file_dict_init.endfile_dict_init.annobin_file_dict_ensure_path_home_dir.start.annobin_file_dict_ensure_path_home_dir.endfile_dict_ensure_path_home_dir.annobin_file_dict_open_latest.start.annobin_file_dict_open_latest.endfile_dict_open_latest__func__.7734.annobin_file_dict_mkdir.isra.4.start.annobin_file_dict_mkdir.isra.4.endfile_dict_mkdir.isra.4.annobin_file_dict_refresh.start.annobin_file_dict_refresh.endfile_dict_refresh.annobin_fd_copy_stat_permissions.isra.6.start.annobin_fd_copy_stat_permissions.isra.6.endfd_copy_stat_permissions.isra.6.annobin_fd_copy_parent_dir_permissions.start.annobin_fd_copy_parent_dir_permissions.endfd_copy_parent_dir_permissions.annobin_file_dict_transaction_commit.start.annobin_file_dict_transaction_commit.endfile_dict_transaction_commitfile_dict_dotlock_settings__func__.7876file_dict_transaction_commit.cold.10.annobin_file_dict_lookup.start.annobin_file_dict_lookup.endfile_dict_lookup.annobin_file_dict_transaction_init.start.annobin_file_dict_transaction_init.endfile_dict_transaction_init.annobin_file_dict_iterate_init.start.annobin_file_dict_iterate_init.endfile_dict_iterate_init.annobin_dict_memcached.c.annobin_dict_memcached.c_end.annobin_dict_memcached.c.hot.annobin_dict_memcached.c_end.hot.annobin_dict_memcached.c.unlikely.annobin_dict_memcached.c_end.unlikely.annobin_dict_memcached.c.startup.annobin_dict_memcached.c_end.startup.annobin_dict_memcached.c.exit.annobin_dict_memcached.c_end.exit.annobin_memcached_dict_lookup_timeout.start.annobin_memcached_dict_lookup_timeout.endmemcached_dict_lookup_timeout.annobin_memcached_conn_connected.start.annobin_memcached_conn_connected.endmemcached_conn_connected.annobin_memcached_conn_destroy.start.annobin_memcached_conn_destroy.endmemcached_conn_destroy.annobin_memcached_dict_lookup.start.annobin_memcached_dict_lookup.endmemcached_dict_lookupmemcached_dict_lookup.cold.2__func__.7047__func__.7034.annobin_memcached_dict_deinit.start.annobin_memcached_dict_deinit.endmemcached_dict_deinitmemcached_connections.annobin_memcached_conn_input.start.annobin_memcached_conn_input.endmemcached_conn_input.annobin_memcached_dict_init.start.annobin_memcached_dict_init.endmemcached_dict_initmemcached_conn_vfuncsmemcached_conn_setmemcached_dict_init.cold.3.annobin_dict_memcached_ascii.c.annobin_dict_memcached_ascii.c_end.annobin_dict_memcached_ascii.c.hot.annobin_dict_memcached_ascii.c_end.hot.annobin_dict_memcached_ascii.c.unlikely.annobin_dict_memcached_ascii.c_end.unlikely.annobin_dict_memcached_ascii.c.startup.annobin_dict_memcached_ascii.c_end.startup.annobin_dict_memcached_ascii.c.exit.annobin_dict_memcached_ascii.c_end.exit.annobin_memcached_ascii_disconnected.start.annobin_memcached_ascii_disconnected.endmemcached_ascii_disconnected.annobin_memcached_ascii_input_timeout.start.annobin_memcached_ascii_input_timeout.endmemcached_ascii_input_timeout.annobin_memcached_ascii_input_wait.start.annobin_memcached_ascii_input_wait.endmemcached_ascii_input_waitmemcached_ascii_input_wait.cold.13__func__.7090.annobin_memcached_ascii_input_reply_read.start.annobin_memcached_ascii_input_reply_read.endmemcached_ascii_input_reply_read.annobin_memcached_ascii_input_reply.start.annobin_memcached_ascii_input_reply.endmemcached_ascii_input_replymemcached_ascii_input_reply.cold.14__func__.7072.annobin_memcached_ascii_wait.start.annobin_memcached_ascii_wait.endmemcached_ascii_waitmemcached_ascii_wait.cold.15__func__.7101__func__.7110.annobin_memcached_ascii_dict_deinit.start.annobin_memcached_ascii_dict_deinit.endmemcached_ascii_dict_deinitmemcached_ascii_connectionsmemcached_ascii_dict_deinit.cold.16.annobin_memcached_ascii_conn_connected.start.annobin_memcached_ascii_conn_connected.endmemcached_ascii_conn_connected.annobin_memcached_ascii_conn_destroy.start.annobin_memcached_ascii_conn_destroy.endmemcached_ascii_conn_destroy.annobin_memcached_ascii_dict_init.start.annobin_memcached_ascii_dict_init.endmemcached_ascii_dict_initmemcached_ascii_conn_vfuncsmemcached_ascii_conn_setmemcached_ascii_dict_init.cold.17.annobin_memcached_ascii_dict_get_full_key.isra.6.start.annobin_memcached_ascii_dict_get_full_key.isra.6.endmemcached_ascii_dict_get_full_key.isra.6memcached_ascii_dict_get_full_key.isra.6.cold.18.annobin_memcached_ascii_connect.start.annobin_memcached_ascii_connect.endmemcached_ascii_connect.annobin_memcached_ascii_transaction_commit.start.annobin_memcached_ascii_transaction_commit.endmemcached_ascii_transaction_commitmemcached_ascii_transaction_commit.cold.19.annobin_memcached_ascii_conn_input.start.annobin_memcached_ascii_conn_input.endmemcached_ascii_conn_input.annobin_memcached_ascii_transaction_init.start.annobin_memcached_ascii_transaction_init.endmemcached_ascii_transaction_init.annobin_memcached_ascii_dict_lookup.start.annobin_memcached_ascii_dict_lookup.endmemcached_ascii_dict_lookup.annobin_dict_redis.c.annobin_dict_redis.c_end.annobin_dict_redis.c.hot.annobin_dict_redis.c_end.hot.annobin_dict_redis.c.unlikely.annobin_dict_redis.c_end.unlikely.annobin_dict_redis.c.startup.annobin_dict_redis.c_end.startup.annobin_dict_redis.c.exit.annobin_dict_redis.c_end.exit.annobin_redis_dict_auth.start.annobin_redis_dict_auth.endredis_dict_auth.annobin_redis_wait.start.annobin_redis_wait.endredis_waitredis_dict_wait_timeoutredis_wait.cold.15__func__.7028.annobin_redis_dict_wait.start.annobin_redis_dict_wait.endredis_dict_wait.annobin_redis_conn_connected.start.annobin_redis_conn_connected.endredis_conn_connected.annobin_redis_dict_deinit.start.annobin_redis_dict_deinit.endredis_dict_deinitredis_connectionsredis_dict_deinit.cold.16__func__.7116.annobin_redis_dict_init.start.annobin_redis_dict_init.endredis_dict_initredis_conn_vfuncsredis_conn_setredis_dict_init.cold.17.annobin_redis_check_transaction.start.annobin_redis_check_transaction.endredis_check_transaction.annobin_redis_append_expire.isra.6.start.annobin_redis_append_expire.isra.6.endredis_append_expire.isra.6.annobin_redis_dict_get_full_key.isra.7.start.annobin_redis_dict_get_full_key.isra.7.endredis_dict_get_full_key.isra.7redis_dict_get_full_key.isra.7.cold.18.annobin_redis_atomic_inc.start.annobin_redis_atomic_inc.endredis_atomic_inc.annobin_redis_unset.start.annobin_redis_unset.endredis_unset.annobin_redis_set.start.annobin_redis_set.endredis_set.annobin_redis_reply_callback.isra.8.start.annobin_redis_reply_callback.isra.8.endredis_reply_callback.isra.8redis_reply_callback.isra.8.cold.19.annobin_redis_disconnected.start.annobin_redis_disconnected.endredis_disconnected.annobin_redis_transaction_rollback.start.annobin_redis_transaction_rollback.endredis_transaction_rollbackredis_transaction_rollback.cold.20__func__.7183.annobin_redis_dict_wait_timeout.start.annobin_redis_dict_wait_timeout.end.annobin_redis_dict_lookup_timeout.start.annobin_redis_dict_lookup_timeout.endredis_dict_lookup_timeout.annobin_redis_conn_destroy.start.annobin_redis_conn_destroy.endredis_conn_destroy.annobin_redis_transaction_commit.start.annobin_redis_transaction_commit.endredis_transaction_commitredis_transaction_commit.cold.21.annobin_redis_dict_select_db.part.12.start.annobin_redis_dict_select_db.part.12.endredis_dict_select_db.part.12.annobin_redis_dict_lookup.start.annobin_redis_dict_lookup.endredis_dict_lookupredis_dict_lookup.cold.22__func__.7151.annobin_redis_conn_input.start.annobin_redis_conn_input.endredis_conn_inputredis_conn_input.cold.23__func__.7057.annobin_redis_transaction_init.start.annobin_redis_transaction_init.endredis_transaction_initredis_transaction_init.cold.24__func__.7161.annobin_dict_fail.c.annobin_dict_fail.c_end.annobin_dict_fail.c.hot.annobin_dict_fail.c_end.hot.annobin_dict_fail.c.unlikely.annobin_dict_fail.c_end.unlikely.annobin_dict_fail.c.startup.annobin_dict_fail.c_end.startup.annobin_dict_fail.c.exit.annobin_dict_fail.c_end.exit.annobin_dict_fail_init.start.annobin_dict_fail_init.enddict_fail_init.annobin_dict_fail_deinit.start.annobin_dict_fail_deinit.enddict_fail_deinit.annobin_dict_fail_lookup.start.annobin_dict_fail_lookup.enddict_fail_lookup.annobin_dict_fail_iterate_init.start.annobin_dict_fail_iterate_init.enddict_fail_iterate_init.annobin_dict_fail_iterate.start.annobin_dict_fail_iterate.enddict_fail_iterate.annobin_dict_fail_iterate_deinit.start.annobin_dict_fail_iterate_deinit.enddict_fail_iterate_deinit.annobin_dict_fail_transaction_init.start.annobin_dict_fail_transaction_init.enddict_fail_transaction_init.annobin_dict_fail_transaction_commit.start.annobin_dict_fail_transaction_commit.enddict_fail_transaction_commit.annobin_dict_fail_set.start.annobin_dict_fail_set.enddict_fail_set.annobin_dict_fail_unset.start.annobin_dict_fail_unset.enddict_fail_unset.annobin_dict_fail_atomic_inc.start.annobin_dict_fail_atomic_inc.enddict_fail_atomic_inc.annobin_dict_fail_switch_ioloop.start.annobin_dict_fail_switch_ioloop.enddict_fail_switch_ioloop.annobin_dict_fail_set_timestamp.start.annobin_dict_fail_set_timestamp.enddict_fail_set_timestamp.annobin_dict_fail_wait.start.annobin_dict_fail_wait.enddict_fail_wait.annobin_dict_fail_transaction_rollback.start.annobin_dict_fail_transaction_rollback.enddict_fail_transaction_rollback.annobin_dict_transaction_memory.c.annobin_dict_transaction_memory.c_end.annobin_dict_transaction_memory.c.hot.annobin_dict_transaction_memory.c_end.hot.annobin_dict_transaction_memory.c.unlikely.annobin_dict_transaction_memory.c_end.unlikely.annobin_dict_transaction_memory.c.startup.annobin_dict_transaction_memory.c_end.startup.annobin_dict_transaction_memory.c.exit.annobin_dict_transaction_memory.c_end.exit.annobin_dict_transaction_memory_init.start.annobin_dict_transaction_memory_init.end.annobin_dict_transaction_memory_rollback.start.annobin_dict_transaction_memory_rollback.end.annobin_dict_transaction_memory_set.start.annobin_dict_transaction_memory_set.end.annobin_dict_transaction_memory_unset.start.annobin_dict_transaction_memory_unset.end.annobin_dict_transaction_memory_atomic_inc.start.annobin_dict_transaction_memory_atomic_inc.end.annobin_dns_lookup.c.annobin_dns_lookup.c_end.annobin_dns_lookup.c.hot.annobin_dns_lookup.c_end.hot.annobin_dns_lookup.c.unlikely.annobin_dns_lookup.c_end.unlikely.annobin_dns_lookup.c.startup.annobin_dns_lookup.c_end.startup.annobin_dns_lookup.c.exit.annobin_dns_lookup.c_end.exit.annobin_dns_client_connected.start.annobin_dns_client_connected.enddns_client_connected.annobin_dns_lookup_callback.start.annobin_dns_lookup_callback.enddns_lookup_callback.annobin_dns_client_destroy.start.annobin_dns_client_destroy.enddns_client_destroy.annobin_dns_client_init.start.annobin_dns_client_init.enddns_client_vfuncsdns_client_set.annobin_dns_client_deinit.start.annobin_dns_client_deinit.enddns_client_disconnect.part.5dns_client_deinit.cold.10.annobin_dns_lookup_free.start.annobin_dns_lookup_free.enddns_lookup_freedns_client_idle_timeout.annobin_dns_lookup_abort.start.annobin_dns_lookup_abort.end.annobin_dns_client_disconnect.part.5.start.annobin_dns_client_disconnect.part.5.end.annobin_dns_client_idle_timeout.start.annobin_dns_client_idle_timeout.enddns_client_idle_timeout.cold.11__func__.8293.annobin_dns_client_input_args.start.annobin_dns_client_input_args.enddns_client_input_args.annobin_dns_lookup_timeout.start.annobin_dns_lookup_timeout.enddns_lookup_timeout.annobin_dns_client_connect.start.annobin_dns_client_connect.end.annobin_dns_client_send_request.start.annobin_dns_client_send_request.enddns_client_send_request.annobin_dns_client_lookup_common.start.annobin_dns_client_lookup_common.enddns_client_lookup_commondns_client_lookup_common.cold.12.annobin_dns_client_lookup.start.annobin_dns_client_lookup.end.annobin_dns_lookup.start.annobin_dns_lookup.endevent_category_dns.annobin_dns_client_lookup_ptr.start.annobin_dns_client_lookup_ptr.end.annobin_dns_lookup_ptr.start.annobin_dns_lookup_ptr.end.annobin_dns_client_switch_ioloop.start.annobin_dns_client_switch_ioloop.end.annobin_dns_lookup_switch_ioloop.start.annobin_dns_lookup_switch_ioloop.end.annobin_dns_util.c.annobin_dns_util.c_end.annobin_dns_util.c.hot.annobin_dns_util.c_end.hot.annobin_dns_util.c.unlikely.annobin_dns_util.c_end.unlikely.annobin_dns_util.c.startup.annobin_dns_util.c_end.startup.annobin_dns_util.c.exit.annobin_dns_util.c_end.exit.annobin_dns_ncompare.start.annobin_dns_ncompare.end.annobin_dns_compare.start.annobin_dns_compare.end.annobin_dns_compare_labels.start.annobin_dns_compare_labels.end.annobin_dns_match_wildcard.start.annobin_dns_match_wildcard.enddns_match_wildcard.cold.1__func__.4558.annobin_imap_arg.c.annobin_imap_arg.c_end.annobin_imap_arg.c.hot.annobin_imap_arg.c_end.hot.annobin_imap_arg.c.unlikely.annobin_imap_arg.c_end.unlikely.annobin_imap_arg.c.startup.annobin_imap_arg.c_end.startup.annobin_imap_arg.c.exit.annobin_imap_arg.c_end.exit.annobin_imap_arg_get_atom.start.annobin_imap_arg_get_atom.end.annobin_imap_arg_get_quoted.start.annobin_imap_arg_get_quoted.end.annobin_imap_arg_get_string.start.annobin_imap_arg_get_string.end.annobin_imap_arg_get_astring.start.annobin_imap_arg_get_astring.end.annobin_imap_arg_get_nstring.start.annobin_imap_arg_get_nstring.end.annobin_imap_arg_get_literal_size.start.annobin_imap_arg_get_literal_size.end.annobin_imap_arg_get_list_full.start.annobin_imap_arg_get_list_full.endimap_arg_get_list_full.cold.2__func__.4861.annobin_imap_arg_get_list.start.annobin_imap_arg_get_list.end.annobin_imap_arg_as_astring.start.annobin_imap_arg_as_astring.endimap_arg_as_astring.cold.3.annobin_imap_arg_as_nstring.start.annobin_imap_arg_as_nstring.endimap_arg_as_nstring.cold.4.annobin_imap_arg_as_literal_size.start.annobin_imap_arg_as_literal_size.endimap_arg_as_literal_size.cold.5.annobin_imap_arg_as_list.start.annobin_imap_arg_as_list.endimap_arg_as_list.cold.6.annobin_imap_arg_atom_equals.start.annobin_imap_arg_atom_equals.end.annobin_imap_base_subject.c.annobin_imap_base_subject.c_end.annobin_imap_base_subject.c.hot.annobin_imap_base_subject.c_end.hot.annobin_imap_base_subject.c.unlikely.annobin_imap_base_subject.c_end.unlikely.annobin_imap_base_subject.c.startup.annobin_imap_base_subject.c_end.startup.annobin_imap_base_subject.c.exit.annobin_imap_base_subject.c_end.exit.annobin_remove_blob.start.annobin_remove_blob.endremove_blob.annobin_imap_get_base_subject_cased.start.annobin_imap_get_base_subject_cased.end.annobin_imap_bodystructure.c.annobin_imap_bodystructure.c_end.annobin_imap_bodystructure.c.hot.annobin_imap_bodystructure.c_end.hot.annobin_imap_bodystructure.c.unlikely.annobin_imap_bodystructure.c_end.unlikely.annobin_imap_bodystructure.c.startup.annobin_imap_bodystructure.c_end.startup.annobin_imap_bodystructure.c.exit.annobin_imap_bodystructure.c_end.exit.annobin_imap_bodystructure_reset_data.start.annobin_imap_bodystructure_reset_data.endimap_bodystructure_reset_data.annobin_str_append_nstring.start.annobin_str_append_nstring.endstr_append_nstring.annobin_imap_write_envelope_list.start.annobin_imap_write_envelope_list.endimap_write_envelope_listimap_write_envelope_list.cold.4.annobin_imap_parse_bodystructure_args.start.annobin_imap_parse_bodystructure_args.endimap_parse_bodystructure_argsimap_parse_bodystructure_args.cold.5.annobin_params_write.start.annobin_params_write.endparams_writeparams_write.cold.6__func__.5720.annobin_part_write_bodystructure_common.start.annobin_part_write_bodystructure_common.endpart_write_bodystructure_commonpart_write_bodystructure_common.cold.7__func__.5738.annobin_imap_bodystructure_params_parse.part.1.start.annobin_imap_bodystructure_params_parse.part.1.endimap_bodystructure_params_parse.part.1.annobin_imap_bodystructure_parse_args_common.isra.2.start.annobin_imap_bodystructure_parse_args_common.isra.2.endimap_bodystructure_parse_args_common.isra.2imap_bodystructure_parse_args_common.isra.2.cold.8.annobin_imap_bodystructure_write.start.annobin_imap_bodystructure_write.endpart_write_bodystructure_siblingsimap_bodystructure_write.cold.9__func__.5754__func__.5763__func__.5749.annobin_part_write_bodystructure_siblings.start.annobin_part_write_bodystructure_siblings.end.annobin_imap_bodystructure_parse_args.start.annobin_imap_bodystructure_parse_args.endimap_bodystructure_parse_args.localalias.3imap_bodystructure_parse_args.cold.10__func__.5840.annobin_imap_bodystructure_parse_full.start.annobin_imap_bodystructure_parse_full.endimap_bodystructure_parse_full.cold.11__func__.5857.annobin_imap_bodystructure_parse.start.annobin_imap_bodystructure_parse.endimap_bodystructure_parse.cold.12__func__.5865.annobin_imap_body_parse_from_bodystructure.start.annobin_imap_body_parse_from_bodystructure.end.annobin_imap_date.c.annobin_imap_date.c_end.annobin_imap_date.c.hot.annobin_imap_date.c_end.hot.annobin_imap_date.c.unlikely.annobin_imap_date.c_end.unlikely.annobin_imap_date.c.startup.annobin_imap_date.c_end.startup.annobin_imap_date.c.exit.annobin_imap_date.c_end.exit.annobin_imap_to_date_tm.start.annobin_imap_to_date_tm.endimap_to_date_tm.annobin_imap_to_datetime_tm.start.annobin_imap_to_datetime_tm.endimap_to_datetime_tm.annobin_imap_parse_date_internal.part.0.start.annobin_imap_parse_date_internal.part.0.endimap_parse_date_internal.part.0.annobin_imap_parse_date.start.annobin_imap_parse_date.end.annobin_imap_parse_datetime.start.annobin_imap_parse_datetime.end.annobin_imap_to_datetime.start.annobin_imap_to_datetime.end.annobin_imap_to_datetime_tz.start.annobin_imap_to_datetime_tz.end.annobin_imap_to_date.start.annobin_imap_to_date.end.annobin_imap_envelope.c.annobin_imap_envelope.c_end.annobin_imap_envelope.c.hot.annobin_imap_envelope.c_end.hot.annobin_imap_envelope.c.unlikely.annobin_imap_envelope.c_end.unlikely.annobin_imap_envelope.c.startup.annobin_imap_envelope.c_end.startup.annobin_imap_envelope.c.exit.annobin_imap_envelope.c_end.exit.annobin_imap_write_address.start.annobin_imap_write_address.endimap_write_address.annobin_imap_envelope_parse_addresses.start.annobin_imap_envelope_parse_addresses.endimap_envelope_parse_addresses.annobin_imap_envelope_write.start.annobin_imap_envelope_write.end.annobin_imap_envelope_parse_args.start.annobin_imap_envelope_parse_args.end.annobin_imap_envelope_parse.start.annobin_imap_envelope_parse.end.annobin_imap_id.c.annobin_imap_id.c_end.annobin_imap_id.c.hot.annobin_imap_id.c_end.hot.annobin_imap_id.c.unlikely.annobin_imap_id.c_end.unlikely.annobin_imap_id.c.startup.annobin_imap_id.c_end.startup.annobin_imap_id.c.exit.annobin_imap_id.c_end.exit.annobin_imap_id_reply_generate.start.annobin_imap_id_reply_generate.endutsname_setutsname_resultimap_id_reply_generate.cold.1.annobin_imap_id_log_reply_append.start.annobin_imap_id_log_reply_append.end.annobin_imap_id_args_get_log_reply.start.annobin_imap_id_args_get_log_reply.end.annobin_imap_keepalive.c.annobin_imap_keepalive.c_end.annobin_imap_keepalive.c.hot.annobin_imap_keepalive.c_end.hot.annobin_imap_keepalive.c.unlikely.annobin_imap_keepalive.c_end.unlikely.annobin_imap_keepalive.c.startup.annobin_imap_keepalive.c_end.startup.annobin_imap_keepalive.c.exit.annobin_imap_keepalive.c_end.exit.annobin_imap_keepalive_interval_msecs.start.annobin_imap_keepalive_interval_msecs.end.annobin_imap_match.c.annobin_imap_match.c_end.annobin_imap_match.c.hot.annobin_imap_match.c_end.hot.annobin_imap_match.c.unlikely.annobin_imap_match.c_end.unlikely.annobin_imap_match.c.startup.annobin_imap_match.c_end.startup.annobin_imap_match.c.exit.annobin_imap_match.c_end.exit.annobin_match_sub.start.annobin_match_sub.endmatch_sub.annobin_imap_match_init_multiple_real.start.annobin_imap_match_init_multiple_real.endimap_match_init_multiple_realinboximap_match_init_multiple_real.cold.6__func__.4969.annobin_imap_match_dup_real.start.annobin_imap_match_dup_real.endimap_match_dup_realimap_match_dup_real.cold.7.annobin_imap_match_init_multiple.start.annobin_imap_match_init_multiple.endimap_match_init_multiple.cold.8.annobin_imap_match_init.start.annobin_imap_match_init.end.annobin_imap_match_deinit.start.annobin_imap_match_deinit.end.annobin_imap_match_dup.start.annobin_imap_match_dup.endimap_match_dup.cold.9.annobin_imap_match_globs_equal.start.annobin_imap_match_globs_equal.end.annobin_imap_match.start.annobin_imap_match.end.annobin_imap_parser.c.annobin_imap_parser.c_end.annobin_imap_parser.c.hot.annobin_imap_parser.c_end.hot.annobin_imap_parser.c.unlikely.annobin_imap_parser.c_end.unlikely.annobin_imap_parser.c.startup.annobin_imap_parser.c_end.startup.annobin_imap_parser.c.exit.annobin_imap_parser.c_end.exit.annobin_is_valid_atom_char.start.annobin_is_valid_atom_char.endis_valid_atom_char.annobin_imap_parser_delete_extra_eol.start.annobin_imap_parser_delete_extra_eol.endimap_parser_delete_extra_eol.annobin_imap_parser_read_next_atom.start.annobin_imap_parser_read_next_atom.endimap_parser_read_next_atom.annobin_imap_parser_get_last_literal_size.start.annobin_imap_parser_get_last_literal_size.endimap_parser_get_last_literal_sizeimap_parser_get_last_literal_size.cold.10__func__.5940.annobin_imap_parser_strdup.isra.2.start.annobin_imap_parser_strdup.isra.2.endimap_parser_strdup.isra.2imap_parser_strdup.isra.2.cold.11.annobin_array_idx_i.isra.3.part.4.start.annobin_array_idx_i.isra.3.part.4.endarray_idx_i.isra.3.part.4__func__.5519.annobin_imap_parser_save_arg.start.annobin_imap_parser_save_arg.endimap_parser_save_argimap_parser_save_arg.cold.12__func__.5818.annobin_finish_line.isra.8.start.annobin_finish_line.isra.8.endfinish_line.isra.8finish_line.isra.8.cold.13__func__.5913.annobin_imap_parser_create.start.annobin_imap_parser_create.end.annobin_imap_parser_ref.start.annobin_imap_parser_ref.endimap_parser_ref.cold.14.annobin_imap_parser_unref.start.annobin_imap_parser_unref.endimap_parser_unref.cold.15__func__.5765.annobin_imap_parser_enable_literal_minus.start.annobin_imap_parser_enable_literal_minus.end.annobin_imap_parser_reset.start.annobin_imap_parser_reset.end.annobin_imap_parser_set_streams.start.annobin_imap_parser_set_streams.end.annobin_imap_parser_get_error.start.annobin_imap_parser_get_error.end.annobin_imap_parser_read_args.start.annobin_imap_parser_read_args.endimap_parser_read_args.cold.16__func__.5887.annobin_imap_parser_get_literal_size.start.annobin_imap_parser_get_literal_size.end.annobin_imap_parser_read_last_literal.start.annobin_imap_parser_read_last_literal.endimap_parser_read_last_literal.cold.17__func__.5955.annobin_imap_parser_finish_line.start.annobin_imap_parser_finish_line.end.annobin_imap_parser_read_word.start.annobin_imap_parser_read_word.end.annobin_imap_parser_read_tag.start.annobin_imap_parser_read_tag.end.annobin_imap_parser_read_command_name.start.annobin_imap_parser_read_command_name.endimap_parser_read_command_name.localalias.9.annobin_imap_parser_client_read_tag.start.annobin_imap_parser_client_read_tag.end.annobin_imap_quote.c.annobin_imap_quote.c_end.annobin_imap_quote.c.hot.annobin_imap_quote.c_end.hot.annobin_imap_quote.c.unlikely.annobin_imap_quote.c_end.unlikely.annobin_imap_quote.c.startup.annobin_imap_quote.c_end.startup.annobin_imap_quote.c.exit.annobin_imap_quote.c_end.exit.annobin_imap_append_literal.start.annobin_imap_append_literal.endimap_append_literal.annobin_imap_append_quoted.start.annobin_imap_append_quoted.end.annobin_imap_append_nstring.start.annobin_imap_append_nstring.end.annobin_imap_append_string.start.annobin_imap_append_string.endimap_append_string.cold.3__func__.4929.annobin_imap_append_astring.start.annobin_imap_append_astring.endimap_append_astring.cold.4__func__.4935.annobin_remove_newlines_and_append.start.annobin_remove_newlines_and_append.endremove_newlines_and_append.annobin_imap_append_nstring_nolf.start.annobin_imap_append_nstring_nolf.endimap_append_nstring_nolf.cold.5.annobin_imap_append_string_for_humans.start.annobin_imap_append_string_for_humans.endimap_append_string_for_humans.cold.6__func__.5021.annobin_imap_url.c.annobin_imap_url.c_end.annobin_imap_url.c.hot.annobin_imap_url.c_end.hot.annobin_imap_url.c.unlikely.annobin_imap_url.c_end.unlikely.annobin_imap_url.c.startup.annobin_imap_url.c_end.startup.annobin_imap_url.c.exit.annobin_imap_url.c_end.exit.annobin_imap_url_parse_number.isra.1.start.annobin_imap_url_parse_number.isra.1.endimap_url_parse_number.isra.1.annobin_imap_url_parse_offset.isra.3.start.annobin_imap_url_parse_offset.isra.3.endimap_url_parse_offset.isra.3.annobin_imap_url_parse.start.annobin_imap_url_parse.endimap_url_parse.cold.5__func__.6152__func__.6161.annobin_imap_url_create.start.annobin_imap_url_create.end.annobin_imap_url_add_urlauth.start.annobin_imap_url_add_urlauth.end.annobin_imap_seqset.c.annobin_imap_seqset.c_end.annobin_imap_seqset.c.hot.annobin_imap_seqset.c_end.hot.annobin_imap_seqset.c.unlikely.annobin_imap_seqset.c_end.unlikely.annobin_imap_seqset.c.startup.annobin_imap_seqset.c_end.startup.annobin_imap_seqset.c.exit.annobin_imap_seqset.c_end.exit.annobin_get_next_seq_range.start.annobin_get_next_seq_range.endget_next_seq_range.annobin_imap_seq_set_parse.start.annobin_imap_seq_set_parse.end.annobin_imap_seq_set_nostar_parse.start.annobin_imap_seq_set_nostar_parse.end.annobin_imap_seq_range_parse.start.annobin_imap_seq_range_parse.end.annobin_imap_utf7.c.annobin_imap_utf7.c_end.annobin_imap_utf7.c.hot.annobin_imap_utf7.c_end.hot.annobin_imap_utf7.c.unlikely.annobin_imap_utf7.c_end.unlikely.annobin_imap_utf7.c.startup.annobin_imap_utf7.c_end.startup.annobin_imap_utf7.c.exit.annobin_imap_utf7.c_end.exit.annobin_utf16buf_to_utf8.start.annobin_utf16buf_to_utf8.endutf16buf_to_utf8.annobin_imap_utf7_to_utf8_int.start.annobin_imap_utf7_to_utf8_int.endimap_utf7_to_utf8_intimap_b64dec.annobin_imap_escaped_utf8_hex_to_char.start.annobin_imap_escaped_utf8_hex_to_char.end.annobin_imap_utf8_to_utf7_int.start.annobin_imap_utf8_to_utf7_int.endimap_utf8_to_utf7_intimap_b64enc.annobin_imap_utf8_to_utf7.start.annobin_imap_utf8_to_utf7.end.annobin_imap_escaped_utf8_to_utf7.start.annobin_imap_escaped_utf8_to_utf7.endimap_escaped_utf8_to_utf7.cold.3__func__.4864.annobin_t_imap_utf8_to_utf7.start.annobin_t_imap_utf8_to_utf7.end.annobin_imap_utf7_to_utf8.start.annobin_imap_utf7_to_utf8.end.annobin_imap_utf7_to_utf8_escaped.start.annobin_imap_utf7_to_utf8_escaped.endimap_utf7_to_utf8_escaped.cold.4__func__.4917.annobin_imap_utf7_is_valid.start.annobin_imap_utf7_is_valid.endimap_utf7_is_valid.cold.5.annobin_imap_util.c.annobin_imap_util.c_end.annobin_imap_util.c.hot.annobin_imap_util.c_end.hot.annobin_imap_util.c.unlikely.annobin_imap_util.c_end.unlikely.annobin_imap_util.c.startup.annobin_imap_util.c_end.startup.annobin_imap_util.c.exit.annobin_imap_util.c_end.exit.annobin_imap_write_flags.start.annobin_imap_write_flags.end.annobin_imap_parse_system_flag.start.annobin_imap_parse_system_flag.end.annobin_imap_write_seq_range.start.annobin_imap_write_seq_range.end.annobin_imap_write_args.start.annobin_imap_write_args.end.annobin_imap_write_arg.start.annobin_imap_write_arg.endimap_write_arg.cold.3.annobin_imap_write_args_for_human.start.annobin_imap_write_args_for_human.endimap_write_args_for_human.localalias.2imap_write_args_for_human.cold.4.annobin_imap_args_to_str.start.annobin_imap_args_to_str.end.annobin_istream_attachment_connector.c.annobin_istream_attachment_connector.c_end.annobin_istream_attachment_connector.c.hot.annobin_istream_attachment_connector.c_end.hot.annobin_istream_attachment_connector.c.unlikely.annobin_istream_attachment_connector.c_end.unlikely.annobin_istream_attachment_connector.c.startup.annobin_istream_attachment_connector.c_end.startup.annobin_istream_attachment_connector.c.exit.annobin_istream_attachment_connector.c_end.exit.annobin_istream_attachment_connector_free.start.annobin_istream_attachment_connector_free.endistream_attachment_connector_free.annobin_istream_attachment_connector_begin.start.annobin_istream_attachment_connector_begin.end.annobin_istream_attachment_connector_add.start.annobin_istream_attachment_connector_add.end.annobin_istream_attachment_connector_finish.start.annobin_istream_attachment_connector_finish.endistream_attachment_connector_finish.cold.4__func__.5169.annobin_istream_attachment_connector_abort.start.annobin_istream_attachment_connector_abort.end.annobin_istream_attachment_extractor.c.annobin_istream_attachment_extractor.c_end.annobin_istream_attachment_extractor.c.hot.annobin_istream_attachment_extractor.c_end.hot.annobin_istream_attachment_extractor.c.unlikely.annobin_istream_attachment_extractor.c_end.unlikely.annobin_istream_attachment_extractor.c.startup.annobin_istream_attachment_extractor.c_end.startup.annobin_istream_attachment_extractor.c.exit.annobin_istream_attachment_extractor.c_end.exit.annobin_i_stream_attachment_extractor_close.start.annobin_i_stream_attachment_extractor_close.endi_stream_attachment_extractor_close.annobin_stream_add_data.part.2.start.annobin_stream_add_data.part.2.endstream_add_data.part.2.annobin_i_stream_read_more.part.4.start.annobin_i_stream_read_more.part.4.endi_stream_read_more.part.4.annobin_astream_try_base64_decode.part.7.start.annobin_astream_try_base64_decode.part.7.endastream_try_base64_decode.part.7astream_try_base64_decode.part.7.cold.10.annobin_astream_end_of_part.start.annobin_astream_end_of_part.endastream_end_of_part__func__.6353__func__.6325astream_end_of_part.cold.11.annobin_i_stream_attachment_extractor_read.start.annobin_i_stream_attachment_extractor_read.endi_stream_attachment_extractor_readi_stream_attachment_extractor_read.cold.12__func__.6298.annobin_i_stream_create_attachment_extractor.start.annobin_i_stream_create_attachment_extractor.endi_stream_create_attachment_extractor.cold.13__func__.6400.annobin_i_stream_attachment_extractor_can_retry.start.annobin_i_stream_attachment_extractor_can_retry.end.annobin_istream_binary_converter.c.annobin_istream_binary_converter.c_end.annobin_istream_binary_converter.c.hot.annobin_istream_binary_converter.c_end.hot.annobin_istream_binary_converter.c.unlikely.annobin_istream_binary_converter.c_end.unlikely.annobin_istream_binary_converter.c.startup.annobin_istream_binary_converter.c_end.startup.annobin_istream_binary_converter.c.exit.annobin_istream_binary_converter.c_end.exit.annobin_i_stream_binary_converter_close.start.annobin_i_stream_binary_converter_close.endi_stream_binary_converter_close.annobin_stream_finish_convert_decision.start.annobin_stream_finish_convert_decision.endstream_finish_convert_decisionstream_finish_convert_decision.cold.6__func__.5493.annobin_stream_add_data.start.annobin_stream_add_data.end.annobin_stream_add_hdr.start.annobin_stream_add_hdr.endstream_add_hdr.annobin_stream_encode_base64.start.annobin_stream_encode_base64.endstream_encode_base64stream_encode_base64.cold.7__func__.5514.annobin_i_stream_binary_converter_read.start.annobin_i_stream_binary_converter_read.endi_stream_binary_converter_readi_stream_binary_converter_read.cold.8__func__.5530.annobin_i_stream_create_binary_converter.start.annobin_i_stream_create_binary_converter.end.annobin_istream_dot.c.annobin_istream_dot.c_end.annobin_istream_dot.c.hot.annobin_istream_dot.c_end.hot.annobin_istream_dot.c.unlikely.annobin_istream_dot.c_end.unlikely.annobin_istream_dot.c.startup.annobin_istream_dot.c_end.startup.annobin_istream_dot.c.exit.annobin_istream_dot.c_end.exit.annobin_flush_pending.start.annobin_flush_pending.end.annobin_flush_dot_state.start.annobin_flush_dot_state.endflush_dot_state.annobin_i_stream_dot_return.isra.0.part.1.start.annobin_i_stream_dot_return.isra.0.part.1.endi_stream_dot_return.isra.0.part.1.annobin_i_stream_dot_read.start.annobin_i_stream_dot_read.endi_stream_dot_readi_stream_dot_read.cold.3__func__.5003__func__.5050.annobin_i_stream_create_dot.start.annobin_i_stream_create_dot.end.annobin_istream_header_filter.c.annobin_istream_header_filter.c_end.annobin_istream_header_filter.c.hot.annobin_istream_header_filter.c_end.hot.annobin_istream_header_filter.c.unlikely.annobin_istream_header_filter.c_end.unlikely.annobin_istream_header_filter.c.startup.annobin_istream_header_filter.c_end.startup.annobin_istream_header_filter.c.exit.annobin_istream_header_filter.c_end.exit.annobin_cmp_uint.start.annobin_cmp_uint.endcmp_uint.annobin_i_stream_header_filter_sync.start.annobin_i_stream_header_filter_sync.endi_stream_header_filter_sync.annobin_i_stream_header_filter_seek_to_header.start.annobin_i_stream_header_filter_seek_to_header.endi_stream_header_filter_seek_to_header.annobin_i_stream_header_filter_destroy.start.annobin_i_stream_header_filter_destroy.endi_stream_header_filter_destroy.annobin_add_eol.start.annobin_add_eol.endadd_eol.annobin_hdr_stream_update_pos.start.annobin_hdr_stream_update_pos.endhdr_stream_update_poshdr_stream_update_pos.cold.10__func__.5539.annobin_i_stream_header_filter_snapshot_free.start.annobin_i_stream_header_filter_snapshot_free.endi_stream_header_filter_snapshot_freei_stream_header_filter_snapshot_free.cold.11__func__.5621.annobin_skip_header.part.6.start.annobin_skip_header.part.6.endskip_header.part.6.annobin_hdr_buf_realloc_if_needed.part.7.start.annobin_hdr_buf_realloc_if_needed.part.7.endhdr_buf_realloc_if_needed.part.7.annobin_stream_reset_to.start.annobin_stream_reset_to.endstream_reset_to.annobin_handle_end_body_with_lf.start.annobin_handle_end_body_with_lf.endhandle_end_body_with_lfhandle_end_body_with_lf.cold.12__func__.5577.annobin_i_stream_header_filter_stat.start.annobin_i_stream_header_filter_stat.endi_stream_header_filter_stati_stream_header_filter_stat.cold.13__func__.5615.annobin_i_stream_header_filter_read.start.annobin_i_stream_header_filter_read.endi_stream_header_filter_readi_stream_header_filter_read.cold.14__func__.5553__func__.5518.annobin_i_stream_header_filter_seek.start.annobin_i_stream_header_filter_seek.endi_stream_header_filter_seek.annobin_i_stream_header_filter_snapshot.start.annobin_i_stream_header_filter_snapshot.endi_stream_header_filter_snapshot.annobin_i_stream_create_header_filter.start.annobin_i_stream_create_header_filter.endi_stream_create_header_filter.cold.15__func__.5640.annobin_i_stream_header_filter_add.start.annobin_i_stream_header_filter_add.end.annobin_istream_nonuls.c.annobin_istream_nonuls.c_end.annobin_istream_nonuls.c.hot.annobin_istream_nonuls.c_end.hot.annobin_istream_nonuls.c.unlikely.annobin_istream_nonuls.c_end.unlikely.annobin_istream_nonuls.c.startup.annobin_istream_nonuls.c_end.startup.annobin_istream_nonuls.c.exit.annobin_istream_nonuls.c_end.exit.annobin_i_stream_nonuls_read.start.annobin_i_stream_nonuls_read.endi_stream_nonuls_readi_stream_nonuls_read.cold.2__func__.5005__func__.4994.annobin_i_stream_create_nonuls.start.annobin_i_stream_create_nonuls.end.annobin_istream_qp_decoder.c.annobin_istream_qp_decoder.c_end.annobin_istream_qp_decoder.c.hot.annobin_istream_qp_decoder.c_end.hot.annobin_istream_qp_decoder.c.unlikely.annobin_istream_qp_decoder.c_end.unlikely.annobin_istream_qp_decoder.c.startup.annobin_istream_qp_decoder.c_end.startup.annobin_istream_qp_decoder.c.exit.annobin_istream_qp_decoder.c_end.exit.annobin_i_stream_qp_decoder_seek.start.annobin_i_stream_qp_decoder_seek.endi_stream_qp_decoder_seek.annobin_i_stream_qp_decoder_read.start.annobin_i_stream_qp_decoder_read.endi_stream_qp_decoder_readi_stream_qp_decoder_read.cold.1__func__.5177.annobin_i_stream_qp_decoder_close.start.annobin_i_stream_qp_decoder_close.endi_stream_qp_decoder_close.annobin_i_stream_create_qp_decoder.start.annobin_i_stream_create_qp_decoder.end.annobin_istream_qp_encoder.c.annobin_istream_qp_encoder.c_end.annobin_istream_qp_encoder.c.hot.annobin_istream_qp_encoder.c_end.hot.annobin_istream_qp_encoder.c.unlikely.annobin_istream_qp_encoder.c_end.unlikely.annobin_istream_qp_encoder.c.startup.annobin_istream_qp_encoder.c_end.startup.annobin_istream_qp_encoder.c.exit.annobin_istream_qp_encoder.c_end.exit.annobin_i_stream_qp_encoder_seek.start.annobin_i_stream_qp_encoder_seek.endi_stream_qp_encoder_seek.annobin_i_stream_qp_encoder_read.start.annobin_i_stream_qp_encoder_read.endi_stream_qp_encoder_readi_stream_qp_encoder_read.cold.1__func__.5160.annobin_i_stream_qp_encoder_close.start.annobin_i_stream_qp_encoder_close.endi_stream_qp_encoder_close.annobin_i_stream_create_qp_encoder.start.annobin_i_stream_create_qp_encoder.end.annobin_mail_html2text.c.annobin_mail_html2text.c_end.annobin_mail_html2text.c.hot.annobin_mail_html2text.c_end.hot.annobin_mail_html2text.c.unlikely.annobin_mail_html2text.c_end.unlikely.annobin_mail_html2text.c.startup.annobin_mail_html2text.c_end.startup.annobin_mail_html2text.c.exit.annobin_mail_html2text.c_end.exit.annobin_mail_html2text_add_space.start.annobin_mail_html2text_add_space.endmail_html2text_add_space.annobin_parse_data.start.annobin_parse_data.endparse_datahtml_entities.annobin_mail_html2text_init.start.annobin_mail_html2text_init.end.annobin_mail_html2text_more.start.annobin_mail_html2text_more.endmail_html2text_more.cold.1__func__.4975.annobin_mail_html2text_deinit.start.annobin_mail_html2text_deinit.end.annobin_mail_user_hash.c.annobin_mail_user_hash.c_end.annobin_mail_user_hash.c.hot.annobin_mail_user_hash.c_end.hot.annobin_mail_user_hash.c.unlikely.annobin_mail_user_hash.c_end.unlikely.annobin_mail_user_hash.c.startup.annobin_mail_user_hash.c_end.startup.annobin_mail_user_hash.c.exit.annobin_mail_user_hash.c_end.exit.annobin_mail_user_hash.start.annobin_mail_user_hash.endmail_user_hash.cold.2__func__.4831.annobin_mbox_from.c.annobin_mbox_from.c_end.annobin_mbox_from.c.hot.annobin_mbox_from.c_end.hot.annobin_mbox_from.c.unlikely.annobin_mbox_from.c_end.unlikely.annobin_mbox_from.c.startup.annobin_mbox_from.c_end.startup.annobin_mbox_from.c.exit.annobin_mbox_from.c_end.exit.annobin_mbox_parse_year.isra.0.start.annobin_mbox_parse_year.isra.0.endmbox_parse_year.isra.0.annobin_mbox_parse_month.isra.1.start.annobin_mbox_parse_month.isra.1.endmbox_parse_month.isra.1months.annobin_mbox_from_parse.start.annobin_mbox_from_parse.end.annobin_mbox_from_create.start.annobin_mbox_from_create.endweekdays.annobin_message_address.c.annobin_message_address.c_end.annobin_message_address.c.hot.annobin_message_address.c_end.hot.annobin_message_address.c.unlikely.annobin_message_address.c_end.unlikely.annobin_message_address.c.startup.annobin_message_address.c_end.startup.annobin_message_address.c.exit.annobin_message_address.c_end.exit.annobin_parse_domain.start.annobin_parse_domain.end.annobin_parse_local_part.start.annobin_parse_local_part.endparse_local_partparse_local_part.cold.7__func__.5253.annobin_parse_angle_addr.start.annobin_parse_angle_addr.endparse_angle_addrparse_angle_addr.cold.8__func__.5271.annobin_rfc822_parser_deinit.isra.1.part.2.start.annobin_rfc822_parser_deinit.isra.1.part.2.endrfc822_parser_deinit.isra.1.part.2__func__.5182.annobin_str_append_maybe_escape.start.annobin_str_append_maybe_escape.endstr_append_maybe_escape.annobin_add_address.start.annobin_add_address.endadd_address.annobin_add_fixed_address.start.annobin_add_fixed_address.endadd_fixed_address.annobin_parse_mailbox.start.annobin_parse_mailbox.endparse_mailbox.cold.9__func__.5280.annobin_message_address_parse_real.isra.3.start.annobin_message_address_parse_real.isra.3.endmessage_address_parse_real.isra.3message_address_parse_real.isra.3.cold.10.annobin_message_address_parse_path_real.start.annobin_message_address_parse_path_real.endmessage_address_parse_path_realmessage_address_parse_path_real.cold.11.annobin_message_address_parse_full.start.annobin_message_address_parse_full.endmessage_address_parse_full.cold.12.annobin_message_address_parse.start.annobin_message_address_parse.end.annobin_message_address_parse_path.start.annobin_message_address_parse_path.endmessage_address_parse_path.cold.13.annobin_message_address_write.start.annobin_message_address_write.endmessage_address_write.cold.14__func__.5363.annobin_message_address_to_string.start.annobin_message_address_to_string.end.annobin_message_address_first_to_string.start.annobin_message_address_first_to_string.end.annobin_message_address_init.start.annobin_message_address_init.end.annobin_message_address_init_from_smtp.start.annobin_message_address_init_from_smtp.end.annobin_message_header_is_address.start.annobin_message_header_is_address.endaddress_headers.annobin_message_binary_part.c.annobin_message_binary_part.c_end.annobin_message_binary_part.c.hot.annobin_message_binary_part.c_end.hot.annobin_message_binary_part.c.unlikely.annobin_message_binary_part.c_end.unlikely.annobin_message_binary_part.c.startup.annobin_message_binary_part.c_end.startup.annobin_message_binary_part.c.exit.annobin_message_binary_part.c_end.exit.annobin_message_binary_part_serialize.start.annobin_message_binary_part_serialize.end.annobin_message_binary_part_deserialize.start.annobin_message_binary_part_deserialize.end.annobin_message_date.c.annobin_message_date.c_end.annobin_message_date.c.hot.annobin_message_date.c_end.hot.annobin_message_date.c.unlikely.annobin_message_date.c_end.unlikely.annobin_message_date.c.startup.annobin_message_date.c_end.startup.annobin_message_date.c.exit.annobin_message_date.c_end.exit.annobin_next_token.start.annobin_next_token.endnext_token.annobin_message_date_parse.start.annobin_message_date_parse.endmessage_date_parse.cold.3__func__.4916.annobin_message_date_create.start.annobin_message_date_create.end.annobin_message_decoder.c.annobin_message_decoder.c_end.annobin_message_decoder.c.hot.annobin_message_decoder.c_end.hot.annobin_message_decoder.c.unlikely.annobin_message_decoder.c_end.unlikely.annobin_message_decoder.c.startup.annobin_message_decoder.c_end.startup.annobin_message_decoder.c.exit.annobin_message_decoder.c_end.exit.annobin_rfc822_parser_deinit.isra.2.part.3.start.annobin_rfc822_parser_deinit.isra.2.part.3.endrfc822_parser_deinit.isra.2.part.3__func__.5053.annobin_message_decode_body_init_charset.isra.4.start.annobin_message_decode_body_init_charset.isra.4.endmessage_decode_body_init_charset.isra.4.annobin_message_decoder_init.start.annobin_message_decoder_init.end.annobin_message_decoder_deinit.start.annobin_message_decoder_deinit.end.annobin_message_decoder_set_return_binary.start.annobin_message_decoder_set_return_binary.end.annobin_message_decoder_parse_cte.start.annobin_message_decoder_parse_cte.endmessage_decoder_parse_cte.cold.10.annobin_message_decoder_current_content_type.start.annobin_message_decoder_current_content_type.end.annobin_message_decoder_decode_reset.start.annobin_message_decoder_decode_reset.end.annobin_message_decoder_decode_next_block.start.annobin_message_decoder_decode_next_block.endmessage_decoder_decode_next_block.cold.11__func__.5374__func__.5354.annobin_message_header_decode.c.annobin_message_header_decode.c_end.annobin_message_header_decode.c.hot.annobin_message_header_decode.c_end.hot.annobin_message_header_decode.c.unlikely.annobin_message_header_decode.c_end.unlikely.annobin_message_header_decode.c.startup.annobin_message_header_decode.c_end.startup.annobin_message_header_decode.c.exit.annobin_message_header_decode.c_end.exit.annobin_decode_utf8_callback.start.annobin_decode_utf8_callback.enddecode_utf8_callback.annobin_message_header_decode.start.annobin_message_header_decode.endmessage_header_decode.cold.1__func__.4976.annobin_message_header_decode_utf8.start.annobin_message_header_decode_utf8.end.annobin_message_header_encode.c.annobin_message_header_encode.c_end.annobin_message_header_encode.c.hot.annobin_message_header_encode.c_end.hot.annobin_message_header_encode.c.unlikely.annobin_message_header_encode.c_end.unlikely.annobin_message_header_encode.c.startup.annobin_message_header_encode.c_end.startup.annobin_message_header_encode.c.exit.annobin_message_header_encode.c_end.exit.annobin_input_idx_need_encoding.start.annobin_input_idx_need_encoding.endinput_idx_need_encodinginput_idx_need_encoding.cold.2__func__.5016.annobin_message_header_encode_q.start.annobin_message_header_encode_q.endmessage_header_encode_q.cold.3__func__.5042.annobin_message_header_encode_b.start.annobin_message_header_encode_b.endmessage_header_encode_b.cold.4__func__.5071.annobin_message_header_encode_data.start.annobin_message_header_encode_data.endmessage_header_encode_data.cold.5__func__.5114.annobin_message_header_encode.start.annobin_message_header_encode.end.annobin_message_header_hash.c.annobin_message_header_hash.c_end.annobin_message_header_hash.c.hot.annobin_message_header_hash.c_end.hot.annobin_message_header_hash.c.unlikely.annobin_message_header_hash.c_end.unlikely.annobin_message_header_hash.c.startup.annobin_message_header_hash.c_end.startup.annobin_message_header_hash.c.exit.annobin_message_header_hash.c_end.exit.annobin_message_header_hash_more.start.annobin_message_header_hash_more.endmessage_header_hash_more.cold.0__func__.4684.annobin_message_header_parser.c.annobin_message_header_parser.c_end.annobin_message_header_parser.c.hot.annobin_message_header_parser.c_end.hot.annobin_message_header_parser.c.unlikely.annobin_message_header_parser.c_end.unlikely.annobin_message_header_parser.c.startup.annobin_message_header_parser.c_end.startup.annobin_message_header_parser.c.exit.annobin_message_header_parser.c_end.exit.annobin_message_parse_header_init.start.annobin_message_parse_header_init.end.annobin_message_parse_header_set_limit.start.annobin_message_parse_header_set_limit.end.annobin_message_parse_header_lower_limit.start.annobin_message_parse_header_lower_limit.end.annobin_message_parse_header_deinit.start.annobin_message_parse_header_deinit.end.annobin_message_parse_header_next.start.annobin_message_parse_header_next.end__func__.5218message_parse_header_next.cold.3__func__.4905.annobin_message_parse_header_has_nuls.start.annobin_message_parse_header_has_nuls.end.annobin_message_parse_header.start.annobin_message_parse_header.endmessage_parse_header.cold.4__func__.5258.annobin_message_header_line_write.start.annobin_message_header_line_write.end.annobin_message_header_strdup.start.annobin_message_header_strdup.endmessage_header_strdup.cold.5.annobin_message_header_name_is_valid.start.annobin_message_header_name_is_valid.end.annobin_message_id.c.annobin_message_id.c_end.annobin_message_id.c.hot.annobin_message_id.c_end.hot.annobin_message_id.c.unlikely.annobin_message_id.c_end.unlikely.annobin_message_id.c.startup.annobin_message_id.c_end.startup.annobin_message_id.c.exit.annobin_message_id.c_end.exit.annobin_message_id_get_next.start.annobin_message_id_get_next.endmessage_id_get_next.cold.1__func__.4804.annobin_message_parser.c.annobin_message_parser.c_end.annobin_message_parser.c.hot.annobin_message_parser.c_end.hot.annobin_message_parser.c.unlikely.annobin_message_parser.c_end.unlikely.annobin_message_parser.c.startup.annobin_message_parser.c_end.startup.annobin_message_parser.c.exit.annobin_message_parser.c_end.exit.annobin_message_part_append.start.annobin_message_part_append.endmessage_part_appendmessage_part_append.cold.17__func__.5526.annobin_parse_body_add_block.start.annobin_parse_body_add_block.endparse_body_add_blockparse_body_add_block.cold.18__func__.5505.annobin_message_part_finish.start.annobin_message_part_finish.endmessage_part_finishmessage_part_finish.cold.19__func__.5532.annobin_boundary_remove_until.isra.7.start.annobin_boundary_remove_until.isra.7.endboundary_remove_until.isra.7boundary_remove_until.isra.7.cold.20__func__.5541.annobin_rfc822_parser_deinit.isra.9.part.10.start.annobin_rfc822_parser_deinit.isra.9.part.10.endrfc822_parser_deinit.isra.9.part.10__func__.5241.annobin_boundary_line_find.start.annobin_boundary_line_find.endboundary_line_findboundary_line_find.cold.21__func__.5560.annobin_message_parser_read_more.start.annobin_message_parser_read_more.endmessage_parser_read_more.cold.22__func__.5516__func__.5120.annobin_parse_next_header.start.annobin_parse_next_header.endparse_next_body_to_boundaryparse_next_body_message_rfc822_initparse_next_body_to_eofparse_next_header.cold.23__func__.5637.annobin_parse_next_header_init.start.annobin_parse_next_header_init.endparse_next_header_init.cold.24__func__.5643.annobin_parse_next_body_message_rfc822_init.start.annobin_parse_next_body_message_rfc822_init.end.annobin_parse_next_mime_header_init.start.annobin_parse_next_mime_header_init.endparse_next_mime_header_init.annobin_parse_next_body_to_eof.start.annobin_parse_next_body_to_eof.end.annobin_parse_next_body_skip_boundary_line.start.annobin_parse_next_body_skip_boundary_line.endparse_next_body_skip_boundary_line.annobin_parse_part_finish.start.annobin_parse_part_finish.endparse_part_finishparse_part_finish.cold.25__func__.5584.annobin_parse_next_body_to_boundary.start.annobin_parse_next_body_to_boundary.endparse_next_body_to_boundary.cold.26__func__.5600.annobin_message_parser_init_int.start.annobin_message_parser_init_int.end.annobin_message_parser_init.start.annobin_message_parser_init.end.annobin_message_parser_deinit_from_parts.start.annobin_message_parser_deinit_from_parts.endmessage_parser_deinit_from_parts.cold.27__func__.5671.annobin_message_parser_deinit.start.annobin_message_parser_deinit.endmessage_parser_deinit.cold.28__func__.5660.annobin_message_parser_parse_next_block.start.annobin_message_parser_parse_next_block.endmessage_parser_parse_next_block.cold.29__func__.5679.annobin_message_parser_parse_header.start.annobin_message_parser_parse_header.endmessage_parser_parse_header.cold.30__func__.5697.annobin_message_parser_parse_body.start.annobin_message_parser_parse_body.endmessage_parser_parse_body.cold.31.annobin_message_parser_from_parts.c.annobin_message_parser_from_parts.c_end.annobin_message_parser_from_parts.c.hot.annobin_message_parser_from_parts.c_end.hot.annobin_message_parser_from_parts.c.unlikely.annobin_message_parser_from_parts.c_end.unlikely.annobin_message_parser_from_parts.c.startup.annobin_message_parser_from_parts.c_end.startup.annobin_message_parser_from_parts.c.exit.annobin_message_parser_from_parts.c_end.exit.annobin_preparsed_parse_eof.start.annobin_preparsed_parse_eof.endpreparsed_parse_eof.annobin_preparsed_skip_to_next.start.annobin_preparsed_skip_to_next.endpreparsed_skip_to_nextpreparsed_parse_next_header_initpreparsed_parse_epilogue_init.annobin_preparsed_parse_finish_header.start.annobin_preparsed_parse_finish_header.endpreparsed_parse_finish_headerpreparsed_parse_body_init.annobin_preparsed_parse_body_init.start.annobin_preparsed_parse_body_init.endpreparsed_parse_body_morepreparsed_parse_prologue_more.annobin_preparsed_parse_body_finish.start.annobin_preparsed_parse_body_finish.endpreparsed_parse_body_finish.annobin_preparsed_parse_prologue_more.start.annobin_preparsed_parse_prologue_more.endpreparsed_parse_prologue_finishpreparsed_parse_prologue_more.cold.1__func__.5052.annobin_preparsed_parse_body_more.start.annobin_preparsed_parse_body_more.end.annobin_preparsed_parse_epilogue_more.start.annobin_preparsed_parse_epilogue_more.endpreparsed_parse_epilogue_more.annobin_preparsed_parse_epilogue_boundary.start.annobin_preparsed_parse_epilogue_boundary.endpreparsed_parse_epilogue_boundary.annobin_preparsed_parse_epilogue_init.start.annobin_preparsed_parse_epilogue_init.end.annobin_preparsed_parse_next_header.start.annobin_preparsed_parse_next_header.endpreparsed_parse_next_headerpreparsed_parse_next_header.cold.2__func__.5093.annobin_preparsed_parse_next_header_init.start.annobin_preparsed_parse_next_header_init.endpreparsed_parse_next_header_init.cold.3__func__.5099.annobin_preparsed_parse_prologue_finish.start.annobin_preparsed_parse_prologue_finish.end.annobin_message_parser_init_from_parts.start.annobin_message_parser_init_from_parts.endmessage_parser_init_from_parts.cold.4__func__.5106.annobin_message_part.c.annobin_message_part.c_end.annobin_message_part.c.hot.annobin_message_part.c_end.hot.annobin_message_part.c.unlikely.annobin_message_part.c_end.unlikely.annobin_message_part.c.startup.annobin_message_part.c_end.startup.annobin_message_part.c.exit.annobin_message_part.c_end.exit.annobin_message_part_find.start.annobin_message_part_find.endmessage_part_find.annobin_message_part_to_idx.start.annobin_message_part_to_idx.endmessage_part_to_idx.cold.1.annobin_message_part_by_idx.start.annobin_message_part_by_idx.endmessage_part_by_idx.cold.2__func__.4585.annobin_message_part_is_equal.start.annobin_message_part_is_equal.endmessage_part_is_equal.localalias.0.annobin_message_part_data.c.annobin_message_part_data.c_end.annobin_message_part_data.c.hot.annobin_message_part_data.c_end.hot.annobin_message_part_data.c.unlikely.annobin_message_part_data.c_end.unlikely.annobin_message_part_data.c.startup.annobin_message_part_data.c_end.startup.annobin_message_part_data.c.exit.annobin_message_part_data.c_end.exit.annobin_rfc822_parser_deinit.isra.3.part.4.start.annobin_rfc822_parser_deinit.isra.3.part.4.endrfc822_parser_deinit.isra.3.part.4__func__.4948.annobin_parse_mime_parameters.start.annobin_parse_mime_parameters.endparse_mime_parametersparse_mime_parameters.cold.15__func__.5277.annobin_message_part_data_is_plain_7bit.start.annobin_message_part_data_is_plain_7bit.endmessage_part_data_is_plain_7bit.cold.16__func__.5198.annobin_message_part_data_get_filename.start.annobin_message_part_data_get_filename.endmessage_part_data_get_filename.cold.17__func__.5207.annobin_message_part_envelope_parse_from_header.start.annobin_message_part_envelope_parse_from_header.end.annobin_message_part_data_parse_from_header.start.annobin_message_part_data_parse_from_header.endmessage_part_data_parse_from_header.cold.18.annobin_message_part_has_content_types.start.annobin_message_part_has_content_types.endmessage_part_has_content_types.cold.19__func__.5355.annobin_message_part_has_parameter.start.annobin_message_part_has_parameter.endmessage_part_has_parameter.cold.20__func__.5366.annobin_message_part_is_attachment.start.annobin_message_part_is_attachment.endmessage_part_is_attachment.cold.21.annobin_message_part_serialize.c.annobin_message_part_serialize.c_end.annobin_message_part_serialize.c.hot.annobin_message_part_serialize.c_end.hot.annobin_message_part_serialize.c.unlikely.annobin_message_part_serialize.c_end.unlikely.annobin_message_part_serialize.c.startup.annobin_message_part_serialize.c_end.startup.annobin_message_part_serialize.c.exit.annobin_message_part_serialize.c_end.exit.annobin_part_serialize.start.annobin_part_serialize.endpart_serialize.cold.1__func__.4809.annobin_message_part_deserialize_part.start.annobin_message_part_deserialize_part.endmessage_part_deserialize_part.annobin_message_part_serialize.start.annobin_message_part_serialize.end.annobin_message_part_deserialize.start.annobin_message_part_deserialize.end.annobin_message_search.c.annobin_message_search.c_end.annobin_message_search.c.hot.annobin_message_search.c_end.hot.annobin_message_search.c.unlikely.annobin_message_search.c_end.unlikely.annobin_message_search.c.startup.annobin_message_search.c_end.startup.annobin_message_search.c.exit.annobin_message_search.c_end.exit.annobin_message_search_more_decoded2.start.annobin_message_search_more_decoded2.endmessage_search_more_decoded2crlf.5391.annobin_message_search_init.start.annobin_message_search_init.endmessage_search_init.cold.5__func__.5371.annobin_message_search_deinit.start.annobin_message_search_deinit.end.annobin_message_search_reset.start.annobin_message_search_reset.end.annobin_message_search_more_get_decoded.start.annobin_message_search_more_get_decoded.endmessage_search_more_get_decoded.cold.6.annobin_message_search_more.start.annobin_message_search_more.end.annobin_message_search_more_decoded.start.annobin_message_search_more_decoded.end.annobin_message_search_msg.start.annobin_message_search_msg.endmessage_search_msg.cold.7__func__.5429.annobin_message_size.c.annobin_message_size.c_end.annobin_message_size.c.hot.annobin_message_size.c_end.hot.annobin_message_size.c.unlikely.annobin_message_size.c_end.unlikely.annobin_message_size.c.startup.annobin_message_size.c_end.startup.annobin_message_size.c.exit.annobin_message_size.c_end.exit.annobin_i_stream_read_more.part.1.start.annobin_i_stream_read_more.part.1.endi_stream_read_more.part.1.annobin_message_get_header_size.start.annobin_message_get_header_size.end__func__.4980message_get_header_size.cold.2.annobin_message_get_body_size.start.annobin_message_get_body_size.end__func__.4991message_get_body_size.cold.3.annobin_message_size_add.start.annobin_message_size_add.end.annobin_message_skip_virtual.start.annobin_message_skip_virtual.endmessage_skip_virtual.cold.4__func__.5015.annobin_message_snippet.c.annobin_message_snippet.c_end.annobin_message_snippet.c.hot.annobin_message_snippet.c_end.hot.annobin_message_snippet.c.unlikely.annobin_message_snippet.c_end.unlikely.annobin_message_snippet.c.startup.annobin_message_snippet.c_end.startup.annobin_message_snippet.c.exit.annobin_message_snippet.c_end.exit.annobin_snippet_copy.start.annobin_snippet_copy.endsnippet_copy.annobin_message_snippet_generate.start.annobin_message_snippet_generate.endmessage_snippet_generate.cold.2__func__.5465__func__.5423.annobin_ostream_dot.c.annobin_ostream_dot.c_end.annobin_ostream_dot.c.hot.annobin_ostream_dot.c_end.hot.annobin_ostream_dot.c.unlikely.annobin_ostream_dot.c_end.unlikely.annobin_ostream_dot.c.startup.annobin_ostream_dot.c_end.startup.annobin_ostream_dot.c.exit.annobin_ostream_dot.c_end.exit.annobin_o_stream_dot_flush.start.annobin_o_stream_dot_flush.endo_stream_dot_flusho_stream_dot_flush.cold.5__func__.5393.annobin_o_stream_dot_close.start.annobin_o_stream_dot_close.endo_stream_dot_close.annobin_o_stream_dot_sendv.start.annobin_o_stream_dot_sendv.endo_stream_dot_sendvo_stream_dot_sendv.cold.6.annobin_o_stream_create_dot.start.annobin_o_stream_create_dot.end.annobin_qp_decoder.c.annobin_qp_decoder.c_end.annobin_qp_decoder.c.hot.annobin_qp_decoder.c_end.hot.annobin_qp_decoder.c.unlikely.annobin_qp_decoder.c_end.unlikely.annobin_qp_decoder.c.startup.annobin_qp_decoder.c_end.startup.annobin_qp_decoder.c.exit.annobin_qp_decoder.c_end.exit.annobin_qp_decoder_invalid.start.annobin_qp_decoder_invalid.endqp_decoder_invalidqp_decoder_invalid.cold.1__func__.4710.annobin_qp_decoder_init.start.annobin_qp_decoder_init.end.annobin_qp_decoder_deinit.start.annobin_qp_decoder_deinit.end.annobin_qp_decoder_more.start.annobin_qp_decoder_more.endqp_decoder_more.cold.2__func__.4693.annobin_qp_decoder_finish.start.annobin_qp_decoder_finish.end.annobin_qp_encoder.c.annobin_qp_encoder.c_end.annobin_qp_encoder.c.hot.annobin_qp_encoder.c_end.hot.annobin_qp_encoder.c.unlikely.annobin_qp_encoder.c_end.unlikely.annobin_qp_encoder.c.startup.annobin_qp_encoder.c_end.startup.annobin_qp_encoder.c.exit.annobin_qp_encoder.c_end.exit.annobin_qp_encoder_init.start.annobin_qp_encoder_init.endqp_encoder_init.cold.1__func__.5332.annobin_qp_encoder_deinit.start.annobin_qp_encoder_deinit.end.annobin_qp_encoder_more.start.annobin_qp_encoder_more.endqp_encoder_more.cold.2__func__.5349.annobin_qp_encoder_finish.start.annobin_qp_encoder_finish.end.annobin_quoted_printable.c.annobin_quoted_printable.c_end.annobin_quoted_printable.c.hot.annobin_quoted_printable.c_end.hot.annobin_quoted_printable.c.unlikely.annobin_quoted_printable.c_end.unlikely.annobin_quoted_printable.c.startup.annobin_quoted_printable.c_end.startup.annobin_quoted_printable.c.exit.annobin_quoted_printable.c_end.exit.annobin_quoted_printable_q_decode.start.annobin_quoted_printable_q_decode.end.annobin_rfc2231_parser.c.annobin_rfc2231_parser.c_end.annobin_rfc2231_parser.c.hot.annobin_rfc2231_parser.c_end.hot.annobin_rfc2231_parser.c.unlikely.annobin_rfc2231_parser.c_end.unlikely.annobin_rfc2231_parser.c.startup.annobin_rfc2231_parser.c_end.startup.annobin_rfc2231_parser.c.exit.annobin_rfc2231_parser.c_end.exit.annobin_rfc2231_parameter_cmp.start.annobin_rfc2231_parameter_cmp.endrfc2231_parameter_cmp.annobin_array_idx_i.isra.6.part.7.start.annobin_array_idx_i.isra.6.part.7.endarray_idx_i.isra.6.part.7.annobin_rfc2231_parse.start.annobin_rfc2231_parse.endrfc2231_parse.cold.8.annobin_rfc822_parser.c.annobin_rfc822_parser.c_end.annobin_rfc822_parser.c.hot.annobin_rfc822_parser.c_end.hot.annobin_rfc822_parser.c.unlikely.annobin_rfc822_parser.c_end.unlikely.annobin_rfc822_parser.c.startup.annobin_rfc822_parser.c_end.startup.annobin_rfc822_parser.c.exit.annobin_rfc822_parser.c_end.exit.annobin_rfc822_parser_init.start.annobin_rfc822_parser_init.end.annobin_rfc822_skip_comment.start.annobin_rfc822_skip_comment.endrfc822_skip_comment.cold.1__func__.4890.annobin_rfc822_skip_lwsp.start.annobin_rfc822_skip_lwsp.end.annobin_rfc822_parse_atom.start.annobin_rfc822_parse_atom.end.annobin_rfc822_parse_dot_atom.start.annobin_rfc822_parse_dot_atom.endrfc822_parse_dot_atom.cold.2__func__.4924.annobin_rfc822_parse_mime_token.start.annobin_rfc822_parse_mime_token.end.annobin_rfc822_parse_quoted_string.start.annobin_rfc822_parse_quoted_string.endrfc822_parse_quoted_string.cold.3__func__.4940.annobin_rfc822_parse_phrase.start.annobin_rfc822_parse_phrase.end.annobin_rfc822_parse_domain.start.annobin_rfc822_parse_domain.endrfc822_parse_domain.cold.4__func__.4971.annobin_rfc822_parse_content_type.start.annobin_rfc822_parse_content_type.end.annobin_rfc822_parse_content_param.start.annobin_rfc822_parse_content_param.end.annobin_mech_external.c.annobin_mech_external.c_end.annobin_mech_external.c.hot.annobin_mech_external.c_end.hot.annobin_mech_external.c.unlikely.annobin_mech_external.c_end.unlikely.annobin_mech_external.c.startup.annobin_mech_external.c_end.startup.annobin_mech_external.c.exit.annobin_mech_external.c_end.exit.annobin_mech_external_input.start.annobin_mech_external_input.endmech_external_input.annobin_mech_external_output.start.annobin_mech_external_output.endmech_external_output.annobin_mech_login.c.annobin_mech_login.c_end.annobin_mech_login.c.hot.annobin_mech_login.c_end.hot.annobin_mech_login.c.unlikely.annobin_mech_login.c_end.unlikely.annobin_mech_login.c.startup.annobin_mech_login.c_end.startup.annobin_mech_login.c.exit.annobin_mech_login.c_end.exit.annobin_mech_login_input.start.annobin_mech_login_input.endmech_login_input.annobin_mech_login_output.start.annobin_mech_login_output.endmech_login_output.annobin_mech_plain.c.annobin_mech_plain.c_end.annobin_mech_plain.c.hot.annobin_mech_plain.c_end.hot.annobin_mech_plain.c.unlikely.annobin_mech_plain.c_end.unlikely.annobin_mech_plain.c.startup.annobin_mech_plain.c_end.startup.annobin_mech_plain.c.exit.annobin_mech_plain.c_end.exit.annobin_mech_plain_input.start.annobin_mech_plain_input.endmech_plain_input.annobin_mech_plain_output.start.annobin_mech_plain_output.endmech_plain_output.annobin_mech_oauthbearer.c.annobin_mech_oauthbearer.c_end.annobin_mech_oauthbearer.c.hot.annobin_mech_oauthbearer.c_end.hot.annobin_mech_oauthbearer.c.unlikely.annobin_mech_oauthbearer.c_end.unlikely.annobin_mech_oauthbearer.c.startup.annobin_mech_oauthbearer.c_end.startup.annobin_mech_oauthbearer.c.exit.annobin_mech_oauthbearer.c_end.exit.annobin_mech_oauthbearer_output.start.annobin_mech_oauthbearer_output.endmech_oauthbearer_output.annobin_mech_xoauth2_output.start.annobin_mech_xoauth2_output.endmech_xoauth2_output.annobin_mech_oauthbearer_get_result.start.annobin_mech_oauthbearer_get_result.endmech_oauthbearer_get_resultmech_oauthbearer_get_result.cold.5__func__.6129.annobin_mech_oauthbearer_set_parameter.start.annobin_mech_oauthbearer_set_parameter.endmech_oauthbearer_set_parameter.annobin_mech_oauthbearer_input.start.annobin_mech_oauthbearer_input.endmech_oauthbearer_input.annobin_dsasl_client.c.annobin_dsasl_client.c_end.annobin_dsasl_client.c.hot.annobin_dsasl_client.c_end.hot.annobin_dsasl_client.c.unlikely.annobin_dsasl_client.c_end.unlikely.annobin_dsasl_client.c.startup.annobin_dsasl_client.c_end.startup.annobin_dsasl_client.c.exit.annobin_dsasl_client.c_end.exit.annobin_dsasl_client_mech_find_idx.start.annobin_dsasl_client_mech_find_idx.enddsasl_client_mech_find_idxdsasl_mechanisms.annobin_dsasl_client_mech_find.start.annobin_dsasl_client_mech_find.end.annobin_dsasl_client_mech_get_name.start.annobin_dsasl_client_mech_get_name.end.annobin_dsasl_client_mech_register.start.annobin_dsasl_client_mech_register.end.annobin_dsasl_client_mech_unregister.start.annobin_dsasl_client_mech_unregister.enddsasl_client_mech_unregister.cold.3.annobin_dsasl_client_new.start.annobin_dsasl_client_new.enddsasl_client_new.cold.4.annobin_dsasl_client_free.start.annobin_dsasl_client_free.end.annobin_dsasl_client_input.start.annobin_dsasl_client_input.end.annobin_dsasl_client_output.start.annobin_dsasl_client_output.end.annobin_dsasl_client_set_parameter.start.annobin_dsasl_client_set_parameter.enddsasl_client_set_parameter.cold.5__func__.4908.annobin_dsasl_client_get_result.start.annobin_dsasl_client_get_result.enddsasl_client_get_result.cold.6.annobin_dsasl_clients_init.start.annobin_dsasl_clients_init.endinit_refcount.annobin_dsasl_clients_deinit.start.annobin_dsasl_clients_deinit.end.annobin_auth_client.c.annobin_auth_client.c_end.annobin_auth_client.c.hot.annobin_auth_client.c_end.hot.annobin_auth_client.c.unlikely.annobin_auth_client.c_end.unlikely.annobin_auth_client.c.startup.annobin_auth_client.c_end.startup.annobin_auth_client.c.exit.annobin_auth_client.c_end.exit.annobin_auth_client_init.start.annobin_auth_client_init.end.annobin_auth_client_deinit.start.annobin_auth_client_deinit.end.annobin_auth_client_connect.start.annobin_auth_client_connect.end.annobin_auth_client_disconnect.start.annobin_auth_client_disconnect.end.annobin_auth_client_is_connected.start.annobin_auth_client_is_connected.end.annobin_auth_client_is_disconnected.start.annobin_auth_client_is_disconnected.end.annobin_auth_client_set_connect_timeout.start.annobin_auth_client_set_connect_timeout.end.annobin_auth_client_set_connect_notify.start.annobin_auth_client_set_connect_notify.end.annobin_auth_client_get_available_mechs.start.annobin_auth_client_get_available_mechs.endauth_client_get_available_mechs.cold.2__func__.6047.annobin_auth_client_find_mech.start.annobin_auth_client_find_mech.end.annobin_auth_client_get_connect_id.start.annobin_auth_client_get_connect_id.endauth_client_get_connect_id.cold.3__func__.6062.annobin_auth_client_request.c.annobin_auth_client_request.c_end.annobin_auth_client_request.c.hot.annobin_auth_client_request.c_end.hot.annobin_auth_client_request.c.unlikely.annobin_auth_client_request.c_end.unlikely.annobin_auth_client_request.c.startup.annobin_auth_client_request.c_end.startup.annobin_auth_client_request.c.exit.annobin_auth_client_request.c_end.exit.annobin_auth_client_request_free.start.annobin_auth_client_request_free.endauth_client_request_free.annobin_auth_client_request_new.start.annobin_auth_client_request_new.endauth_client_request_new.cold.7__func__.6621.annobin_auth_client_request_get_id.start.annobin_auth_client_request_get_id.end.annobin_auth_client_request_get_server_pid.start.annobin_auth_client_request_get_server_pid.end.annobin_auth_client_request_get_cookie.start.annobin_auth_client_request_get_cookie.end.annobin_auth_client_request_is_aborted.start.annobin_auth_client_request_is_aborted.end.annobin_auth_client_request_get_create_time.start.annobin_auth_client_request_get_create_time.end.annobin_auth_client_request_continue.start.annobin_auth_client_request_continue.end.annobin_auth_client_request_server_input.start.annobin_auth_client_request_server_input.endauth_client_request_server_input.cold.8.annobin_auth_client_send_cancel.start.annobin_auth_client_send_cancel.end.annobin_auth_client_request_abort.start.annobin_auth_client_request_abort.end.annobin_auth_client_connection.c.annobin_auth_client_connection.c_end.annobin_auth_client_connection.c.hot.annobin_auth_client_connection.c_end.hot.annobin_auth_client_connection.c.unlikely.annobin_auth_client_connection.c_end.unlikely.annobin_auth_client_connection.c.startup.annobin_auth_client_connection.c_end.startup.annobin_auth_client_connection.c.exit.annobin_auth_client_connection.c_end.exit.annobin_auth_client_connection_handshake_ready.start.annobin_auth_client_connection_handshake_ready.endauth_client_connection_handshake_ready.annobin_auth_server_lookup_request.start.annobin_auth_server_lookup_request.endauth_server_lookup_requestauth_server_lookup_request.cold.11.annobin_auth_client_connection_handshake_line.start.annobin_auth_client_connection_handshake_line.endauth_client_connection_handshake_line.annobin_auth_client_connection_connected.start.annobin_auth_client_connection_connected.endauth_client_connection_connectedauth_client_connection_connected.cold.12__func__.7918.annobin_auth_client_connection_list_init.start.annobin_auth_client_connection_list_init.endauth_client_connection_vfuncsauth_client_connection_set.annobin_auth_client_connection_init.start.annobin_auth_client_connection_init.end.annobin_auth_client_connection_disconnect.start.annobin_auth_client_connection_disconnect.endtemp_failure_args.7871.annobin_auth_client_connection_input_line.start.annobin_auth_client_connection_input_line.endauth_client_connection_input_line.annobin_auth_client_connection_reconnect.start.annobin_auth_client_connection_reconnect.endauth_client_connection_reconnectauth_server_reconnect_timeout.annobin_auth_client_handshake_timeout.start.annobin_auth_client_handshake_timeout.endauth_client_handshake_timeout.annobin_auth_client_connection_destroy.start.annobin_auth_client_connection_destroy.endauth_client_connection_destroy.annobin_auth_client_connection_deinit.start.annobin_auth_client_connection_deinit.endauth_client_connection_deinit.cold.13__func__.7908.annobin_auth_client_connection_connect.start.annobin_auth_client_connection_connect.endauth_client_connection_connect.cold.14__func__.7923.annobin_auth_server_reconnect_timeout.start.annobin_auth_server_reconnect_timeout.end.annobin_auth_client_connection_add_request.start.annobin_auth_client_connection_add_request.endauth_client_connection_add_request.cold.15.annobin_auth_client_connection_remove_request.start.annobin_auth_client_connection_remove_request.endauth_client_connection_remove_request.cold.16__func__.7938.annobin_auth_master.c.annobin_auth_master.c_end.annobin_auth_master.c.hot.annobin_auth_master.c_end.hot.annobin_auth_master.c.unlikely.annobin_auth_master.c_end.unlikely.annobin_auth_master.c.startup.annobin_auth_master.c_end.startup.annobin_auth_master.c.exit.annobin_auth_master.c_end.exit.annobin_auth_master_handshake_line.start.annobin_auth_master_handshake_line.endauth_master_handshake_line.annobin_auth_request_timeout.start.annobin_auth_request_timeout.endauth_request_timeout.annobin_auth_cache_flush_reply_callback.start.annobin_auth_cache_flush_reply_callback.endauth_cache_flush_reply_callback.annobin_auth_master_input_args.start.annobin_auth_master_input_args.endauth_master_input_args.annobin_auth_master_input_line.start.annobin_auth_master_input_line.endauth_master_input_line.annobin_auth_master_destroy.start.annobin_auth_master_destroy.endauth_master_destroy.annobin_auth_idle_timeout.start.annobin_auth_idle_timeout.endauth_idle_timeout.annobin_auth_user_list_reply_callback.start.annobin_auth_user_list_reply_callback.endauth_user_list_reply_callback.annobin_auth_master_connected.start.annobin_auth_master_connected.endauth_master_connectedauth_master_connected.cold.16__func__.8385.annobin_auth_master_event_create.isra.6.start.annobin_auth_master_event_create.isra.6.endauth_master_event_create.isra.6auth_master_event_create.isra.6.cold.17__func__.8446.annobin_auth_master_event_finish.start.annobin_auth_master_event_finish.endauth_master_event_finishauth_master_event_finish.cold.18__func__.8455.annobin_auth_master_user_event_create.start.annobin_auth_master_user_event_create.endauth_master_user_event_create.annobin_auth_master_unset_io.start.annobin_auth_master_unset_io.endauth_master_unset_ioauth_master_unset_io.cold.19.annobin_auth_master_run_cmd_pre.start.annobin_auth_master_run_cmd_pre.endauth_master_run_cmd_preauth_master_run_cmd_pre.cold.20__func__.8420.annobin_auth_master_run_cmd_post.start.annobin_auth_master_run_cmd_post.endauth_master_run_cmd_post.annobin_auth_master_run_cmd.start.annobin_auth_master_run_cmd.endauth_master_run_cmd.annobin_auth_lookup_reply_callback.start.annobin_auth_lookup_reply_callback.endauth_lookup_reply_callbackauth_lookup_reply_callback.cold.21__func__.5086.annobin_auth_master_init.start.annobin_auth_master_init.endauth_master_vfuncsauth_master_set.annobin_auth_master_deinit.start.annobin_auth_master_deinit.end.annobin_auth_master_set_timeout.start.annobin_auth_master_set_timeout.end.annobin_auth_master_get_socket_path.start.annobin_auth_master_get_socket_path.end.annobin_auth_user_info_export.start.annobin_auth_user_info_export.end.annobin_auth_master_user_lookup.start.annobin_auth_master_user_lookup.end.annobin_auth_user_fields_parse.start.annobin_auth_user_fields_parse.endauth_user_fields_parse.cold.22.annobin_auth_master_pass_lookup.start.annobin_auth_master_pass_lookup.end.annobin_auth_master_cache_flush.start.annobin_auth_master_cache_flush.end.annobin_auth_master_user_list_init.start.annobin_auth_master_user_list_init.end.annobin_auth_master_user_list_next.start.annobin_auth_master_user_list_next.endauth_master_user_list_next.cold.23.annobin_auth_master_user_list_deinit.start.annobin_auth_master_user_list_deinit.end__func__.8389.annobin_charset_iconv.c.annobin_charset_iconv.c_end.annobin_charset_iconv.c.hot.annobin_charset_iconv.c_end.hot.annobin_charset_iconv.c.unlikely.annobin_charset_iconv.c_end.unlikely.annobin_charset_iconv.c.startup.annobin_charset_iconv.c_end.startup.annobin_charset_iconv.c.exit.annobin_charset_iconv.c_end.exit.annobin_iconv_charset_to_utf8_reset.start.annobin_iconv_charset_to_utf8_reset.endiconv_charset_to_utf8_reset.annobin_iconv_charset_to_utf8_end.start.annobin_iconv_charset_to_utf8_end.endiconv_charset_to_utf8_end.annobin_charset_to_utf8_try.isra.0.start.annobin_charset_to_utf8_try.isra.0.endcharset_to_utf8_try.isra.0charset_to_utf8_try.isra.0.cold.2__func__.4909.annobin_iconv_charset_to_utf8.start.annobin_iconv_charset_to_utf8.endiconv_charset_to_utf8iconv_charset_to_utf8.cold.3__func__.4921.annobin_iconv_charset_to_utf8_begin.start.annobin_iconv_charset_to_utf8_begin.endiconv_charset_to_utf8_begin.annobin_charset_utf8.c.annobin_charset_utf8.c_end.annobin_charset_utf8.c.hot.annobin_charset_utf8.c_end.hot.annobin_charset_utf8.c.unlikely.annobin_charset_utf8.c_end.unlikely.annobin_charset_utf8.c.startup.annobin_charset_utf8.c_end.startup.annobin_charset_utf8.c.exit.annobin_charset_utf8.c_end.exit.annobin_charset_is_utf8.start.annobin_charset_is_utf8.end.annobin_charset_utf8_to_utf8.start.annobin_charset_utf8_to_utf8.endcharset_utf8_to_utf8.cold.0__func__.4973.annobin_charset_to_utf8_begin.start.annobin_charset_to_utf8_begin.end.annobin_charset_utf8_to_utf8_begin.start.annobin_charset_utf8_to_utf8_begin.endcharset_utf8_to_utf8_begin.cold.1.annobin_charset_to_utf8_end.start.annobin_charset_to_utf8_end.end.annobin_charset_to_utf8_reset.start.annobin_charset_to_utf8_reset.end.annobin_charset_to_utf8.start.annobin_charset_to_utf8.end.annobin_charset_to_utf8_str.start.annobin_charset_to_utf8_str.end.annobin_charset_utf8_only.c.annobin_charset_utf8_only.c_end.annobin_charset_utf8_only.c.hot.annobin_charset_utf8_only.c_end.hot.annobin_charset_utf8_only.c.unlikely.annobin_charset_utf8_only.c_end.unlikely.annobin_charset_utf8_only.c.startup.annobin_charset_utf8_only.c_end.startup.annobin_charset_utf8_only.c.exit.annobin_charset_utf8_only.c_end.exit.annobin_utf8only_charset_to_utf8_end.start.annobin_utf8only_charset_to_utf8_end.endutf8only_charset_to_utf8_end.annobin_utf8only_charset_to_utf8_reset.start.annobin_utf8only_charset_to_utf8_reset.endutf8only_charset_to_utf8_reset.annobin_utf8only_charset_to_utf8.start.annobin_utf8only_charset_to_utf8.endutf8only_charset_to_utf8.annobin_utf8only_charset_to_utf8_begin.start.annobin_utf8only_charset_to_utf8_begin.endutf8only_charset_to_utf8_begin.annobin_iostream_ssl.c.annobin_iostream_ssl.c_end.annobin_iostream_ssl.c.hot.annobin_iostream_ssl.c_end.hot.annobin_iostream_ssl.c.unlikely.annobin_iostream_ssl.c_end.unlikely.annobin_iostream_ssl.c.startup.annobin_iostream_ssl.c_end.startup.annobin_iostream_ssl.c.exit.annobin_iostream_ssl.c_end.exit.annobin_ssl_module_unload.start.annobin_ssl_module_unload.endssl_module_unloadssl_module.annobin_iostream_ssl_module_init.start.annobin_iostream_ssl_module_init.endssl_vfuncsssl_module_loaded.annobin_ssl_module_load.start.annobin_ssl_module_load.end.annobin_io_stream_ssl_global_init.start.annobin_io_stream_ssl_global_init.end.annobin_ssl_iostream_context_init_client.start.annobin_ssl_iostream_context_init_client.end.annobin_ssl_iostream_context_init_server.start.annobin_ssl_iostream_context_init_server.end.annobin_ssl_iostream_context_ref.start.annobin_ssl_iostream_context_ref.end.annobin_ssl_iostream_context_unref.start.annobin_ssl_iostream_context_unref.end.annobin_io_stream_create_ssl_client.start.annobin_io_stream_create_ssl_client.end.annobin_io_stream_create_ssl_server.start.annobin_io_stream_create_ssl_server.end.annobin_ssl_iostream_unref.start.annobin_ssl_iostream_unref.end.annobin_ssl_iostream_destroy.start.annobin_ssl_iostream_destroy.end.annobin_ssl_iostream_set_log_prefix.start.annobin_ssl_iostream_set_log_prefix.end.annobin_ssl_iostream_handshake.start.annobin_ssl_iostream_handshake.end.annobin_ssl_iostream_set_handshake_callback.start.annobin_ssl_iostream_set_handshake_callback.end.annobin_ssl_iostream_set_sni_callback.start.annobin_ssl_iostream_set_sni_callback.end.annobin_ssl_iostream_change_context.start.annobin_ssl_iostream_change_context.end.annobin_ssl_iostream_is_handshaked.start.annobin_ssl_iostream_is_handshaked.end.annobin_ssl_iostream_has_handshake_failed.start.annobin_ssl_iostream_has_handshake_failed.end.annobin_ssl_iostream_has_valid_client_cert.start.annobin_ssl_iostream_has_valid_client_cert.end.annobin_ssl_iostream_has_broken_client_cert.start.annobin_ssl_iostream_has_broken_client_cert.end.annobin_ssl_iostream_cert_match_name.start.annobin_ssl_iostream_cert_match_name.end.annobin_ssl_iostream_get_peer_name.start.annobin_ssl_iostream_get_peer_name.end.annobin_ssl_iostream_get_server_name.start.annobin_ssl_iostream_get_server_name.end.annobin_ssl_iostream_get_compression.start.annobin_ssl_iostream_get_compression.end.annobin_ssl_iostream_get_security_string.start.annobin_ssl_iostream_get_security_string.end.annobin_ssl_iostream_get_last_error.start.annobin_ssl_iostream_get_last_error.end.annobin_ssl_iostream_check_cert_validity.start.annobin_ssl_iostream_check_cert_validity.end.annobin_ssl_iostream_settings_init_from.start.annobin_ssl_iostream_settings_init_from.endssl_iostream_settings_string_offsets.annobin_ssl_iostream_settings_dup.start.annobin_ssl_iostream_settings_dup.end.annobin_ssl_iostream_settings_equals.start.annobin_ssl_iostream_settings_equals.end.annobin_ssl_iostream_settings_drop_stream_only.start.annobin_ssl_iostream_settings_drop_stream_only.end.annobin_ssl_iostream_get_cipher.start.annobin_ssl_iostream_get_cipher.end.annobin_ssl_iostream_get_pfs.start.annobin_ssl_iostream_get_pfs.end.annobin_ssl_iostream_get_protocol_name.start.annobin_ssl_iostream_get_protocol_name.end.annobin_iostream_ssl_context_cache.c.annobin_iostream_ssl_context_cache.c_end.annobin_iostream_ssl_context_cache.c.hot.annobin_iostream_ssl_context_cache.c_end.hot.annobin_iostream_ssl_context_cache.c.unlikely.annobin_iostream_ssl_context_cache.c_end.unlikely.annobin_iostream_ssl_context_cache.c.startup.annobin_iostream_ssl_context_cache.c_end.startup.annobin_iostream_ssl_context_cache.c.exit.annobin_iostream_ssl_context_cache.c_end.exit.annobin_ssl_iostream_context_cache_hash.start.annobin_ssl_iostream_context_cache_hash.endssl_iostream_context_cache_hash.annobin_ssl_iostream_context_cache_cmp.start.annobin_ssl_iostream_context_cache_cmp.endssl_iostream_context_cache_cmp.annobin_ssl_iostream_context_cache_get.start.annobin_ssl_iostream_context_cache_get.endssl_iostream_context_cache_getssl_iostream_contexts_poolssl_iostream_contexts.annobin_ssl_iostream_client_context_cache_get.start.annobin_ssl_iostream_client_context_cache_get.end.annobin_ssl_iostream_server_context_cache_get.start.annobin_ssl_iostream_server_context_cache_get.end.annobin_ssl_iostream_context_cache_free.start.annobin_ssl_iostream_context_cache_free.end.annobin_iostream_ssl_test.c.annobin_iostream_ssl_test.c_end.annobin_iostream_ssl_test.c.hot.annobin_iostream_ssl_test.c_end.hot.annobin_iostream_ssl_test.c.unlikely.annobin_iostream_ssl_test.c_end.unlikely.annobin_iostream_ssl_test.c.startup.annobin_iostream_ssl_test.c_end.startup.annobin_iostream_ssl_test.c.exit.annobin_iostream_ssl_test.c_end.exit.annobin_ssl_iostream_test_settings_server.start.annobin_ssl_iostream_test_settings_server.end.annobin_ssl_iostream_test_settings_client.start.annobin_ssl_iostream_test_settings_client.end.annobin_dcrypt.c.annobin_dcrypt.c_end.annobin_dcrypt.c.hot.annobin_dcrypt.c_end.hot.annobin_dcrypt.c.unlikely.annobin_dcrypt.c_end.unlikely.annobin_dcrypt.c.startup.annobin_dcrypt.c_end.startup.annobin_dcrypt.c.exit.annobin_dcrypt.c_end.exit.annobin_dcrypt_deinitialize.start.annobin_dcrypt_deinitialize.enddcrypt_moduledcrypt_vfs.annobin_dcrypt_initialize.start.annobin_dcrypt_initialize.enddcrypt_default_setdcrypt_initialize.cold.0__func__.5926.annobin_dcrypt_set_vfs.start.annobin_dcrypt_set_vfs.end.annobin_dcrypt_is_initialized.start.annobin_dcrypt_is_initialized.end.annobin_dcrypt_ctx_sym_create.start.annobin_dcrypt_ctx_sym_create.enddcrypt_ctx_sym_create.cold.1__func__.5942.annobin_dcrypt_ctx_sym_destroy.start.annobin_dcrypt_ctx_sym_destroy.enddcrypt_ctx_sym_destroy.cold.2.annobin_dcrypt_ctx_sym_set_key.start.annobin_dcrypt_ctx_sym_set_key.enddcrypt_ctx_sym_set_key.cold.3__func__.5952.annobin_dcrypt_ctx_sym_set_iv.start.annobin_dcrypt_ctx_sym_set_iv.enddcrypt_ctx_sym_set_iv.cold.4__func__.5958.annobin_dcrypt_ctx_sym_set_key_iv_random.start.annobin_dcrypt_ctx_sym_set_key_iv_random.enddcrypt_ctx_sym_set_key_iv_random.cold.5__func__.5962.annobin_dcrypt_ctx_sym_get_key.start.annobin_dcrypt_ctx_sym_get_key.enddcrypt_ctx_sym_get_key.cold.6__func__.5967.annobin_dcrypt_ctx_sym_get_iv.start.annobin_dcrypt_ctx_sym_get_iv.enddcrypt_ctx_sym_get_iv.cold.7__func__.5972.annobin_dcrypt_ctx_sym_get_key_length.start.annobin_dcrypt_ctx_sym_get_key_length.enddcrypt_ctx_sym_get_key_length.cold.8__func__.5976.annobin_dcrypt_ctx_sym_get_iv_length.start.annobin_dcrypt_ctx_sym_get_iv_length.enddcrypt_ctx_sym_get_iv_length.cold.9__func__.5980.annobin_dcrypt_ctx_sym_set_aad.start.annobin_dcrypt_ctx_sym_set_aad.enddcrypt_ctx_sym_set_aad.cold.10__func__.5986.annobin_dcrypt_ctx_sym_get_aad.start.annobin_dcrypt_ctx_sym_get_aad.enddcrypt_ctx_sym_get_aad.cold.11__func__.5991.annobin_dcrypt_ctx_sym_set_tag.start.annobin_dcrypt_ctx_sym_set_tag.enddcrypt_ctx_sym_set_tag.cold.12.annobin_dcrypt_ctx_sym_get_tag.start.annobin_dcrypt_ctx_sym_get_tag.enddcrypt_ctx_sym_get_tag.cold.13__func__.6002.annobin_dcrypt_ctx_sym_get_block_size.start.annobin_dcrypt_ctx_sym_get_block_size.enddcrypt_ctx_sym_get_block_size.cold.14__func__.6006.annobin_dcrypt_ctx_sym_init.start.annobin_dcrypt_ctx_sym_init.enddcrypt_ctx_sym_init.cold.15__func__.6011.annobin_dcrypt_ctx_sym_update.start.annobin_dcrypt_ctx_sym_update.enddcrypt_ctx_sym_update.cold.16__func__.6019.annobin_dcrypt_ctx_sym_final.start.annobin_dcrypt_ctx_sym_final.enddcrypt_ctx_sym_final.cold.17__func__.6025.annobin_dcrypt_ctx_sym_set_padding.start.annobin_dcrypt_ctx_sym_set_padding.enddcrypt_ctx_sym_set_padding.cold.18__func__.6030.annobin_dcrypt_ctx_hmac_create.start.annobin_dcrypt_ctx_hmac_create.enddcrypt_ctx_hmac_create.cold.19__func__.6036.annobin_dcrypt_ctx_hmac_destroy.start.annobin_dcrypt_ctx_hmac_destroy.enddcrypt_ctx_hmac_destroy.cold.20__func__.6040.annobin_dcrypt_ctx_hmac_set_key.start.annobin_dcrypt_ctx_hmac_set_key.enddcrypt_ctx_hmac_set_key.cold.21__func__.6046.annobin_dcrypt_ctx_hmac_get_key.start.annobin_dcrypt_ctx_hmac_get_key.enddcrypt_ctx_hmac_get_key.cold.22__func__.6051.annobin_dcrypt_ctx_hmac_set_key_random.start.annobin_dcrypt_ctx_hmac_set_key_random.enddcrypt_ctx_hmac_set_key_random.cold.23__func__.6055.annobin_dcrypt_ctx_hmac_get_digest_length.start.annobin_dcrypt_ctx_hmac_get_digest_length.enddcrypt_ctx_hmac_get_digest_length.cold.24__func__.6059.annobin_dcrypt_ctx_hmac_init.start.annobin_dcrypt_ctx_hmac_init.enddcrypt_ctx_hmac_init.cold.25__func__.6064.annobin_dcrypt_ctx_hmac_update.start.annobin_dcrypt_ctx_hmac_update.enddcrypt_ctx_hmac_update.cold.26__func__.6071.annobin_dcrypt_ctx_hmac_final.start.annobin_dcrypt_ctx_hmac_final.enddcrypt_ctx_hmac_final.cold.27__func__.6077.annobin_dcrypt_ecdh_derive_secret.start.annobin_dcrypt_ecdh_derive_secret.enddcrypt_ecdh_derive_secret.cold.28__func__.6084.annobin_dcrypt_ecdh_derive_secret_local.start.annobin_dcrypt_ecdh_derive_secret_local.enddcrypt_ecdh_derive_secret_local.cold.29__func__.6091.annobin_dcrypt_ecdh_derive_secret_peer.start.annobin_dcrypt_ecdh_derive_secret_peer.enddcrypt_ecdh_derive_secret_peer.cold.30__func__.6098.annobin_dcrypt_pbkdf2.start.annobin_dcrypt_pbkdf2.enddcrypt_pbkdf2.cold.31__func__.6110.annobin_dcrypt_keypair_generate.start.annobin_dcrypt_keypair_generate.enddcrypt_keypair_generate.cold.32__func__.6118.annobin_dcrypt_key_load_private.start.annobin_dcrypt_key_load_private.enddcrypt_key_load_private.cold.33__func__.6126.annobin_dcrypt_key_load_public.start.annobin_dcrypt_key_load_public.enddcrypt_key_load_public.cold.34__func__.6132.annobin_dcrypt_key_store_private.start.annobin_dcrypt_key_store_private.enddcrypt_key_store_private.cold.35__func__.6142.annobin_dcrypt_key_store_public.start.annobin_dcrypt_key_store_public.enddcrypt_key_store_public.cold.36__func__.6149.annobin_dcrypt_key_convert_private_to_public.start.annobin_dcrypt_key_convert_private_to_public.enddcrypt_key_convert_private_to_public.cold.37__func__.6154.annobin_dcrypt_key_string_get_info.start.annobin_dcrypt_key_string_get_info.enddcrypt_key_string_get_info.cold.38__func__.6165.annobin_dcrypt_key_type_private.start.annobin_dcrypt_key_type_private.enddcrypt_key_type_private.cold.39__func__.6169.annobin_dcrypt_key_type_public.start.annobin_dcrypt_key_type_public.enddcrypt_key_type_public.cold.40__func__.6173.annobin_dcrypt_key_id_public.start.annobin_dcrypt_key_id_public.enddcrypt_key_id_public.cold.41__func__.6180.annobin_dcrypt_key_id_public_old.start.annobin_dcrypt_key_id_public_old.enddcrypt_key_id_public_old.cold.42__func__.6186.annobin_dcrypt_key_id_private.start.annobin_dcrypt_key_id_private.enddcrypt_key_id_private.cold.43__func__.6193.annobin_dcrypt_key_id_private_old.start.annobin_dcrypt_key_id_private_old.enddcrypt_key_id_private_old.cold.44__func__.6199.annobin_dcrypt_keypair_unref.start.annobin_dcrypt_keypair_unref.enddcrypt_keypair_unref.cold.45__func__.6203.annobin_dcrypt_key_ref_public.start.annobin_dcrypt_key_ref_public.enddcrypt_key_ref_public.cold.46__func__.6207.annobin_dcrypt_key_ref_private.start.annobin_dcrypt_key_ref_private.enddcrypt_key_ref_private.cold.47__func__.6211.annobin_dcrypt_key_unref_public.start.annobin_dcrypt_key_unref_public.enddcrypt_key_unref_public.cold.48__func__.6215.annobin_dcrypt_key_unref_private.start.annobin_dcrypt_key_unref_private.enddcrypt_key_unref_private.cold.49__func__.6219.annobin_dcrypt_rsa_encrypt.start.annobin_dcrypt_rsa_encrypt.enddcrypt_rsa_encrypt.cold.50__func__.6228.annobin_dcrypt_rsa_decrypt.start.annobin_dcrypt_rsa_decrypt.enddcrypt_rsa_decrypt.cold.51__func__.6237.annobin_dcrypt_oid2name.start.annobin_dcrypt_oid2name.enddcrypt_oid2name.cold.52__func__.6243.annobin_dcrypt_name2oid.start.annobin_dcrypt_name2oid.enddcrypt_name2oid.cold.53__func__.6249.annobin_dcrypt_key_store_private_raw.start.annobin_dcrypt_key_store_private_raw.enddcrypt_key_store_private_raw.cold.54__func__.6257.annobin_dcrypt_key_store_public_raw.start.annobin_dcrypt_key_store_public_raw.enddcrypt_key_store_public_raw.cold.55__func__.6265.annobin_dcrypt_key_load_private_raw.start.annobin_dcrypt_key_load_private_raw.enddcrypt_key_load_private_raw.cold.56__func__.6272.annobin_dcrypt_key_load_public_raw.start.annobin_dcrypt_key_load_public_raw.enddcrypt_key_load_public_raw.cold.57__func__.6279.annobin_dcrypt_key_get_curve_public.start.annobin_dcrypt_key_get_curve_public.enddcrypt_key_get_curve_public.cold.58__func__.6285.annobin_dcrypt_key_get_id_public.start.annobin_dcrypt_key_get_id_public.enddcrypt_key_get_id_public.cold.59__func__.6289.annobin_dcrypt_key_get_id_private.start.annobin_dcrypt_key_get_id_private.enddcrypt_key_get_id_private.cold.60__func__.6293.annobin_dcrypt_key_set_id_public.start.annobin_dcrypt_key_set_id_public.enddcrypt_key_set_id_public.cold.61.annobin_dcrypt_key_set_id_private.start.annobin_dcrypt_key_set_id_private.enddcrypt_key_set_id_private.cold.62__func__.6303.annobin_dcrypt_key_get_usage_public.start.annobin_dcrypt_key_get_usage_public.enddcrypt_key_get_usage_public.cold.63__func__.6307.annobin_dcrypt_key_get_usage_private.start.annobin_dcrypt_key_get_usage_private.enddcrypt_key_get_usage_private.cold.64__func__.6311.annobin_dcrypt_key_set_usage_public.start.annobin_dcrypt_key_set_usage_public.enddcrypt_key_set_usage_public.cold.65__func__.6316.annobin_dcrypt_key_set_usage_private.start.annobin_dcrypt_key_set_usage_private.enddcrypt_key_set_usage_private.cold.66.annobin_dcrypt_sign.start.annobin_dcrypt_sign.enddcrypt_sign.cold.67__func__.6332.annobin_dcrypt_verify.start.annobin_dcrypt_verify.enddcrypt_verify.cold.68__func__.6345.annobin_parse_jwk_key.start.annobin_parse_jwk_key.endparse_jwk_key.cold.69__func__.6361.annobin_istream_decrypt.c.annobin_istream_decrypt.c_end.annobin_istream_decrypt.c.hot.annobin_istream_decrypt.c_end.hot.annobin_istream_decrypt.c.unlikely.annobin_istream_decrypt.c_end.unlikely.annobin_istream_decrypt.c.startup.annobin_istream_decrypt.c_end.startup.annobin_istream_decrypt.c.exit.annobin_istream_decrypt.c_end.exit.annobin_i_stream_create_decrypt_common.start.annobin_i_stream_create_decrypt_common.endi_stream_create_decrypt_commoni_stream_decrypt_readi_stream_decrypt_snapshoti_stream_decrypt_seeki_stream_decrypt_closei_stream_decrypt_destroyi_stream_create_decrypt_common.cold.4__func__.6348.annobin_i_stream_decrypt_destroy.start.annobin_i_stream_decrypt_destroy.end.annobin_i_stream_decrypt_close.start.annobin_i_stream_decrypt_close.end.annobin_i_stream_decrypt_der.start.annobin_i_stream_decrypt_der.endi_stream_decrypt_der.annobin_i_stream_decrypt_snapshot_free.start.annobin_i_stream_decrypt_snapshot_free.endi_stream_decrypt_snapshot_freei_stream_decrypt_snapshot_free.cold.5__func__.6333.annobin_i_stream_decrypt_realloc_buf_if_needed.part.1.start.annobin_i_stream_decrypt_realloc_buf_if_needed.part.1.endi_stream_decrypt_realloc_buf_if_needed.part.1.annobin_i_stream_decrypt_read.start.annobin_i_stream_decrypt_read.endIOSTREAM_CRYPT_MAGICi_stream_decrypt_read.cold.6__func__.6310.annobin_i_stream_decrypt_seek.start.annobin_i_stream_decrypt_seek.endi_stream_decrypt_seek.cold.7.annobin_i_stream_decrypt_snapshot.start.annobin_i_stream_decrypt_snapshot.end.annobin_i_stream_encrypt_get_format.start.annobin_i_stream_encrypt_get_format.end.annobin_i_stream_encrypt_get_flags.start.annobin_i_stream_encrypt_get_flags.end.annobin_i_stream_create_decrypt.start.annobin_i_stream_create_decrypt.end.annobin_i_stream_create_sym_decrypt.start.annobin_i_stream_create_sym_decrypt.end.annobin_i_stream_create_decrypt_callback.start.annobin_i_stream_create_decrypt_callback.endi_stream_create_decrypt_callback.cold.8__func__.6367.annobin_ostream_encrypt.c.annobin_ostream_encrypt.c_end.annobin_ostream_encrypt.c.hot.annobin_ostream_encrypt.c_end.hot.annobin_ostream_encrypt.c.unlikely.annobin_ostream_encrypt.c_end.unlikely.annobin_ostream_encrypt.c.startup.annobin_ostream_encrypt.c_end.startup.annobin_ostream_encrypt.c.exit.annobin_ostream_encrypt.c_end.exit.annobin_o_stream_encrypt_destroy.start.annobin_o_stream_encrypt_destroy.endo_stream_encrypt_destroy.annobin_o_stream_encrypt_close.start.annobin_o_stream_encrypt_close.endo_stream_encrypt_closeo_stream_encrypt_close.cold.3__func__.6360.annobin_o_stream_encrypt_send.start.annobin_o_stream_encrypt_send.endo_stream_encrypt_send.annobin_o_stream_encrypt_flush.start.annobin_o_stream_encrypt_flush.endo_stream_encrypt_flusho_stream_encrypt_flush.cold.4__func__.6350.annobin_o_stream_encrypt_sendv.start.annobin_o_stream_encrypt_sendv.endo_stream_encrypt_sendvo_stream_encrypt_sendv.cold.5__func__.6261__func__.6329__func__.6254.annobin_o_stream_create_encrypt.start.annobin_o_stream_create_encrypt.endo_stream_create_encrypt.cold.6__func__.6297.annobin_o_stream_create_sym_encrypt.start.annobin_o_stream_create_sym_encrypt.end.annobin_fuzzer.c.annobin_fuzzer.c_end.annobin_fuzzer.c.hot.annobin_fuzzer.c_end.hot.annobin_fuzzer.c.unlikely.annobin_fuzzer.c_end.unlikely.annobin_fuzzer.c.startup.annobin_fuzzer.c_end.startup.annobin_fuzzer.c.exit.annobin_fuzzer.c_end.exit.annobin_pump_finished.start.annobin_pump_finished.endpump_finished.cold.0.annobin_fuzzer_init.start.annobin_fuzzer_init.end.annobin_fuzzer_deinit.start.annobin_fuzzer_deinit.end.annobin_fuzzer_io_as_fd.start.annobin_fuzzer_io_as_fd.endfuzzer_io_as_fd.cold.1.annobin_ostream_final_trickle.c.annobin_ostream_final_trickle.c_end.annobin_ostream_final_trickle.c.hot.annobin_ostream_final_trickle.c_end.hot.annobin_ostream_final_trickle.c.unlikely.annobin_ostream_final_trickle.c_end.unlikely.annobin_ostream_final_trickle.c.startup.annobin_ostream_final_trickle.c_end.startup.annobin_ostream_final_trickle.c.exit.annobin_ostream_final_trickle.c_end.exit.annobin_o_stream_final_trickle_switch_ioloop_to.start.annobin_o_stream_final_trickle_switch_ioloop_to.endo_stream_final_trickle_switch_ioloop_to.annobin_o_stream_final_trickle_get_buffer_used_size.start.annobin_o_stream_final_trickle_get_buffer_used_size.endo_stream_final_trickle_get_buffer_used_size.annobin_o_stream_final_trickle_flush.start.annobin_o_stream_final_trickle_flush.endo_stream_final_trickle_flush.annobin_o_stream_final_trickle_close.start.annobin_o_stream_final_trickle_close.endo_stream_final_trickle_close.annobin_o_stream_final_trickle_flush_buffer.part.0.start.annobin_o_stream_final_trickle_flush_buffer.part.0.endo_stream_final_trickle_flush_buffer.part.0.annobin_o_stream_final_trickle_sendv.start.annobin_o_stream_final_trickle_sendv.endo_stream_final_trickle_sendvo_stream_final_trickle_timeout__func__.5145o_stream_final_trickle_sendv.cold.3.annobin_o_stream_final_trickle_timeout.start.annobin_o_stream_final_trickle_timeout.endo_stream_final_trickle_timeout.cold.4__func__.5133.annobin_o_stream_create_final_trickle.start.annobin_o_stream_create_final_trickle.end.annobin_test_common.c.annobin_test_common.c_end.annobin_test_common.c.hot.annobin_test_common.c_end.hot.annobin_test_common.c.unlikely.annobin_test_common.c_end.unlikely.annobin_test_common.c.startup.annobin_test_common.c_end.startup.annobin_test_common.c.exit.annobin_test_common.c_end.exit.annobin_test_init.start.annobin_test_init.endtest_prefixfailure_counttotal_counttest_deinit_libtest_error_handler.annobin_test_run_funcs.start.annobin_test_run_funcs.endtest_run_funcstest_run_funcs.cold.4.annobin_test_run_named_funcs.start.annobin_test_run_named_funcs.endtest_run_named_funcstest_run_named_funcs.cold.5.annobin_test_deinit.start.annobin_test_deinit.endtest_deinittest_deinit.cold.6__func__.5336.annobin_test_has_failed.start.annobin_test_has_failed.endtest_success.annobin_test_assert_failed.start.annobin_test_assert_failed.end.annobin_test_begin.start.annobin_test_begin.endexpecting_fatalexpected_errorstest_begin.cold.7.annobin_expect_error_check.part.1.start.annobin_expect_error_check.part.1.endexpect_error_check.part.1expect_error_check.part.1.cold.8.annobin_test_error_handler.start.annobin_test_error_handler.endexpected_error_str.annobin_test_fatal_handler.start.annobin_test_fatal_handler.endtest_fatal_handlerexpected_fatal_strtest_fatal_callbacktest_fatal_contextfatal_jmpbuftest_fatal_handler.cold.9__func__.5327.annobin_test_assert_failed_idx.start.annobin_test_assert_failed_idx.end.annobin_test_assert_failed_strcmp_idx.start.annobin_test_assert_failed_strcmp_idx.end.annobin_test_assert_failed_cmp_intmax_idx.start.annobin_test_assert_failed_cmp_intmax_idx.end.annobin_test_assert_failed_ucmp_intmax_idx.start.annobin_test_assert_failed_ucmp_intmax_idx.end.annobin_test_out_reason.start.annobin_test_out_reason.end.annobin_test_out.start.annobin_test_out.end.annobin_test_end.start.annobin_test_end.endtest_end.cold.10__func__.5266.annobin_run_one_fatal.start.annobin_run_one_fatal.endrun_one_fatalindex.5358run_one_fatal.cold.11.annobin_test_out_quiet.start.annobin_test_out_quiet.end.annobin_test_expect_error_string_n_times.start.annobin_test_expect_error_string_n_times.endtest_expect_error_string_n_times.cold.12__func__.5288.annobin_test_expect_error_string.start.annobin_test_expect_error_string.end.annobin_test_expect_errors.start.annobin_test_expect_errors.endtest_expect_errors.cold.13__func__.5295.annobin_test_expect_no_more_errors.start.annobin_test_expect_no_more_errors.end.annobin_test_expect_fatal_string.start.annobin_test_expect_fatal_string.end.annobin_test_fatal_set_callback.start.annobin_test_fatal_set_callback.endtest_fatal_set_callback.cold.14__func__.5321.annobin_test_run.start.annobin_test_run.end.annobin_test_run_named.start.annobin_test_run_named.end.annobin_test_run_with_fatals.start.annobin_test_run_with_fatals.endtest_run_with_fatals.cold.15.annobin_test_run_named_with_fatals.start.annobin_test_run_named_with_fatals.endtest_run_named_with_fatals.cold.16.annobin_test_forked_end.start.annobin_test_forked_end.end.annobin_test_exit.start.annobin_test_exit.end.annobin_test_istream.c.annobin_test_istream.c_end.annobin_test_istream.c.hot.annobin_test_istream.c_end.hot.annobin_test_istream.c.unlikely.annobin_test_istream.c_end.unlikely.annobin_test_istream.c.startup.annobin_test_istream.c_end.startup.annobin_test_istream.c.exit.annobin_test_istream.c_end.exit.annobin_test_buffer_free.start.annobin_test_buffer_free.endtest_buffer_free.annobin_test_seek.start.annobin_test_seek.endtest_seek.annobin_test_read.start.annobin_test_read.endtest_readtest_read.cold.2__func__.5141.annobin_test_istream_find.part.0.start.annobin_test_istream_find.part.0.endtest_istream_find.part.0.annobin_test_istream_create_data.start.annobin_test_istream_create_data.end.annobin_test_istream_create.start.annobin_test_istream_create.end.annobin_test_istream_set_allow_eof.start.annobin_test_istream_set_allow_eof.end.annobin_test_istream_set_max_buffer_size.start.annobin_test_istream_set_max_buffer_size.end.annobin_test_istream_set_size.start.annobin_test_istream_set_size.end.annobin_test_ostream.c.annobin_test_ostream.c_end.annobin_test_ostream.c.hot.annobin_test_ostream.c_end.hot.annobin_test_ostream.c.unlikely.annobin_test_ostream.c_end.unlikely.annobin_test_ostream.c.startup.annobin_test_ostream.c_end.startup.annobin_test_ostream.c.exit.annobin_test_ostream.c_end.exit.annobin_o_stream_test_get_buffer_used_size.start.annobin_o_stream_test_get_buffer_used_size.endo_stream_test_get_buffer_used_size.annobin_o_stream_test_flush.start.annobin_o_stream_test_flush.endo_stream_test_flush.annobin_test_ostream_send_more.start.annobin_test_ostream_send_more.endtest_ostream_send_more.annobin_o_stream_test_destroy.start.annobin_o_stream_test_destroy.endo_stream_test_destroy.annobin_test_ostream_set_send_more_timeout.start.annobin_test_ostream_set_send_more_timeout.endtest_ostream_set_send_more_timeout.annobin_o_stream_test_flush_pending.start.annobin_o_stream_test_flush_pending.endo_stream_test_flush_pendingo_stream_test_flush_pending.cold.4__func__.5404.annobin_o_stream_test_sendv.start.annobin_o_stream_test_sendv.endo_stream_test_sendv.annobin_test_ostream_create.start.annobin_test_ostream_create.end.annobin_test_ostream_create_nonblocking.start.annobin_test_ostream_create_nonblocking.end.annobin_test_ostream_set_max_output_size.start.annobin_test_ostream_set_max_output_size.end.annobin_test_subprocess.c.annobin_test_subprocess.c_end.annobin_test_subprocess.c.hot.annobin_test_subprocess.c_end.hot.annobin_test_subprocess.c.unlikely.annobin_test_subprocess.c_end.unlikely.annobin_test_subprocess.c.startup.annobin_test_subprocess.c_end.startup.annobin_test_subprocess.c.exit.annobin_test_subprocess.c_end.exit.annobin_test_subprocess_alarm.start.annobin_test_subprocess_alarm.endtest_subprocess_alarm.annobin_test_subprocess_free_all.start.annobin_test_subprocess_free_all.endtest_subprocess_free_alltest_subprocesses.annobin_test_subprocess_signal.start.annobin_test_subprocess_signal.endtest_subprocess_signal.annobin_test_subprocess_notification_signal.start.annobin_test_subprocess_notification_signal.endtest_subprocess_notification_signaltest_subprocess_notification_signal_receivedtest_subprocess_notification_signal.cold.10__func__.6644.annobin_test_subprocess_kill_forced.isra.5.start.annobin_test_subprocess_kill_forced.isra.5.endtest_subprocess_kill_forced.isra.5test_subprocess_kill_forced.isra.5.cold.11__func__.6557.annobin_test_subprocess_cleanup.part.7.start.annobin_test_subprocess_cleanup.part.7.endtest_subprocess_cleanup.part.7test_subprocess_cleanup_callback.annobin_test_atexit.start.annobin_test_atexit.endtest_atexit.annobin_test_subprocess_terminate.start.annobin_test_subprocess_terminate.endtest_subprocess_terminate.annobin_test_subprocess_fork.start.annobin_test_subprocess_fork.endtest_subprocess_eventtest_subprocess_fork.cold.12.annobin_test_subprocess_kill_all.start.annobin_test_subprocess_kill_all.endtest_subprocess_kill_all.cold.13__func__.6585.annobin_test_subprocess_set_cleanup_callback.start.annobin_test_subprocess_set_cleanup_callback.end.annobin_test_subprocess_notify_signal_send.start.annobin_test_subprocess_notify_signal_send.endtest_subprocess_notify_signal_send.cold.14.annobin_test_subprocess_notify_signal_send_parent.start.annobin_test_subprocess_notify_signal_send_parent.end.annobin_test_subprocess_notify_signal_reset.start.annobin_test_subprocess_notify_signal_reset.endtest_subprocess_notify_signal_reset.cold.15__func__.6629.annobin_test_subprocess_notify_signal_wait.start.annobin_test_subprocess_notify_signal_wait.endtest_subprocess_notify_signal_wait.cold.16.annobin_test_subprocesses_init.start.annobin_test_subprocesses_init.endtest_subprocess_lib_init.annobin_test_subprocesses_deinit.start.annobin_test_subprocesses_deinit.end.annobin_array.c.annobin_array.c_end.annobin_array.c.hot.annobin_array.c_end.hot.annobin_array.c.unlikely.annobin_array.c_end.unlikely.annobin_array.c.startup.annobin_array.c_end.startup.annobin_array.c.exit.annobin_array.c_end.exit.annobin_array_idx_modifiable_i.start.annobin_array_idx_modifiable_i.endarray_idx_modifiable_i.cold.2.annobin_array_idx_get_space_i.start.annobin_array_idx_get_space_i.end.annobin_array_idx_set_i.start.annobin_array_idx_set_i.end.annobin_array_idx_clear_i.start.annobin_array_idx_clear_i.end.annobin_array_insert_space_i.start.annobin_array_insert_space_i.end.annobin_array_cmp_i.start.annobin_array_cmp_i.end.annobin_array_equal_fn_i.start.annobin_array_equal_fn_i.endarray_equal_fn_i.cold.3__func__.4805.annobin_array_equal_fn_ctx_i.start.annobin_array_equal_fn_ctx_i.endarray_equal_fn_ctx_i.cold.4__func__.4822.annobin_array_reverse_i.start.annobin_array_reverse_i.end.annobin_array_sort_i.start.annobin_array_sort_i.end.annobin_array_bsearch_i.start.annobin_array_bsearch_i.end.annobin_array_lsearch_i.start.annobin_array_lsearch_i.end.annobin_aqueue.c.annobin_aqueue.c_end.annobin_aqueue.c.hot.annobin_aqueue.c_end.hot.annobin_aqueue.c.unlikely.annobin_aqueue.c_end.unlikely.annobin_aqueue.c.startup.annobin_aqueue.c_end.startup.annobin_aqueue.c.exit.annobin_aqueue.c_end.exit.annobin_array_copy.isra.2.part.3.start.annobin_array_copy.isra.2.part.3.endarray_copy.isra.2.part.3.annobin_aqueue_init.start.annobin_aqueue_init.endaqueue_init.cold.5__func__.4796.annobin_aqueue_deinit.start.annobin_aqueue_deinit.end.annobin_aqueue_append.start.annobin_aqueue_append.endaqueue_append.cold.6__func__.4806.annobin_aqueue_clear.start.annobin_aqueue_clear.end.annobin_aqueue_count.start.annobin_aqueue_count.end.annobin_aqueue_delete.start.annobin_aqueue_delete.endaqueue_delete.cold.7__func__.4818.annobin_aqueue_delete_tail.start.annobin_aqueue_delete_tail.end.annobin_askpass.c.annobin_askpass.c_end.annobin_askpass.c.hot.annobin_askpass.c_end.hot.annobin_askpass.c.unlikely.annobin_askpass.c_end.unlikely.annobin_askpass.c.startup.annobin_askpass.c_end.startup.annobin_askpass.c.exit.annobin_askpass.c_end.exit.annobin_askpass_str.start.annobin_askpass_str.endaskpass_str__func__.6231askpass_str.cold.0.annobin_askpass.start.annobin_askpass.end.annobin_t_askpass.start.annobin_t_askpass.end.annobin_backtrace_string.c.annobin_backtrace_string.c_end.annobin_backtrace_string.c.hot.annobin_backtrace_string.c_end.hot.annobin_backtrace_string.c.unlikely.annobin_backtrace_string.c_end.unlikely.annobin_backtrace_string.c.startup.annobin_backtrace_string.c_end.startup.annobin_backtrace_string.c.exit.annobin_backtrace_string.c_end.exit.annobin_backtrace_append.start.annobin_backtrace_append.end.annobin_backtrace_get.start.annobin_backtrace_get.end.annobin_base32.c.annobin_base32.c_end.annobin_base32.c.hot.annobin_base32.c_end.hot.annobin_base32.c.unlikely.annobin_base32.c_end.unlikely.annobin_base32.c.startup.annobin_base32.c_end.startup.annobin_base32.c.exit.annobin_base32.c_end.exit.annobin_base32_decode_with_alphabet.start.annobin_base32_decode_with_alphabet.endbase32_decode_with_alphabetbase32_decode_with_alphabet.cold.0.annobin_base32_encode_with_alphabet.start.annobin_base32_encode_with_alphabet.endbase32_encode_with_alphabet.annobin_base32_encode.start.annobin_base32_encode.endb32enc.annobin_base32hex_encode.start.annobin_base32hex_encode.endb32hexenc.annobin_base32_decode.start.annobin_base32_decode.endb32dec.annobin_base32hex_decode.start.annobin_base32hex_decode.endb32hexdec.annobin_t_base32_decode_str.start.annobin_t_base32_decode_str.end.annobin_t_base32hex_decode_str.start.annobin_t_base32hex_decode_str.end.annobin_base32_is_valid_char.start.annobin_base32_is_valid_char.end.annobin_base32hex_is_valid_char.start.annobin_base32hex_is_valid_char.end.annobin_base64.c.annobin_base64.c_end.annobin_base64.c.hot.annobin_base64.c_end.hot.annobin_base64.c.unlikely.annobin_base64.c_end.unlikely.annobin_base64.c.startup.annobin_base64.c_end.startup.annobin_base64.c.exit.annobin_base64.c_end.exit.annobin_base64_encode_get_out_size.isra.2.start.annobin_base64_encode_get_out_size.isra.2.endbase64_encode_get_out_size.isra.2base64_encode_get_out_size.isra.2.cold.5__func__.4851.annobin_base64_get_full_encoded_size.start.annobin_base64_get_full_encoded_size.endbase64_get_full_encoded_size.cold.6__func__.4844.annobin_base64_encode_get_size.start.annobin_base64_encode_get_size.endbase64_encode_get_size.cold.7__func__.4874.annobin_base64_encode_get_full_space.start.annobin_base64_encode_get_full_space.endbase64_encode_get_full_space.cold.8__func__.4882.annobin_base64_encode_more.start.annobin_base64_encode_more.endbase64_encode_more.cold.9__func__.4937__func__.4911.annobin_base64_encode_finish.start.annobin_base64_encode_finish.end__func__.4960base64_encode_finish.cold.10.annobin_base64_decode_more.start.annobin_base64_decode_more.endbase64_decode_more.cold.11.annobin_base64_decode_finish.start.annobin_base64_decode_finish.endbase64_decode_finish.cold.12.annobin_t_base64_scheme_encode.start.annobin_t_base64_scheme_encode.end.annobin_base64_scheme_decode.start.annobin_base64_scheme_decode.end.annobin_t_base64_scheme_decode.start.annobin_t_base64_scheme_decode.end.annobin_bits.c.annobin_bits.c_end.annobin_bits.c.hot.annobin_bits.c_end.hot.annobin_bits.c.unlikely.annobin_bits.c_end.unlikely.annobin_bits.c.startup.annobin_bits.c_end.startup.annobin_bits.c.exit.annobin_bits.c_end.exit.annobin_nearest_power.start.annobin_nearest_power.endnearest_power.cold.0__func__.4508.annobin_bsearch_insert_pos.c.annobin_bsearch_insert_pos.c_end.annobin_bsearch_insert_pos.c.hot.annobin_bsearch_insert_pos.c_end.hot.annobin_bsearch_insert_pos.c.unlikely.annobin_bsearch_insert_pos.c_end.unlikely.annobin_bsearch_insert_pos.c.startup.annobin_bsearch_insert_pos.c_end.startup.annobin_bsearch_insert_pos.c.exit.annobin_bsearch_insert_pos.c_end.exit.annobin_bsearch_insert_pos.start.annobin_bsearch_insert_pos.endbsearch_insert_pos.cold.2__func__.4797.annobin_array_bsearch_insert_pos_i.start.annobin_array_bsearch_insert_pos_i.end.annobin_buffer.c.annobin_buffer.c_end.annobin_buffer.c.hot.annobin_buffer.c_end.hot.annobin_buffer.c.unlikely.annobin_buffer.c_end.unlikely.annobin_buffer.c.startup.annobin_buffer.c_end.startup.annobin_buffer.c.exit.annobin_buffer.c_end.exit.annobin_buffer_check_limits.part.1.start.annobin_buffer_check_limits.part.1.endbuffer_check_limits.part.1__func__.4662.annobin_buffer_alloc.start.annobin_buffer_alloc.endbuffer_alloc.cold.5__func__.4653.annobin_buffer_create_from_data.start.annobin_buffer_create_from_data.end.annobin_buffer_create_from_const_data.start.annobin_buffer_create_from_const_data.end.annobin_buffer_create_dynamic_max.start.annobin_buffer_create_dynamic_max.end.annobin_buffer_create_dynamic.start.annobin_buffer_create_dynamic.end.annobin_buffer_free.start.annobin_buffer_free.end.annobin_buffer_free_without_data.start.annobin_buffer_free_without_data.end.annobin_buffer_get_pool.start.annobin_buffer_get_pool.end.annobin_buffer_write.start.annobin_buffer_write.endbuffer_write.cold.6.annobin_buffer_append.start.annobin_buffer_append.endbuffer_append.cold.7.annobin_buffer_append_c.start.annobin_buffer_append_c.endbuffer_append_c.cold.8.annobin_buffer_write_zero.start.annobin_buffer_write_zero.endbuffer_write_zero.cold.9.annobin_buffer_append_zero.start.annobin_buffer_append_zero.endbuffer_append_zero.cold.10.annobin_buffer_copy.start.annobin_buffer_copy.endbuffer_copy.cold.11__func__.4774.annobin_buffer_insert.start.annobin_buffer_insert.end.annobin_buffer_insert_zero.start.annobin_buffer_insert_zero.end.annobin_buffer_append_buf.start.annobin_buffer_append_buf.end.annobin_buffer_get_space_unsafe.start.annobin_buffer_get_space_unsafe.endbuffer_get_space_unsafe.cold.12.annobin_buffer_append_space_unsafe.start.annobin_buffer_append_space_unsafe.end.annobin_buffer_get_modifiable_data.start.annobin_buffer_get_modifiable_data.endbuffer_get_modifiable_data.cold.13.annobin_buffer_set_used_size.start.annobin_buffer_set_used_size.endbuffer_set_used_size.cold.14__func__.4802.annobin_buffer_delete.start.annobin_buffer_delete.end.annobin_buffer_replace.start.annobin_buffer_replace.end.annobin_buffer_get_size.start.annobin_buffer_get_size.end.annobin_buffer_get_writable_size.start.annobin_buffer_get_writable_size.end.annobin_buffer_get_avail_size.start.annobin_buffer_get_avail_size.endbuffer_get_avail_size.cold.15__func__.4815.annobin_buffer_cmp.start.annobin_buffer_cmp.end.annobin_buffer_verify_pool.start.annobin_buffer_verify_pool.endbuffer_verify_pool.cold.16__func__.4825.annobin_buffer_truncate_rshift_bits.start.annobin_buffer_truncate_rshift_bits.end__func__.4680.annobin_buffer_istream.c.annobin_buffer_istream.c_end.annobin_buffer_istream.c.hot.annobin_buffer_istream.c_end.hot.annobin_buffer_istream.c.unlikely.annobin_buffer_istream.c_end.unlikely.annobin_buffer_istream.c.startup.annobin_buffer_istream.c_end.startup.annobin_buffer_istream.c.exit.annobin_buffer_istream.c_end.exit.annobin_buffer_append_full_istream.start.annobin_buffer_append_full_istream.endbuffer_append_full_istream.cold.2__func__.4956__func__.4923.annobin_buffer_append_full_file.start.annobin_buffer_append_full_file.endbuffer_append_full_file.cold.3__func__.4965.annobin_child_wait.c.annobin_child_wait.c_end.annobin_child_wait.c.hot.annobin_child_wait.c_end.hot.annobin_child_wait.c.unlikely.annobin_child_wait.c_end.unlikely.annobin_child_wait.c.startup.annobin_child_wait.c_end.startup.annobin_child_wait.c.exit.annobin_child_wait.c_end.exit.annobin_child_wait_free.start.annobin_child_wait_free.endchild_pidschild_wait_free.cold.3.annobin_child_wait_add_pid.start.annobin_child_wait_add_pid.endsigchld_handler.annobin_child_wait_new_with_pid.start.annobin_child_wait_new_with_pid.end.annobin_child_wait_remove_pid.start.annobin_child_wait_remove_pid.endchild_wait_remove_pid.cold.4.annobin_sigchld_handler.start.annobin_sigchld_handler.end.annobin_child_wait_switch_ioloop.start.annobin_child_wait_switch_ioloop.end.annobin_child_wait_init.start.annobin_child_wait_init.endchild_wait_refcount.annobin_child_wait_deinit.start.annobin_child_wait_deinit.endchild_wait_deinit.cold.5__func__.5079.annobin_compat.c.annobin_compat.c_end.annobin_compat.c.hot.annobin_compat.c_end.hot.annobin_compat.c.unlikely.annobin_compat.c_end.unlikely.annobin_compat.c.startup.annobin_compat.c_end.startup.annobin_compat.c.exit.annobin_compat.c_end.exit.annobin_i_my_pread.start.annobin_i_my_pread.end.annobin_i_my_pwrite.start.annobin_i_my_pwrite.end.annobin_connection.c.annobin_connection.c_end.annobin_connection.c.hot.annobin_connection.c_end.hot.annobin_connection.c.unlikely.annobin_connection.c_end.unlikely.annobin_connection.c.startup.annobin_connection.c_end.startup.annobin_connection.c.exit.annobin_connection.c_end.exit.annobin_connection_idle_timeout.start.annobin_connection_idle_timeout.end.annobin_connection_connect_timeout.start.annobin_connection_connect_timeout.end.annobin_connection_input_line_default.start.annobin_connection_input_line_default.endconnection_input_line_default.cold.7.annobin_connection_input_resume_full.start.annobin_connection_input_resume_full.endconnection_input_resume_fullconnection_input_resume_full.cold.8.annobin_connection_create_stream_name.start.annobin_connection_create_stream_name.endconnection_create_stream_name.annobin_connection_update_stream_names.start.annobin_connection_update_stream_names.endconnection_update_stream_names.annobin_connection_init_streams.start.annobin_connection_init_streams.endconnection_init_streamsconnection_init_streams.cold.9__func__.7616.annobin_connection_verify_version.start.annobin_connection_verify_version.endconnection_verify_version.cold.10__func__.7551.annobin_connection_handshake_args_default.start.annobin_connection_handshake_args_default.end.annobin_connection_input_halt.start.annobin_connection_input_halt.end.annobin_connection_input_resume.start.annobin_connection_input_resume.end.annobin_connection_update_event.start.annobin_connection_update_event.end.annobin_connection_update_properties.start.annobin_connection_update_properties.endconnection_update_properties.cold.11__func__.7611__func__.7587.annobin_connection_client_connected.start.annobin_connection_client_connected.endconnection_client_connectedconnection_client_connected.cold.12__func__.7626.annobin_connection_socket_connected.start.annobin_connection_socket_connected.endconnection_socket_connected.annobin_connection_streams_changed.start.annobin_connection_streams_changed.end.annobin_connection_client_connect.start.annobin_connection_client_connect.endconnection_client_connect.cold.13__func__.7711.annobin_connection_input_read.start.annobin_connection_input_read.end.annobin_connection_input_default.start.annobin_connection_input_default.endconnection_input_default.cold.14.annobin_connection_disconnect_reason.start.annobin_connection_disconnect_reason.endconnection_disconnect_reason.cold.15.annobin_connection_disconnect.start.annobin_connection_disconnect.end.annobin_connection_deinit.start.annobin_connection_deinit.endconnection_deinit.cold.16__func__.7728.annobin_connection_input_timeout_reason.start.annobin_connection_input_timeout_reason.end.annobin_connection_set_handlers.start.annobin_connection_set_handlers.endconnection_set_handlers.cold.17__func__.7759.annobin_connection_set_default_handlers.start.annobin_connection_set_default_handlers.end.annobin_connection_init_full.start.annobin_connection_init_full.endconnection_init_fullconnection_init_full.cold.18__func__.7637.annobin_connection_init.start.annobin_connection_init.end.annobin_connection_init_client_ip_from.start.annobin_connection_init_client_ip_from.endconnection_init_client_ip_from.cold.19__func__.7681.annobin_connection_init_client_ip.start.annobin_connection_init_client_ip.end.annobin_connection_init_client_unix.start.annobin_connection_init_client_unix.endconnection_init_client_unix.cold.20__func__.7694.annobin_connection_init_server.start.annobin_connection_init_server.endconnection_init_server.cold.21__func__.7650.annobin_connection_init_server_ip.start.annobin_connection_init_server_ip.end.annobin_connection_init_client_fd.start.annobin_connection_init_client_fd.endconnection_init_client_fd.cold.22__func__.7669.annobin_connection_init_from_streams.start.annobin_connection_init_from_streams.endconnection_init_from_streams.cold.23__func__.7702.annobin_connection_switch_ioloop_to.start.annobin_connection_switch_ioloop_to.end.annobin_connection_switch_ioloop.start.annobin_connection_switch_ioloop.end.annobin_connection_list_init.start.annobin_connection_list_init.endconnection_list_init.cold.24__func__.7775.annobin_connection_list_deinit.start.annobin_connection_list_deinit.endconnection_list_deinit.cold.25__func__.7781.annobin_cpu_limit.c.annobin_cpu_limit.c_end.annobin_cpu_limit.c.hot.annobin_cpu_limit.c_end.hot.annobin_cpu_limit.c.unlikely.annobin_cpu_limit.c_end.unlikely.annobin_cpu_limit.c.startup.annobin_cpu_limit.c_end.startup.annobin_cpu_limit.c.exit.annobin_cpu_limit.c_end.exit.annobin_cpu_limit_handler.start.annobin_cpu_limit_handler.endcpu_limit_handlerxcpu_signal_counter.annobin_timeval_add.isra.0.part.1.start.annobin_timeval_add.isra.0.part.1.endtimeval_add.isra.0.part.1__func__.4946.annobin_cpu_limit_get_usage_msecs_with.start.annobin_cpu_limit_get_usage_msecs_with.endcpu_limit_get_usage_msecs_withcpu_limit_get_usage_msecs_with.cold.3.annobin_cpu_limit_update_recursive.start.annobin_cpu_limit_update_recursive.endcpu_limit_update_recursive.annobin_cpu_limit_update_rlimit.start.annobin_cpu_limit_update_rlimit.endcpu_limit_update_rlimitcpu_limitorig_limitlast_set_rlimitrlim_cur_adjust_secscpu_limit_update_rlimit.cold.4.annobin_cpu_limit_get_usage_msecs.start.annobin_cpu_limit_get_usage_msecs.endcpu_limit_get_usage_msecs.cold.5.annobin_cpu_limit_init.start.annobin_cpu_limit_init.endcpu_limit_init.cold.6__func__.5140.annobin_cpu_limit_deinit.start.annobin_cpu_limit_deinit.endcpu_limit_deinit.cold.7.annobin_cpu_limit_exceeded.start.annobin_cpu_limit_exceeded.endchecked_signal_countertv_last.5149.annobin_crc32.c.annobin_crc32.c_end.annobin_crc32.c.hot.annobin_crc32.c_end.hot.annobin_crc32.c.unlikely.annobin_crc32.c_end.unlikely.annobin_crc32.c.startup.annobin_crc32.c_end.startup.annobin_crc32.c.exit.annobin_crc32.c_end.exit.annobin_crc32_data_more.start.annobin_crc32_data_more.endcrc32tab.annobin_crc32_data.start.annobin_crc32_data.end.annobin_crc32_str_more.start.annobin_crc32_str_more.end.annobin_crc32_str.start.annobin_crc32_str.end.annobin_data_stack.c.annobin_data_stack.c_end.annobin_data_stack.c.hot.annobin_data_stack.c_end.hot.annobin_data_stack.c.unlikely.annobin_data_stack.c_end.unlikely.annobin_data_stack.c.startup.annobin_data_stack.c_end.startup.annobin_data_stack.c.exit.annobin_data_stack.c_end.exit.annobin_mem_block_alloc.start.annobin_mem_block_alloc.endmem_block_alloccurrent_blockoutofmemoutofmem_areamem_block_alloc.cold.5.annobin_t_pop_last_unsafe.start.annobin_t_pop_last_unsafe.endcurrent_framelast_buffer_blockunused_blockt_pop_last_unsafe.cold.6.annobin_t_pop.start.annobin_t_pop.end.annobin_t_try_realloc.start.annobin_t_try_realloc.endt_try_realloc.cold.7.annobin_t_get_bytes_available.start.annobin_t_get_bytes_available.endt_get_bytes_available.cold.8__func__.4826.annobin_data_stack_frame_contains.start.annobin_data_stack_frame_contains.enddata_stack_frame_contains.cold.9__func__.4854.annobin_t_pop_pass_str.start.annobin_t_pop_pass_str.end.annobin_data_stack_get_alloc_size.start.annobin_data_stack_get_alloc_size.enddata_stack_get_alloc_size.cold.10__func__.4863.annobin_data_stack_get_used_size.start.annobin_data_stack_get_used_size.enddata_stack_get_used_size.cold.11__func__.4872.annobin_data_stack_free_unused.start.annobin_data_stack_free_unused.end.annobin_data_stack_init.start.annobin_data_stack_init.enddata_stack_initializedlast_buffer_sizeroot_frame_id.annobin_t_malloc_real.start.annobin_t_malloc_real.endt_malloc_realevent_datastack_deinitializedevent_datastackt_malloc_real.cold.12.annobin_t_malloc_no0.start.annobin_t_malloc_no0.end.annobin_t_malloc0.start.annobin_t_malloc0.end.annobin_t_buffer_get.start.annobin_t_buffer_get.end.annobin_t_buffer_reget.start.annobin_t_buffer_reget.end.annobin_t_buffer_alloc.start.annobin_t_buffer_alloc.endt_buffer_alloc.cold.13__func__.4840.annobin_t_push.start.annobin_t_push.endt_push.cold.14__func__.4755.annobin_t_push_named.start.annobin_t_push_named.end.annobin_t_buffer_alloc_last_full.start.annobin_t_buffer_alloc_last_full.end.annobin_data_stack_deinit_event.start.annobin_data_stack_deinit_event.end.annobin_data_stack_deinit.start.annobin_data_stack_deinit.enddata_stack_deinit.cold.15.annobin_eacces_error.c.annobin_eacces_error.c_end.annobin_eacces_error.c.hot.annobin_eacces_error.c_end.hot.annobin_eacces_error.c.unlikely.annobin_eacces_error.c_end.unlikely.annobin_eacces_error.c.startup.annobin_eacces_error.c_end.startup.annobin_eacces_error.c.exit.annobin_eacces_error.c_end.exit.annobin_write_eacces_error.start.annobin_write_eacces_error.endwrite_eacces_error.annobin_test_manual_access.start.annobin_test_manual_access.endtest_manual_access.annobin_test_access.start.annobin_test_access.endtest_access.annobin_eacces_error_get_full.start.annobin_eacces_error_get_full.endeacces_error_get_fulleacces_error_get_full.cold.1.annobin_eacces_error_get.start.annobin_eacces_error_get.end.annobin_eacces_error_get_creating.start.annobin_eacces_error_get_creating.end.annobin_eperm_error_get_chgrp.start.annobin_eperm_error_get_chgrp.end.annobin_env_util.c.annobin_env_util.c_end.annobin_env_util.c.hot.annobin_env_util.c_end.hot.annobin_env_util.c.unlikely.annobin_env_util.c_end.unlikely.annobin_env_util.c.startup.annobin_env_util.c_end.startup.annobin_env_util.c.exit.annobin_env_util.c_end.exit.annobin_env_put.start.annobin_env_put.endenv_put.cold.5__func__.4792.annobin_env_put_array.start.annobin_env_put_array.endenv_put_array.cold.6__func__.4798.annobin_env_remove.start.annobin_env_remove.endenv_remove.cold.7.annobin_env_clean.start.annobin_env_clean.endenv_clean.cold.8.annobin_env_clean_except.start.annobin_env_clean_except.endenv_clean_except.cold.9.annobin_env_backup_restore.start.annobin_env_backup_restore.end.annobin_env_backup_free.start.annobin_env_backup_free.end.annobin_env_get_environ_p.start.annobin_env_get_environ_p.end.annobin_env_backup_save.start.annobin_env_backup_save.endenv_backup_save.cold.10__func__.4837.annobin_event_filter.c.annobin_event_filter.c_end.annobin_event_filter.c.hot.annobin_event_filter.c_end.hot.annobin_event_filter.c.unlikely.annobin_event_filter.c_end.unlikely.annobin_event_filter.c.startup.annobin_event_filter.c_end.startup.annobin_event_filter.c.exit.annobin_event_filter.c_end.exit.annobin_filter_node_requires_event_name.start.annobin_filter_node_requires_event_name.endfilter_node_requires_event_name.annobin_event_has_category_nonrecursive.start.annobin_event_has_category_nonrecursive.endevent_has_category_nonrecursive.annobin_event_filter_query_update_category.start.annobin_event_filter_query_update_category.endevent_filter_query_update_category.annobin_event_filter_category_registered.start.annobin_event_filter_category_registered.endevent_filter_category_registeredevent_filters.annobin_event_match_strlist_recursive.start.annobin_event_match_strlist_recursive.endevent_match_strlist_recursiveevent_match_strlist_recursive.cold.15__func__.5438.annobin_event_match_field.start.annobin_event_match_field.endevent_match_fieldevent_match_field.cold.16.annobin_add_node.part.5.start.annobin_add_node.part.5.endadd_node.part.5.annobin_event_filter_get_or_alloc_internal_query.start.annobin_event_filter_get_or_alloc_internal_query.endevent_filter_get_or_alloc_internal_query.annobin_event_filter_export_query_expr_op.start.annobin_event_filter_export_query_expr_op.endevent_filter_export_query_expr_opevent_filter_export_query_expr_op.cold.17.annobin_event_filter_query_match.isra.10.part.11.start.annobin_event_filter_query_match.isra.10.part.11.endevent_filter_query_match.isra.10.part.11__func__.5508.annobin_event_filter_create_real.start.annobin_event_filter_create_real.endevent_filter_create_real.annobin_clone_expr.start.annobin_clone_expr.endclone_expr.annobin_event_filter_merge_with_context_internal.start.annobin_event_filter_merge_with_context_internal.endevent_filter_merge_with_context_internalevent_filter_merge_with_context_internal.cold.18.annobin_event_filter_create.start.annobin_event_filter_create.end.annobin_event_filter_create_fragment.start.annobin_event_filter_create_fragment.end.annobin_event_filter_ref.start.annobin_event_filter_ref.endevent_filter_ref.cold.19__func__.5255.annobin_event_filter_unref.start.annobin_event_filter_unref.endevent_filter_unref.cold.20__func__.5260.annobin_event_filter_parse.start.annobin_event_filter_parse.endevent_filter_parse.cold.21__func__.5293.annobin_event_filter_category_to_log_type.start.annobin_event_filter_category_to_log_type.endevent_filter_log_type_map.annobin_event_filter_category_from_log_type.start.annobin_event_filter_category_from_log_type.endevent_filter_category_from_log_type.cold.22.annobin_event_filter_export_query_expr.start.annobin_event_filter_export_query_expr.endevent_filter_export_query_exprevent_filter_export_query_expr.cold.23.annobin_event_filter_remove_queries_with_context.start.annobin_event_filter_remove_queries_with_context.end.annobin_event_filter_merge.start.annobin_event_filter_merge.end.annobin_event_filter_merge_with_context.start.annobin_event_filter_merge_with_context.end.annobin_event_filter_export.start.annobin_event_filter_export.end.annobin_event_filter_get_expr_for_testing.start.annobin_event_filter_get_expr_for_testing.end.annobin_event_filter_query_match_eval.start.annobin_event_filter_query_match_eval.endevent_filter_query_match_eval.localalias.13event_filter_query_match_eval.cold.24.annobin_event_filter_match_source.start.annobin_event_filter_match_source.endevent_filter_match_source.cold.25.annobin_event_filter_match.start.annobin_event_filter_match.end.annobin_event_filter_match_iter_init.start.annobin_event_filter_match_iter_init.endevent_filter_match_iter_init.cold.26.annobin_event_filter_match_iter_next.start.annobin_event_filter_match_iter_next.endevent_filter_match_iter_next.cold.27.annobin_event_filter_match_iter_deinit.start.annobin_event_filter_match_iter_deinit.end.annobin_event_filter_init.start.annobin_event_filter_init.end.annobin_event_filter_deinit.start.annobin_event_filter_deinit.end.annobin_event_filter_lexer.c.annobin_event_filter_lexer.c_end.annobin_event_filter_lexer.c.hot.annobin_event_filter_lexer.c_end.hot.annobin_event_filter_lexer.c.unlikely.annobin_event_filter_lexer.c_end.unlikely.annobin_event_filter_lexer.c.startup.annobin_event_filter_lexer.c_end.startup.annobin_event_filter_lexer.c.exit.annobin_event_filter_lexer.c_end.exit.annobin_yy_get_previous_state.start.annobin_yy_get_previous_state.endyy_get_previous_stateyy_acceptyy_baseyy_chkyy_nxtyy_ecyy_defyy_meta.annobin_event_filter_parser__flush_buffer.start.annobin_event_filter_parser__flush_buffer.end.annobin_event_filter_parser__init_buffer.start.annobin_event_filter_parser__init_buffer.endevent_filter_parser__init_buffer.annobin_event_filter_parser_get_extra.start.annobin_event_filter_parser_get_extra.end.annobin_event_filter_parser_get_lineno.start.annobin_event_filter_parser_get_lineno.end.annobin_event_filter_parser_get_column.start.annobin_event_filter_parser_get_column.end.annobin_event_filter_parser_get_in.start.annobin_event_filter_parser_get_in.end.annobin_event_filter_parser_get_out.start.annobin_event_filter_parser_get_out.end.annobin_event_filter_parser_get_leng.start.annobin_event_filter_parser_get_leng.end.annobin_event_filter_parser_get_text.start.annobin_event_filter_parser_get_text.end.annobin_event_filter_parser_set_extra.start.annobin_event_filter_parser_set_extra.end.annobin_event_filter_parser_set_lineno.start.annobin_event_filter_parser_set_lineno.endevent_filter_parser_set_lineno.cold.7.annobin_event_filter_parser_set_column.start.annobin_event_filter_parser_set_column.endevent_filter_parser_set_column.cold.8.annobin_event_filter_parser_set_in.start.annobin_event_filter_parser_set_in.end.annobin_event_filter_parser_set_out.start.annobin_event_filter_parser_set_out.end.annobin_event_filter_parser_get_debug.start.annobin_event_filter_parser_get_debug.end.annobin_event_filter_parser_set_debug.start.annobin_event_filter_parser_set_debug.end.annobin_event_filter_parser_get_lval.start.annobin_event_filter_parser_get_lval.end.annobin_event_filter_parser_set_lval.start.annobin_event_filter_parser_set_lval.end.annobin_event_filter_parser_alloc.start.annobin_event_filter_parser_alloc.endevent_filter_parser_alloc.cold.9.annobin_event_filter_parser__create_buffer.start.annobin_event_filter_parser__create_buffer.endevent_filter_parser__create_buffer.cold.10.annobin_event_filter_parser_lex_init.start.annobin_event_filter_parser_lex_init.end.annobin_event_filter_parser_lex_init_extra.start.annobin_event_filter_parser_lex_init_extra.end.annobin_event_filter_parser_realloc.start.annobin_event_filter_parser_realloc.endevent_filter_parser_realloc.cold.11.annobin_event_filter_parser_ensure_buffer_stack.start.annobin_event_filter_parser_ensure_buffer_stack.endevent_filter_parser_ensure_buffer_stackevent_filter_parser_ensure_buffer_stack.cold.12.annobin_event_filter_parser_restart.start.annobin_event_filter_parser_restart.end.annobin_event_filter_parser__switch_to_buffer.start.annobin_event_filter_parser__switch_to_buffer.end.annobin_event_filter_parser__scan_buffer.start.annobin_event_filter_parser__scan_buffer.endevent_filter_parser__scan_buffer.cold.13.annobin_event_filter_parser__scan_bytes.start.annobin_event_filter_parser__scan_bytes.endevent_filter_parser__scan_bytes.cold.14.annobin_event_filter_parser__scan_string.start.annobin_event_filter_parser__scan_string.end.annobin_event_filter_parser_push_buffer_state.start.annobin_event_filter_parser_push_buffer_state.end.annobin_event_filter_parser_lex.start.annobin_event_filter_parser_lex.endevent_filter_parser_lex.cold.15__func__.6704.annobin_event_filter_parser_free.start.annobin_event_filter_parser_free.end.annobin_event_filter_parser__delete_buffer.start.annobin_event_filter_parser__delete_buffer.end.annobin_event_filter_parser_pop_buffer_state.start.annobin_event_filter_parser_pop_buffer_state.end.annobin_event_filter_parser_lex_destroy.start.annobin_event_filter_parser_lex_destroy.end.annobin_event_filter_parser.c.annobin_event_filter_parser.c_end.annobin_event_filter_parser.c.hot.annobin_event_filter_parser.c_end.hot.annobin_event_filter_parser.c.unlikely.annobin_event_filter_parser.c_end.unlikely.annobin_event_filter_parser.c.startup.annobin_event_filter_parser.c_end.startup.annobin_event_filter_parser.c.exit.annobin_event_filter_parser.c_end.exit.annobin_yytnamerr.start.annobin_yytnamerr.endyytnamerr.annobin_yysyntax_error.start.annobin_yysyntax_error.endyysyntax_erroryypactyycheckyytname.annobin_event_filter_parser_error.start.annobin_event_filter_parser_error.end.annobin_event_filter_parser_parse.start.annobin_event_filter_parser_parse.endyytableyydefactyyr2yyr1yypgotoyydefgotoyytranslate.annobin_event_log.c.annobin_event_log.c_end.annobin_event_log.c.hot.annobin_event_log.c_end.hot.annobin_event_log.c.unlikely.annobin_event_log.c_end.unlikely.annobin_event_log.c.startup.annobin_event_log.c_end.startup.annobin_event_log.c.exit.annobin_event_log.c_end.exit.annobin_event_get_log_message_str_out.start.annobin_event_get_log_message_str_out.endevent_get_log_message_str_out.annobin_event_get_log_message.start.annobin_event_get_log_message.endevent_get_log_message.annobin_event_logv_params.start.annobin_event_logv_params.endevent_logv_paramsevent_logv_params.cold.3__func__.5063.annobin_event_want_log_level.start.annobin_event_want_log_level.end.annobin_event_want_level.start.annobin_event_want_level.end.annobin_event_logv.start.annobin_event_logv.end.annobin_e_error.start.annobin_e_error.ende_error.cold.4.annobin_e_warning.start.annobin_e_warning.ende_warning.cold.5.annobin_e_info.start.annobin_e_info.ende_info.cold.6.annobin_e_debug.start.annobin_e_debug.ende_debug.cold.7.annobin_e_log.start.annobin_e_log.ende_log.cold.8.annobin_event_log.start.annobin_event_log.end.annobin_event_set_forced_debug.start.annobin_event_set_forced_debug.end.annobin_event_unset_forced_debug.start.annobin_event_unset_forced_debug.end.annobin_event_get_global_debug_log_filter.start.annobin_event_get_global_debug_log_filter.end.annobin_event_unset_global_debug_log_filter.start.annobin_event_unset_global_debug_log_filter.end.annobin_event_set_global_debug_log_filter.start.annobin_event_set_global_debug_log_filter.end.annobin_event_get_global_debug_send_filter.start.annobin_event_get_global_debug_send_filter.end.annobin_event_unset_global_debug_send_filter.start.annobin_event_unset_global_debug_send_filter.end.annobin_event_set_global_debug_send_filter.start.annobin_event_set_global_debug_send_filter.end.annobin_event_get_global_core_log_filter.start.annobin_event_get_global_core_log_filter.end.annobin_event_unset_global_core_log_filter.start.annobin_event_unset_global_core_log_filter.end.annobin_event_set_global_core_log_filter.start.annobin_event_set_global_core_log_filter.end.annobin_execv_const.c.annobin_execv_const.c_end.annobin_execv_const.c.hot.annobin_execv_const.c_end.hot.annobin_execv_const.c.unlikely.annobin_execv_const.c_end.unlikely.annobin_execv_const.c.startup.annobin_execv_const.c_end.startup.annobin_execv_const.c.exit.annobin_execv_const.c_end.exit.annobin_argv_drop_const.start.annobin_argv_drop_const.endargv_drop_const.annobin_execv_const.start.annobin_execv_const.end.annobin_execvp_const.start.annobin_execvp_const.end.annobin_failures.c.annobin_failures.c_end.annobin_failures.c.hot.annobin_failures.c_end.hot.annobin_failures.c.unlikely.annobin_failures.c_end.unlikely.annobin_failures.c.startup.annobin_failures.c_end.startup.annobin_failures.c.exit.annobin_failures.c_end.exit.annobin_syslog_post_handler.start.annobin_syslog_post_handler.endsyslog_post_handler.annobin_log_fd_write.start.annobin_log_fd_write.endlog_fd_writelog_fd_write.cold.9.annobin_default_write.start.annobin_default_write.enddefault_writelog_fdlog_info_fdlog_debug_fd.annobin_i_failure_send_option_forced.start.annobin_i_failure_send_option_forced.endi_failure_send_option_forced.annobin_internal_format.start.annobin_internal_format.endinternal_formatlog_prefix_sent.annobin_default_post_handler.start.annobin_default_post_handler.enddefault_post_handlercoredump_on_errordefault_post_handler.cold.10.annobin_log_timestamp_add.isra.3.start.annobin_log_timestamp_add.isra.3.endlog_timestamp_add.isra.3log_stamp_formatlog_stamp_format_suffix.annobin_internal_write.start.annobin_internal_write.endinternal_write.annobin_internal_post_handler.start.annobin_internal_post_handler.endinternal_post_handler.annobin_failure_exit.start.annobin_failure_exit.endrecursed.7530.annobin_syslog_on_handler_failure.start.annobin_syslog_on_handler_failure.endsyslog_on_handler_failure.annobin_internal_on_handler_failure.start.annobin_internal_on_handler_failure.endinternal_on_handler_failure.annobin_i_log_typev.start.annobin_i_log_typev.end.annobin_i_log_type.start.annobin_i_log_type.end.annobin_i_panic.start.annobin_i_panic.end.annobin_log_prefix_add.start.annobin_log_prefix_add.endlog_prefix_addlog_prefix_add.cold.11.annobin_default_format.start.annobin_default_format.enddefault_format.annobin_syslog_format.start.annobin_syslog_format.endsyslog_format.annobin_common_handler.start.annobin_common_handler.endcommon_handlerrecursed.7506common_handler.cold.12.annobin_error_handler_real.start.annobin_error_handler_real.enderror_handler_real.annobin_default_error_handler.start.annobin_default_error_handler.enddefault_handler_vfuncs.annobin_i_syslog_error_handler.start.annobin_i_syslog_error_handler.endsyslog_handler_vfuncs.annobin_i_internal_error_handler.start.annobin_i_internal_error_handler.endi_internal_error_handlerinternal_handler_vfuncs.annobin_i_fatal.start.annobin_i_fatal.end.annobin_i_fatal_status.start.annobin_i_fatal_status.end.annobin_default_on_handler_failure.start.annobin_default_on_handler_failure.enddefault_on_handler_failure.annobin_open_log_file.start.annobin_open_log_file.endopen_log_fileopen_log_file.cold.13.annobin_i_error.start.annobin_i_error.endfailure_ctx_error.annobin_fatal_handler_real.start.annobin_fatal_handler_real.endfatal_handler_realrecursed.7571fatal_handler_real.cold.14.annobin_default_fatal_handler.start.annobin_default_fatal_handler.end.annobin_i_syslog_fatal_handler.start.annobin_i_syslog_fatal_handler.end.annobin_i_internal_fatal_handler.start.annobin_i_internal_fatal_handler.endi_internal_fatal_handler.annobin_i_warning.start.annobin_i_warning.endfailure_ctx_warning.annobin_i_info.start.annobin_i_info.endfailure_ctx_info.annobin_i_debug.start.annobin_i_debug.endfailure_ctx_debug.annobin_i_set_fatal_handler.start.annobin_i_set_fatal_handler.end.annobin_i_set_error_handler.start.annobin_i_set_error_handler.end.annobin_i_set_info_handler.start.annobin_i_set_info_handler.end.annobin_i_set_debug_handler.start.annobin_i_set_debug_handler.end.annobin_i_get_failure_handlers.start.annobin_i_get_failure_handlers.end.annobin_i_set_failure_syslog.start.annobin_i_set_failure_syslog.end.annobin_i_set_failure_prefix.start.annobin_i_set_failure_prefix.end.annobin_i_set_failure_file.start.annobin_i_set_failure_file.endi_set_failure_file.cold.15.annobin_i_unset_failure_prefix.start.annobin_i_unset_failure_prefix.end.annobin_i_get_failure_prefix.start.annobin_i_get_failure_prefix.end.annobin_i_failure_parse_line.start.annobin_i_failure_parse_line.end.annobin_i_set_failure_internal.start.annobin_i_set_failure_internal.end.annobin_i_failure_handler_is_internal.start.annobin_i_failure_handler_is_internal.end.annobin_i_set_failure_ignore_errors.start.annobin_i_set_failure_ignore_errors.end.annobin_i_set_info_file.start.annobin_i_set_info_file.end.annobin_i_set_debug_file.start.annobin_i_set_debug_file.end.annobin_i_set_failure_timestamp_format.start.annobin_i_set_failure_timestamp_format.end.annobin_i_set_failure_send_ip.start.annobin_i_set_failure_send_ip.end.annobin_i_set_failure_send_prefix.start.annobin_i_set_failure_send_prefix.end.annobin_i_set_failure_exit_callback.start.annobin_i_set_failure_exit_callback.end.annobin_failures_deinit.start.annobin_failures_deinit.end__func__.7766.annobin_i_unreached.start.annobin_i_unreached.end.annobin_syslog_write.start.annobin_syslog_write.endsyslog_writesyslog_write.cold.16.annobin_fd_util.c.annobin_fd_util.c_end.annobin_fd_util.c.hot.annobin_fd_util.c_end.hot.annobin_fd_util.c.unlikely.annobin_fd_util.c_end.unlikely.annobin_fd_util.c.startup.annobin_fd_util.c_end.startup.annobin_fd_util.c.exit.annobin_fd_util.c_end.exit.annobin_fd_close_on_exec.start.annobin_fd_close_on_exec.endfd_close_on_exec.cold.0.annobin_fd_debug_verify_leaks.start.annobin_fd_debug_verify_leaks.endfd_debug_verify_leaks.cold.1.annobin_fd_set_nonblock.start.annobin_fd_set_nonblock.endfd_set_nonblock.cold.2__func__.6422.annobin_i_close_fd_path.start.annobin_i_close_fd_path.endi_close_fd_path.cold.3.annobin_fd_close_maybe_stdio.start.annobin_fd_close_maybe_stdio.end__func__.6429fd_close_maybe_stdio.cold.4.annobin_fdatasync_path.c.annobin_fdatasync_path.c_end.annobin_fdatasync_path.c.hot.annobin_fdatasync_path.c_end.hot.annobin_fdatasync_path.c.unlikely.annobin_fdatasync_path.c_end.unlikely.annobin_fdatasync_path.c.startup.annobin_fdatasync_path.c_end.startup.annobin_fdatasync_path.c.exit.annobin_fdatasync_path.c_end.exit.annobin_fdatasync_path.start.annobin_fdatasync_path.end__func__.5422.annobin_fdpass.c.annobin_fdpass.c_end.annobin_fdpass.c.hot.annobin_fdpass.c_end.hot.annobin_fdpass.c.unlikely.annobin_fdpass.c_end.unlikely.annobin_fdpass.c.startup.annobin_fdpass.c_end.startup.annobin_fdpass.c.exit.annobin_fdpass.c_end.exit.annobin_fd_send.start.annobin_fd_send.endfd_send.cold.0__func__.4744.annobin_fd_read.start.annobin_fd_read.endfd_read.cold.1__func__.4756.annobin_file_cache.c.annobin_file_cache.c_end.annobin_file_cache.c.hot.annobin_file_cache.c_end.hot.annobin_file_cache.c.unlikely.annobin_file_cache.c_end.unlikely.annobin_file_cache.c.startup.annobin_file_cache.c_end.startup.annobin_file_cache.c.exit.annobin_file_cache.c_end.exit.annobin_file_cache_new_path.start.annobin_file_cache_new_path.end.annobin_file_cache_new.start.annobin_file_cache_new.end.annobin_file_cache_free.start.annobin_file_cache_free.endfile_cache_free.cold.1.annobin_file_cache_set_size.start.annobin_file_cache_set_size.endfile_cache_set_size.cold.2.annobin_file_cache_read.start.annobin_file_cache_read.endfile_cache_read.cold.3__func__.5779.annobin_file_cache_get_map.start.annobin_file_cache_get_map.end.annobin_file_cache_invalidate.start.annobin_file_cache_invalidate.endfile_cache_invalidate.cold.4__func__.5813.annobin_file_cache_set_fd.start.annobin_file_cache_set_fd.end.annobin_file_cache_write.start.annobin_file_cache_write.endfile_cache_write.cold.5__func__.5799.annobin_file_create_locked.c.annobin_file_create_locked.c_end.annobin_file_create_locked.c.hot.annobin_file_create_locked.c_end.hot.annobin_file_create_locked.c.unlikely.annobin_file_create_locked.c_end.unlikely.annobin_file_create_locked.c.startup.annobin_file_create_locked.c_end.startup.annobin_file_create_locked.c.exit.annobin_file_create_locked.c_end.exit.annobin_try_lock_existing.start.annobin_try_lock_existing.endtry_lock_existing.annobin_file_create_locked.start.annobin_file_create_locked.end__func__.5918__func__.5907.annobin_file_copy.c.annobin_file_copy.c_end.annobin_file_copy.c.hot.annobin_file_copy.c_end.hot.annobin_file_copy.c.unlikely.annobin_file_copy.c_end.unlikely.annobin_file_copy.c.startup.annobin_file_copy.c_end.startup.annobin_file_copy.c.exit.annobin_file_copy.c_end.exit.annobin_file_copy.start.annobin_file_copy.endfile_copy.cold.0__func__.6745.annobin_file_dotlock.c.annobin_file_dotlock.c_end.annobin_file_dotlock.c.hot.annobin_file_dotlock.c_end.hot.annobin_file_dotlock.c.unlikely.annobin_file_dotlock.c_end.unlikely.annobin_file_dotlock.c.startup.annobin_file_dotlock.c_end.startup.annobin_file_dotlock.c.exit.annobin_file_dotlock.c_end.exit.annobin_update_change_info.start.annobin_update_change_info.endupdate_change_info.annobin_file_dotlock_free.start.annobin_file_dotlock_free.endfile_dotlock_freefile_dotlock_free.cold.5.annobin_dotlock_wait_end.start.annobin_dotlock_wait_end.enddotlock_wait_end.annobin_read_local_pid.start.annobin_read_local_pid.endread_local_pid__func__.7228.annobin_update_lock_info.start.annobin_update_lock_info.endupdate_lock_infoupdate_lock_info.cold.6.annobin_dotlock_override.start.annobin_dotlock_override.enddotlock_override.annobin_file_write_pid.start.annobin_file_write_pid.endfile_write_pidfile_write_pid.cold.7.annobin_dotlock_create.start.annobin_dotlock_create.end__func__.7271__func__.7277dotlock_create.cold.8.annobin_file_dotlock_alloc.start.annobin_file_dotlock_alloc.endfile_dotlock_alloc.annobin_file_dotlock_create.start.annobin_file_dotlock_create.endfile_dotlock_create.cold.9.annobin_file_dotlock_open.start.annobin_file_dotlock_open.endfile_dotlock_open.cold.10.annobin_file_dotlock_get_lock_path.start.annobin_file_dotlock_get_lock_path.end.annobin_dotlock_replaced_warning.start.annobin_dotlock_replaced_warning.enddotlock_replaced_warning.annobin_file_dotlock_delete.start.annobin_file_dotlock_delete.endfile_dotlock_delete.cold.11.annobin_file_dotlock_open_mode_full.start.annobin_file_dotlock_open_mode_full.endfile_dotlock_open_mode_full.annobin_file_dotlock_open_mode.start.annobin_file_dotlock_open_mode.end.annobin_file_dotlock_open_group.start.annobin_file_dotlock_open_group.end.annobin_file_dotlock_touch.start.annobin_file_dotlock_touch.endfile_dotlock_touch.cold.12.annobin_file_dotlock_is_locked.start.annobin_file_dotlock_is_locked.endfile_dotlock_is_locked.cold.13.annobin_file_dotlock_replace.start.annobin_file_dotlock_replace.endfile_dotlock_replace.cold.14.annobin_file_lock.c.annobin_file_lock.c_end.annobin_file_lock.c.hot.annobin_file_lock.c_end.hot.annobin_file_lock.c.unlikely.annobin_file_lock.c_end.unlikely.annobin_file_lock.c.startup.annobin_file_lock.c_end.startup.annobin_file_lock.c.exit.annobin_file_lock.c_end.exit.annobin_err_is_lock_timeout.start.annobin_err_is_lock_timeout.enderr_is_lock_timeout.annobin_file_lock_wait_init_warning.start.annobin_file_lock_wait_init_warning.endfile_lock_wait_init_warningfile_lock_slow_warning_usecsfile_lock_wait_init_warning.cold.7.annobin_file_lock_log_warning_if_slow.start.annobin_file_lock_log_warning_if_slow.endfile_lock_log_warning_if_slow.annobin_file_lock_method_parse.start.annobin_file_lock_method_parse.end.annobin_file_lock_method_to_str.start.annobin_file_lock_method_to_str.end.annobin_file_lock_find.start.annobin_file_lock_find.endhave_proc_locks.6030file_lock_find.cold.8.annobin_file_lock_set_unlink_on_free.start.annobin_file_lock_set_unlink_on_free.end.annobin_file_lock_set_close_on_free.start.annobin_file_lock_set_close_on_free.end.annobin_file_lock_from_dotlock.start.annobin_file_lock_from_dotlock.end.annobin_file_lock_get_path.start.annobin_file_lock_get_path.end.annobin_file_lock_set_path.start.annobin_file_lock_set_path.end.annobin_file_lock_wait_start.start.annobin_file_lock_wait_start.endfile_lock_wait_start.cold.9__func__.6137.annobin_file_lock_wait_end.start.annobin_file_lock_wait_end.endfile_lock_wait_usecsfile_lock_wait_end.cold.10.annobin_file_lock_do.start.annobin_file_lock_do.endfile_lock_dofile_lock_do.cold.11.annobin_file_wait_lock.start.annobin_file_wait_lock.end.annobin_file_try_lock.start.annobin_file_try_lock.end.annobin_file_lock_try_update.start.annobin_file_lock_try_update.end.annobin_file_unlock_real.start.annobin_file_unlock_real.endfile_unlock_realfile_unlock_real.cold.12.annobin_file_try_unlink_locked.start.annobin_file_try_unlink_locked.endfile_try_unlink_lockedfile_try_unlink_locked.cold.13.annobin_file_lock_free.start.annobin_file_lock_free.end.annobin_file_unlock.start.annobin_file_unlock.endfile_unlock.cold.14__func__.6112.annobin_file_lock_wait_get_total_usecs.start.annobin_file_lock_wait_get_total_usecs.end.annobin_file_set_size.c.annobin_file_set_size.c_end.annobin_file_set_size.c.hot.annobin_file_set_size.c_end.hot.annobin_file_set_size.c.unlikely.annobin_file_set_size.c_end.unlikely.annobin_file_set_size.c.startup.annobin_file_set_size.c_end.startup.annobin_file_set_size.c.exit.annobin_file_set_size.c_end.exit.annobin_file_set_size.start.annobin_file_set_size.endposix_fallocate_supported.6100file_set_size.cold.0__func__.6105.annobin_file_preallocate.start.annobin_file_preallocate.end.annobin_guid.c.annobin_guid.c_end.annobin_guid.c.hot.annobin_guid.c_end.hot.annobin_guid.c.unlikely.annobin_guid.c_end.unlikely.annobin_guid.c.startup.annobin_guid.c_end.startup.annobin_guid.c.exit.annobin_guid.c_end.exit.annobin_guid_generate.start.annobin_guid_generate.endts.6070pid.6071guid_generate.cold.1.annobin_guid_128_host_hash_get.start.annobin_guid_128_host_hash_get.end.annobin_guid_128_generate.start.annobin_guid_128_generate.endts.6080guid_static.6081guid_128_generate.cold.2.annobin_guid_128_is_empty.start.annobin_guid_128_is_empty.end.annobin_guid_128_equals.start.annobin_guid_128_equals.end.annobin_guid_128_from_string.start.annobin_guid_128_from_string.end.annobin_guid_128_to_string.start.annobin_guid_128_to_string.end.annobin_guid_128_hash.start.annobin_guid_128_hash.end.annobin_guid_128_cmp.start.annobin_guid_128_cmp.end.annobin_guid_128_to_uuid_string.start.annobin_guid_128_to_uuid_string.endguid_128_to_uuid_string.localalias.0.annobin_guid_128_from_uuid_string.start.annobin_guid_128_from_uuid_string.endguid_128_from_uuid_string.cold.3.annobin_hash.c.annobin_hash.c_end.annobin_hash.c.hot.annobin_hash.c_end.hot.annobin_hash.c.unlikely.annobin_hash.c_end.unlikely.annobin_hash.c.startup.annobin_hash.c_end.startup.annobin_hash.c.exit.annobin_hash.c_end.exit.annobin_direct_hash.start.annobin_direct_hash.enddirect_hash.annobin_direct_cmp.start.annobin_direct_cmp.enddirect_cmp.annobin_hash_table_destroy_nodes.start.annobin_hash_table_destroy_nodes.endhash_table_destroy_nodes.annobin_hash_table_compress.start.annobin_hash_table_compress.endhash_table_compresshash_table_compress.cold.5.annobin_hash_table_resize.start.annobin_hash_table_resize.endhash_table_resizehash_table_insert_nodehash_table_resize.cold.6.annobin_hash_table_insert_node.start.annobin_hash_table_insert_node.endhash_table_insert_node.cold.7.annobin_hash_table_create.start.annobin_hash_table_create.end.annobin_hash_table_create_direct.start.annobin_hash_table_create_direct.end.annobin_hash_table_destroy.start.annobin_hash_table_destroy.endhash_table_destroy.cold.8__func__.4750.annobin_hash_table_clear.start.annobin_hash_table_clear.endhash_table_clear.cold.9.annobin_hash_table_lookup.start.annobin_hash_table_lookup.end.annobin_hash_table_lookup_full.start.annobin_hash_table_lookup_full.end.annobin_hash_table_insert.start.annobin_hash_table_insert.end.annobin_hash_table_update.start.annobin_hash_table_update.end.annobin_hash_table_try_remove.start.annobin_hash_table_try_remove.end.annobin_hash_table_count.start.annobin_hash_table_count.end.annobin_hash_table_iterate.start.annobin_hash_table_iterate.end.annobin_hash_table_freeze.start.annobin_hash_table_freeze.end.annobin_hash_table_iterate_init.start.annobin_hash_table_iterate_init.end.annobin_hash_table_thaw.start.annobin_hash_table_thaw.endhash_table_thaw.cold.10__func__.4852.annobin_hash_table_iterate_deinit.start.annobin_hash_table_iterate_deinit.end.annobin_hash_table_copy.start.annobin_hash_table_copy.end.annobin_str_hash.start.annobin_str_hash.end.annobin_strcase_hash.start.annobin_strcase_hash.end.annobin_mem_hash.start.annobin_mem_hash.end.annobin_strfastcase_hash.start.annobin_strfastcase_hash.end.annobin_hash_format.c.annobin_hash_format.c_end.annobin_hash_format.c.hot.annobin_hash_format.c_end.hot.annobin_hash_format.c.unlikely.annobin_hash_format.c_end.unlikely.annobin_hash_format.c.startup.annobin_hash_format.c_end.startup.annobin_hash_format.c.exit.annobin_hash_format.c_end.exit.annobin_hash_format_init.start.annobin_hash_format_init.endhash_format_init.cold.5.annobin_hash_format_loop.start.annobin_hash_format_loop.end.annobin_hash_format_reset.start.annobin_hash_format_reset.end.annobin_hash_format_write.start.annobin_hash_format_write.endhash_format_write.cold.6__func__.5073.annobin_hash_format_deinit.start.annobin_hash_format_deinit.end.annobin_hash_format_deinit_free.start.annobin_hash_format_deinit_free.end.annobin_hash_method.c.annobin_hash_method.c_end.annobin_hash_method.c.hot.annobin_hash_method.c_end.hot.annobin_hash_method.c.unlikely.annobin_hash_method.c_end.unlikely.annobin_hash_method.c.startup.annobin_hash_method.c_end.startup.annobin_hash_method.c.exit.annobin_hash_method.c_end.exit.annobin_hash_method_init_size.start.annobin_hash_method_init_size.endhash_method_init_size.annobin_hash_method_loop_size.start.annobin_hash_method_loop_size.endhash_method_loop_size.annobin_hash_method_result_size.start.annobin_hash_method_result_size.endhash_method_result_size.annobin_hash_method_lookup.start.annobin_hash_method_lookup.end.annobin_hash_method_get_digest.start.annobin_hash_method_get_digest.end__func__.4860hash_method_get_digest.cold.1.annobin_t_hash_data.start.annobin_t_hash_data.endt_hash_data.cold.2__func__.4867hash_method_size.annobin_hash2.c.annobin_hash2.c_end.annobin_hash2.c.hot.annobin_hash2.c_end.hot.annobin_hash2.c.unlikely.annobin_hash2.c_end.unlikely.annobin_hash2.c.startup.annobin_hash2.c_end.startup.annobin_hash2.c.exit.annobin_hash2.c_end.exit.annobin_hash2_alloc_table.start.annobin_hash2_alloc_table.endhash2_alloc_table.annobin_hash2_resize.start.annobin_hash2_resize.endhash2_resizehash2_resize.cold.5.annobin_hash2_create.start.annobin_hash2_create.end.annobin_hash2_destroy.start.annobin_hash2_destroy.end.annobin_hash2_clear.start.annobin_hash2_clear.end.annobin_hash2_lookup.start.annobin_hash2_lookup.endhash2_lookup.cold.6.annobin_hash2_iterate.start.annobin_hash2_iterate.endhash2_iterate.cold.7.annobin_hash2_insert_hash.start.annobin_hash2_insert_hash.end.annobin_hash2_insert.start.annobin_hash2_insert.end.annobin_hash2_remove.start.annobin_hash2_remove.endhash2_remove.cold.8.annobin_hash2_remove_iter.start.annobin_hash2_remove_iter.endhash2_remove_iter.cold.9.annobin_hash2_count.start.annobin_hash2_count.end.annobin_hex_binary.c.annobin_hex_binary.c_end.annobin_hex_binary.c.hot.annobin_hex_binary.c_end.hot.annobin_hex_binary.c.unlikely.annobin_hex_binary.c_end.unlikely.annobin_hex_binary.c.startup.annobin_hex_binary.c_end.startup.annobin_hex_binary.c.exit.annobin_hex_binary.c_end.exit.annobin_binary_to_hex_case.start.annobin_binary_to_hex_case.endbinary_to_hex_case.annobin_binary_to_hex.start.annobin_binary_to_hex.end.annobin_binary_to_hex_ucase.start.annobin_binary_to_hex_ucase.end.annobin_binary_to_hex_append.start.annobin_binary_to_hex_append.end.annobin_hex_to_binary.start.annobin_hex_to_binary.end.annobin_hex_dec.c.annobin_hex_dec.c_end.annobin_hex_dec.c.hot.annobin_hex_dec.c_end.hot.annobin_hex_dec.c.unlikely.annobin_hex_dec.c_end.unlikely.annobin_hex_dec.c.startup.annobin_hex_dec.c_end.startup.annobin_hex_dec.c.exit.annobin_hex_dec.c_end.exit.annobin_dec2hex.start.annobin_dec2hex.end.annobin_hex2dec.start.annobin_hex2dec.end.annobin_hmac.c.annobin_hmac.c_end.annobin_hmac.c.hot.annobin_hmac.c_end.hot.annobin_hmac.c.unlikely.annobin_hmac.c_end.unlikely.annobin_hmac.c.startup.annobin_hmac.c_end.startup.annobin_hmac.c.exit.annobin_hmac.c_end.exit.annobin_hmac_init.start.annobin_hmac_init.end__func__.4841.annobin_hmac_final.start.annobin_hmac_final.end.annobin_t_hmac_data.start.annobin_t_hmac_data.end__func__.4858t_hmac_data.cold.0.annobin_t_hmac_buffer.start.annobin_t_hmac_buffer.end.annobin_t_hmac_str.start.annobin_t_hmac_str.end.annobin_hmac_hkdf.start.annobin_hmac_hkdf.end__func__.4884hmac_hkdf.cold.1.annobin_hmac_cram_md5.c.annobin_hmac_cram_md5.c_end.annobin_hmac_cram_md5.c.hot.annobin_hmac_cram_md5.c_end.hot.annobin_hmac_cram_md5.c.unlikely.annobin_hmac_cram_md5.c_end.unlikely.annobin_hmac_cram_md5.c.startup.annobin_hmac_cram_md5.c_end.startup.annobin_hmac_cram_md5.c.exit.annobin_hmac_cram_md5.c_end.exit.annobin_hmac_md5_get_cram_context.start.annobin_hmac_md5_get_cram_context.end.annobin_hmac_md5_set_cram_context.start.annobin_hmac_md5_set_cram_context.end.annobin_home_expand.c.annobin_home_expand.c_end.annobin_home_expand.c.hot.annobin_home_expand.c_end.hot.annobin_home_expand.c.unlikely.annobin_home_expand.c_end.unlikely.annobin_home_expand.c.startup.annobin_home_expand.c_end.startup.annobin_home_expand.c.exit.annobin_home_expand.c_end.exit.annobin_home_try_expand.start.annobin_home_try_expand.endhome_try_expand.cold.0.annobin_home_expand.start.annobin_home_expand.end.annobin_home_expand_tilde.start.annobin_home_expand_tilde.end.annobin_hook_build.c.annobin_hook_build.c_end.annobin_hook_build.c.hot.annobin_hook_build.c_end.hot.annobin_hook_build.c.unlikely.annobin_hook_build.c_end.unlikely.annobin_hook_build.c.startup.annobin_hook_build.c_end.startup.annobin_hook_build.c.exit.annobin_hook_build.c_end.exit.annobin_hook_build_append.start.annobin_hook_build_append.endhook_build_appendhook_build_append.cold.2.annobin_hook_build_init.start.annobin_hook_build_init.endhook_build_init.cold.3.annobin_hook_build_update.start.annobin_hook_build_update.endhook_build_update.cold.4__func__.4803__func__.4812.annobin_hook_build_deinit.start.annobin_hook_build_deinit.end.annobin_hostpid.c.annobin_hostpid.c_end.annobin_hostpid.c.hot.annobin_hostpid.c_end.hot.annobin_hostpid.c.unlikely.annobin_hostpid.c_end.unlikely.annobin_hostpid.c.startup.annobin_hostpid.c_end.startup.annobin_hostpid.c.exit.annobin_hostpid.c_end.exit.annobin_hostpid_init.start.annobin_hostpid_init.endmy_hostname_dupmy_domainpid.6005hostpid_init.cold.0.annobin_hostpid_deinit.start.annobin_hostpid_deinit.end.annobin_my_hostdomain.start.annobin_my_hostdomain.end.annobin_imem.c.annobin_imem.c_end.annobin_imem.c.hot.annobin_imem.c_end.hot.annobin_imem.c.unlikely.annobin_imem.c_end.unlikely.annobin_imem.c.startup.annobin_imem.c_end.startup.annobin_imem.c.exit.annobin_imem.c_end.exit.annobin_i_malloc.start.annobin_i_malloc.endi_malloc.cold.0.annobin_i_realloc.start.annobin_i_realloc.endi_realloc.cold.1.annobin_i_strdup.start.annobin_i_strdup.end.annobin_i_memdup.start.annobin_i_memdup.end.annobin_i_strdup_empty.start.annobin_i_strdup_empty.end.annobin_i_strdup_until.start.annobin_i_strdup_until.end.annobin_i_strndup.start.annobin_i_strndup.endi_strndup.cold.2__func__.4532.annobin_i_strdup_printf.start.annobin_i_strdup_printf.end.annobin_i_strdup_vprintf.start.annobin_i_strdup_vprintf.end.annobin_i_strconcat.start.annobin_i_strconcat.endi_strconcat.cold.3__func__.4548.annobin_ipwd.c.annobin_ipwd.c_end.annobin_ipwd.c.hot.annobin_ipwd.c_end.hot.annobin_ipwd.c.unlikely.annobin_ipwd.c_end.unlikely.annobin_ipwd.c.startup.annobin_ipwd.c_end.startup.annobin_ipwd.c.exit.annobin_ipwd.c_end.exit.annobin_pw_init.start.annobin_pw_init.endpw_initpwbufpwbuf_size.annobin_gr_init.start.annobin_gr_init.endgr_initgrbufgrbuf_size.annobin_ipwd_deinit.start.annobin_ipwd_deinit.end.annobin_i_getpwnam.start.annobin_i_getpwnam.end.annobin_i_getpwuid.start.annobin_i_getpwuid.end.annobin_i_getgrnam.start.annobin_i_getgrnam.end.annobin_i_getgrgid.start.annobin_i_getgrgid.end.annobin_iostream.c.annobin_iostream.c_end.annobin_iostream.c.hot.annobin_iostream.c_end.hot.annobin_iostream.c.unlikely.annobin_iostream.c_end.unlikely.annobin_iostream.c.startup.annobin_iostream.c_end.startup.annobin_iostream.c.exit.annobin_iostream.c_end.exit.annobin_io_stream_default_close.start.annobin_io_stream_default_close.endio_stream_default_close.annobin_io_stream_default_destroy.start.annobin_io_stream_default_destroy.endio_stream_default_destroy.annobin_io_stream_init.start.annobin_io_stream_init.end.annobin_io_stream_ref.start.annobin_io_stream_ref.endio_stream_ref.cold.5__func__.5625.annobin_io_stream_unref.start.annobin_io_stream_unref.endio_stream_unref.cold.6__func__.5629.annobin_io_stream_free.start.annobin_io_stream_free.end.annobin_io_stream_close.start.annobin_io_stream_close.end.annobin_io_stream_set_max_buffer_size.start.annobin_io_stream_set_max_buffer_size.end.annobin_io_stream_add_destroy_callback.start.annobin_io_stream_add_destroy_callback.end.annobin_io_stream_remove_destroy_callback.start.annobin_io_stream_remove_destroy_callback.endio_stream_remove_destroy_callback.cold.7.annobin_io_stream_set_verror.start.annobin_io_stream_set_verror.end.annobin_io_stream_set_error.start.annobin_io_stream_set_error.end.annobin_io_stream_get_disconnect_reason.start.annobin_io_stream_get_disconnect_reason.end.annobin_io_stream_switch_ioloop_to.start.annobin_io_stream_switch_ioloop_to.end.annobin_io_stream_get_ioloop.start.annobin_io_stream_get_ioloop.end.annobin_iostream_pump.c.annobin_iostream_pump.c_end.annobin_iostream_pump.c.hot.annobin_iostream_pump.c_end.hot.annobin_iostream_pump.c.unlikely.annobin_iostream_pump.c_end.unlikely.annobin_iostream_pump.c.startup.annobin_iostream_pump.c_end.startup.annobin_iostream_pump.c.exit.annobin_iostream_pump.c_end.exit.annobin_iostream_pump_copy.start.annobin_iostream_pump_copy.endiostream_pump_copyiostream_pump_copy.cold.4__func__.6384.annobin_iostream_pump_flush.start.annobin_iostream_pump_flush.endiostream_pump_flush.annobin_iostream_pump_create.start.annobin_iostream_pump_create.end__func__.6401iostream_pump_create.cold.5.annobin_iostream_pump_start.start.annobin_iostream_pump_start.endiostream_pump_start.cold.6__func__.6405.annobin_iostream_pump_get_input.start.annobin_iostream_pump_get_input.endiostream_pump_get_input.cold.7__func__.6411.annobin_iostream_pump_get_output.start.annobin_iostream_pump_get_output.endiostream_pump_get_output.cold.8.annobin_iostream_pump_set_completion_callback.start.annobin_iostream_pump_set_completion_callback.endiostream_pump_set_completion_callback.cold.9__func__.6421.annobin_iostream_pump_ref.start.annobin_iostream_pump_ref.endiostream_pump_ref.cold.10__func__.6425.annobin_iostream_pump_stop.start.annobin_iostream_pump_stop.endiostream_pump_stop.cold.11__func__.6439.annobin_iostream_pump_unref.start.annobin_iostream_pump_unref.endiostream_pump_unref.cold.12.annobin_iostream_pump_destroy.start.annobin_iostream_pump_destroy.endiostream_pump_destroy.cold.13__func__.6434.annobin_iostream_pump_is_waiting_output.start.annobin_iostream_pump_is_waiting_output.end.annobin_iostream_pump_switch_ioloop_to.start.annobin_iostream_pump_switch_ioloop_to.endiostream_pump_switch_ioloop_to.cold.14__func__.6447.annobin_iostream_pump_switch_ioloop.start.annobin_iostream_pump_switch_ioloop.end.annobin_iostream_proxy.c.annobin_iostream_proxy.c_end.annobin_iostream_proxy.c.hot.annobin_iostream_proxy.c_end.hot.annobin_iostream_proxy.c.unlikely.annobin_iostream_proxy.c_end.unlikely.annobin_iostream_proxy.c.startup.annobin_iostream_proxy.c_end.startup.annobin_iostream_proxy.c.exit.annobin_iostream_proxy.c_end.exit.annobin_iostream_proxy_ltr_completion.start.annobin_iostream_proxy_ltr_completion.endiostream_proxy_ltr_completionCSWTCH.6iostream_proxy_ltr_completion.cold.3.annobin_iostream_proxy_rtl_completion.start.annobin_iostream_proxy_rtl_completion.endiostream_proxy_rtl_completioniostream_proxy_rtl_completion.cold.4.annobin_iostream_proxy_create.start.annobin_iostream_proxy_create.endiostream_proxy_create.cold.5__func__.5653.annobin_iostream_proxy_start.start.annobin_iostream_proxy_start.endiostream_proxy_start.cold.6__func__.5662.annobin_iostream_proxy_set_completion_callback.start.annobin_iostream_proxy_set_completion_callback.endiostream_proxy_set_completion_callback.cold.7__func__.5668.annobin_iostream_proxy_get_istream.start.annobin_iostream_proxy_get_istream.endiostream_proxy_get_istream.cold.8__func__.5673.annobin_iostream_proxy_get_ostream.start.annobin_iostream_proxy_get_ostream.endiostream_proxy_get_ostream.cold.9__func__.5681.annobin_iostream_proxy_ref.start.annobin_iostream_proxy_ref.endiostream_proxy_ref.cold.10__func__.5688.annobin_iostream_proxy_unref.start.annobin_iostream_proxy_unref.endiostream_proxy_unref.cold.11__func__.5693.annobin_iostream_proxy_stop.start.annobin_iostream_proxy_stop.endiostream_proxy_stop.cold.12.annobin_iostream_proxy_is_waiting_output.start.annobin_iostream_proxy_is_waiting_output.end.annobin_iostream_proxy_switch_ioloop.start.annobin_iostream_proxy_switch_ioloop.endiostream_proxy_switch_ioloop.cold.13__func__.5707.annobin_iostream_rawlog.c.annobin_iostream_rawlog.c_end.annobin_iostream_rawlog.c.hot.annobin_iostream_rawlog.c_end.hot.annobin_iostream_rawlog.c.unlikely.annobin_iostream_rawlog.c_end.unlikely.annobin_iostream_rawlog.c.startup.annobin_iostream_rawlog.c_end.startup.annobin_iostream_rawlog.c.exit.annobin_iostream_rawlog.c_end.exit.annobin_iostream_rawlog_create_fd.start.annobin_iostream_rawlog_create_fd.endiostream_rawlog_create_fd.annobin_rawlog_write_timestamp.part.0.start.annobin_rawlog_write_timestamp.part.0.endrawlog_write_timestamp.part.0.annobin_iostream_rawlog_try_create_tcp.part.1.start.annobin_iostream_rawlog_try_create_tcp.part.1.endiostream_rawlog_try_create_tcp.part.1.annobin_iostream_rawlog_init.start.annobin_iostream_rawlog_init.end.annobin_iostream_rawlog_close.start.annobin_iostream_rawlog_close.end.annobin_iostream_rawlog_write.start.annobin_iostream_rawlog_write.end.annobin_iostream_rawlog_create_prefix.start.annobin_iostream_rawlog_create_prefix.endiostream_rawlog_create_prefix.cold.2__func__.7523.annobin_iostream_rawlog_create.start.annobin_iostream_rawlog_create.endcounter.7507.annobin_iostream_rawlog_create_path.start.annobin_iostream_rawlog_create_path.endiostream_rawlog_create_path.cold.3.annobin_iostream_rawlog_create_from_stream.start.annobin_iostream_rawlog_create_from_stream.end.annobin_iostream_temp.c.annobin_iostream_temp.c_end.annobin_iostream_temp.c.hot.annobin_iostream_temp.c_end.hot.annobin_iostream_temp.c.unlikely.annobin_iostream_temp.c_end.unlikely.annobin_iostream_temp.c.startup.annobin_iostream_temp.c_end.startup.annobin_iostream_temp.c.exit.annobin_iostream_temp.c_end.exit.annobin_o_stream_temp_seek.start.annobin_o_stream_temp_seek.endo_stream_temp_seek.annobin_o_stream_temp_close.start.annobin_o_stream_temp_close.endo_stream_temp_close__func__.6641.annobin_iostream_temp_buf_destroyed.start.annobin_iostream_temp_buf_destroyed.endiostream_temp_buf_destroyed.annobin_o_stream_temp_dup_cancel.start.annobin_o_stream_temp_dup_cancel.endo_stream_temp_dup_cancelo_stream_temp_dup_cancel.cold.3.annobin_o_stream_temp_send_istream.start.annobin_o_stream_temp_send_istream.endo_stream_temp_send_istreamo_stream_temp_send_istream.cold.4.annobin_o_stream_temp_write_at.start.annobin_o_stream_temp_write_at.endo_stream_temp_write_at__func__.6718o_stream_temp_write_at.cold.5.annobin_o_stream_temp_move_to_memory.start.annobin_o_stream_temp_move_to_memory.end__func__.6654o_stream_temp_move_to_memory.cold.6.annobin_o_stream_temp_fd_sendv.start.annobin_o_stream_temp_fd_sendv.endo_stream_temp_fd_sendvo_stream_temp_fd_sendv.cold.7__func__.6668.annobin_o_stream_temp_sendv.start.annobin_o_stream_temp_sendv.endo_stream_temp_sendv__func__.6646o_stream_temp_sendv.cold.8__func__.6681.annobin_iostream_temp_create_sized.start.annobin_iostream_temp_create_sized.end.annobin_iostream_temp_create_named.start.annobin_iostream_temp_create_named.end.annobin_iostream_temp_create.start.annobin_iostream_temp_create.end.annobin_iostream_temp_finish.start.annobin_iostream_temp_finish.end.annobin_iso8601_date.c.annobin_iso8601_date.c_end.annobin_iso8601_date.c.hot.annobin_iso8601_date.c_end.hot.annobin_iso8601_date.c.unlikely.annobin_iso8601_date.c_end.unlikely.annobin_iso8601_date.c.startup.annobin_iso8601_date.c_end.startup.annobin_iso8601_date.c.exit.annobin_iso8601_date.c_end.exit.annobin_iso8601_date_parse_number.isra.0.start.annobin_iso8601_date_parse_number.isra.0.endiso8601_date_parse_number.isra.0.annobin_iso8601_date_do_parse.start.annobin_iso8601_date_do_parse.endiso8601_date_do_parse.annobin_iso8601_date_parse.start.annobin_iso8601_date_parse.end.annobin_iso8601_date_parse_tm.start.annobin_iso8601_date_parse_tm.end.annobin_iso8601_date_create_tm.start.annobin_iso8601_date_create_tm.end.annobin_iso8601_date_create.start.annobin_iso8601_date_create.end.annobin_istream.c.annobin_istream.c_end.annobin_istream.c.hot.annobin_istream.c_end.hot.annobin_istream.c.unlikely.annobin_istream.c_end.unlikely.annobin_istream.c.startup.annobin_istream.c_end.startup.annobin_istream.c.exit.annobin_istream.c_end.exit.annobin_i_stream_noop_snapshot.start.annobin_i_stream_noop_snapshot.endi_stream_noop_snapshot.annobin_i_stream_w_buffer_free.start.annobin_i_stream_w_buffer_free.endi_stream_w_buffer_free.annobin_i_stream_default_seek_seekable.start.annobin_i_stream_default_seek_seekable.endi_stream_default_seek_seekable.annobin_i_stream_default_get_size.start.annobin_i_stream_default_get_size.endi_stream_default_get_size.annobin_i_stream_next_line_finish.start.annobin_i_stream_next_line_finish.endi_stream_next_line_finish.annobin_i_stream_last_line.start.annobin_i_stream_last_line.endi_stream_last_line.annobin_i_stream_w_buffer_realloc.start.annobin_i_stream_w_buffer_realloc.endi_stream_w_buffer_realloci_stream_w_buffer_realloc.cold.14__func__.5944.annobin_i_stream_set_name.start.annobin_i_stream_set_name.end.annobin_i_stream_get_name.start.annobin_i_stream_get_name.end.annobin_i_stream_default_snapshot.start.annobin_i_stream_default_snapshot.endi_stream_default_snapshot.cold.15__func__.5772.annobin_i_stream_ref.start.annobin_i_stream_ref.end.annobin_i_stream_add_destroy_callback.start.annobin_i_stream_add_destroy_callback.end.annobin_i_stream_remove_destroy_callback.start.annobin_i_stream_remove_destroy_callback.end.annobin_i_stream_get_fd.start.annobin_i_stream_get_fd.end.annobin_i_stream_copy_fd.start.annobin_i_stream_copy_fd.endi_stream_copy_fd.cold.16.annobin_i_stream_get_error.start.annobin_i_stream_get_error.end.annobin_i_stream_get_disconnect_reason.start.annobin_i_stream_get_disconnect_reason.end.annobin_i_stream_close.start.annobin_i_stream_close.end.annobin_i_stream_default_close.start.annobin_i_stream_default_close.endi_stream_default_close.annobin_i_stream_set_init_buffer_size.start.annobin_i_stream_set_init_buffer_size.end.annobin_i_stream_set_max_buffer_size.start.annobin_i_stream_set_max_buffer_size.end.annobin_i_stream_default_set_max_buffer_size.start.annobin_i_stream_default_set_max_buffer_size.endi_stream_default_set_max_buffer_size.annobin_i_stream_get_max_buffer_size.start.annobin_i_stream_get_max_buffer_size.end.annobin_i_stream_set_return_partial_line.start.annobin_i_stream_set_return_partial_line.end.annobin_i_stream_set_persistent_buffers.start.annobin_i_stream_set_persistent_buffers.end.annobin_i_stream_set_blocking.start.annobin_i_stream_set_blocking.end.annobin_i_stream_snapshot_free.start.annobin_i_stream_snapshot_free.endi_stream_snapshot_free.localalias.11.annobin_i_stream_unref.start.annobin_i_stream_unref.endi_stream_unref.localalias.12i_stream_unref.cold.17.annobin_i_stream_destroy.start.annobin_i_stream_destroy.end.annobin_i_stream_get_last_read_time.start.annobin_i_stream_get_last_read_time.end.annobin_i_stream_free_buffer.start.annobin_i_stream_free_buffer.end.annobin_i_stream_default_destroy.start.annobin_i_stream_default_destroy.endi_stream_default_destroy.annobin_i_stream_skip.start.annobin_i_stream_skip.end.annobin_i_stream_seek.start.annobin_i_stream_seek.end.annobin_i_stream_read_memarea.start.annobin_i_stream_read_memarea.end__func__.5793i_stream_read_memarea.cold.18.annobin_i_stream_read.start.annobin_i_stream_read.end.annobin_i_stream_default_seek_nonseekable.start.annobin_i_stream_default_seek_nonseekable.end.annobin_i_stream_seek_mark.start.annobin_i_stream_seek_mark.end.annobin_i_stream_sync.start.annobin_i_stream_sync.end.annobin_i_stream_stat.start.annobin_i_stream_stat.end.annobin_i_stream_get_size.start.annobin_i_stream_get_size.end.annobin_i_stream_get_absolute_offset.start.annobin_i_stream_get_absolute_offset.end.annobin_i_stream_next_line.start.annobin_i_stream_next_line.end.annobin_i_stream_last_line_crlf.start.annobin_i_stream_last_line_crlf.end.annobin_i_stream_get_data.start.annobin_i_stream_get_data.end.annobin_i_stream_read_more_memarea.start.annobin_i_stream_read_more_memarea.end.annobin_i_stream_read_copy_from_parent.start.annobin_i_stream_read_copy_from_parent.endi_stream_read_copy_from_parent.cold.19__func__.5817.annobin_i_stream_get_data_size.start.annobin_i_stream_get_data_size.end.annobin_i_stream_have_bytes_left.start.annobin_i_stream_have_bytes_left.end.annobin_i_stream_read_eof.start.annobin_i_stream_read_eof.end.annobin_i_stream_read_next_line.start.annobin_i_stream_read_next_line.end.annobin_i_stream_default_stat.start.annobin_i_stream_default_stat.endi_stream_default_stati_stream_default_stat.cold.20__func__.6054.annobin_i_stream_get_modifiable_data.start.annobin_i_stream_get_modifiable_data.end.annobin_i_stream_read_data.start.annobin_i_stream_read_data.endi_stream_read_data.cold.21__func__.5923.annobin_i_stream_read_limited.start.annobin_i_stream_read_limited.endi_stream_read_limited.cold.22__func__.5475.annobin_i_stream_compress.start.annobin_i_stream_compress.endi_stream_compress.cold.23__func__.5935.annobin_i_stream_grow_buffer.start.annobin_i_stream_grow_buffer.endi_stream_grow_buffer.cold.24.annobin_i_stream_try_alloc.start.annobin_i_stream_try_alloc.endi_stream_try_alloc.cold.25.annobin_i_stream_try_alloc_avoid_compress.start.annobin_i_stream_try_alloc_avoid_compress.end.annobin_i_stream_alloc.start.annobin_i_stream_alloc.endi_stream_alloc.cold.26__func__.5973.annobin_i_stream_memarea_detach.start.annobin_i_stream_memarea_detach.end.annobin_i_stream_add_data.start.annobin_i_stream_add_data.end.annobin_i_stream_get_root_io.start.annobin_i_stream_get_root_io.endi_stream_get_root_io.cold.27.annobin_i_stream_set_input_pending.start.annobin_i_stream_set_input_pending.end.annobin_i_stream_switch_ioloop_to.start.annobin_i_stream_switch_ioloop_to.end.annobin_i_stream_switch_ioloop.start.annobin_i_stream_switch_ioloop.end.annobin_i_stream_set_io.start.annobin_i_stream_set_io.endi_stream_set_io.cold.28__func__.6008.annobin_i_stream_unset_io.start.annobin_i_stream_unset_io.endi_stream_unset_io.cold.29__func__.6013.annobin_i_stream_nonseekable_try_seek.start.annobin_i_stream_nonseekable_try_seek.end.annobin_i_stream_init_parent.start.annobin_i_stream_init_parent.end.annobin_i_stream_create.start.annobin_i_stream_create.end.annobin_i_stream_create_error.start.annobin_i_stream_create_error.end.annobin_i_stream_create_error_str.start.annobin_i_stream_create_error_str.end.annobin_istream_base64_decoder.c.annobin_istream_base64_decoder.c_end.annobin_istream_base64_decoder.c.hot.annobin_istream_base64_decoder.c_end.hot.annobin_istream_base64_decoder.c.unlikely.annobin_istream_base64_decoder.c_end.unlikely.annobin_istream_base64_decoder.c.startup.annobin_istream_base64_decoder.c_end.startup.annobin_istream_base64_decoder.c.exit.annobin_istream_base64_decoder.c_end.exit.annobin_i_stream_base64_decoder_seek.start.annobin_i_stream_base64_decoder_seek.endi_stream_base64_decoder_seek.annobin_i_stream_base64_decoder_read.start.annobin_i_stream_base64_decoder_read.endi_stream_base64_decoder_readi_stream_base64_decoder_read.cold.3__func__.5345__func__.5359__func__.5372.annobin_i_stream_create_base64_decoder_common.start.annobin_i_stream_create_base64_decoder_common.endi_stream_create_base64_decoder_common.annobin_i_stream_create_base64_decoder.start.annobin_i_stream_create_base64_decoder.end.annobin_i_stream_create_base64url_decoder.start.annobin_i_stream_create_base64url_decoder.end.annobin_istream_base64_encoder.c.annobin_istream_base64_encoder.c_end.annobin_istream_base64_encoder.c.hot.annobin_istream_base64_encoder.c_end.hot.annobin_istream_base64_encoder.c.unlikely.annobin_istream_base64_encoder.c_end.unlikely.annobin_istream_base64_encoder.c.startup.annobin_istream_base64_encoder.c_end.startup.annobin_istream_base64_encoder.c.exit.annobin_istream_base64_encoder.c_end.exit.annobin_i_stream_base64_encoder_stat.start.annobin_i_stream_base64_encoder_stat.endi_stream_base64_encoder_stat.annobin_i_stream_base64_encoder_seek.start.annobin_i_stream_base64_encoder_seek.endi_stream_base64_encoder_seek.annobin_i_stream_base64_encoder_read.start.annobin_i_stream_base64_encoder_read.endi_stream_base64_encoder_readi_stream_base64_encoder_read.cold.3__func__.5353__func__.5344.annobin_i_stream_create_base64_encoder_common.start.annobin_i_stream_create_base64_encoder_common.endi_stream_create_base64_encoder_commoni_stream_create_base64_encoder_common.cold.4__func__.5387.annobin_i_stream_create_base64_encoder.start.annobin_i_stream_create_base64_encoder.end.annobin_i_stream_create_base64url_encoder.start.annobin_i_stream_create_base64url_encoder.end.annobin_istream_callback.c.annobin_istream_callback.c_end.annobin_istream_callback.c.hot.annobin_istream_callback.c_end.hot.annobin_istream_callback.c.unlikely.annobin_istream_callback.c_end.unlikely.annobin_istream_callback.c.startup.annobin_istream_callback.c_end.startup.annobin_istream_callback.c.exit.annobin_istream_callback.c_end.exit.annobin_i_stream_callback_read.start.annobin_i_stream_callback_read.endi_stream_callback_readi_stream_callback_read.cold.1__func__.5144.annobin_i_stream_callback_destroy.start.annobin_i_stream_callback_destroy.endi_stream_callback_destroy.annobin_i_stream_create_callback.start.annobin_i_stream_create_callback.endi_stream_create_callback.cold.2__func__.5151.annobin_i_stream_callback_append.start.annobin_i_stream_callback_append.end.annobin_i_stream_callback_append_str.start.annobin_i_stream_callback_append_str.end.annobin_i_stream_callback_get_buffer.start.annobin_i_stream_callback_get_buffer.end.annobin_i_stream_callback_set_error.start.annobin_i_stream_callback_set_error.end.annobin_istream_chain.c.annobin_istream_chain.c_end.annobin_istream_chain.c.hot.annobin_istream_chain.c_end.hot.annobin_istream_chain.c.unlikely.annobin_istream_chain.c_end.unlikely.annobin_istream_chain.c.startup.annobin_istream_chain.c_end.startup.annobin_istream_chain.c.exit.annobin_istream_chain.c_end.exit.annobin_i_stream_chain_set_max_buffer_size.start.annobin_i_stream_chain_set_max_buffer_size.endi_stream_chain_set_max_buffer_size.annobin_i_stream_chain_skip.start.annobin_i_stream_chain_skip.endi_stream_chain_skip__func__.5075i_stream_chain_skip.cold.2.annobin_i_stream_chain_read.start.annobin_i_stream_chain_read.endi_stream_chain_read__func__.5087i_stream_chain_read.cold.3__func__.5068.annobin_i_stream_chain_destroy.start.annobin_i_stream_chain_destroy.endi_stream_chain_destroy.annobin_i_stream_chain_snapshot.start.annobin_i_stream_chain_snapshot.endi_stream_chain_snapshoti_stream_chain_snapshot.cold.4__func__.5101.annobin_i_stream_chain_close.start.annobin_i_stream_chain_close.endi_stream_chain_close.annobin_i_stream_chain_append_internal.start.annobin_i_stream_chain_append_internal.endi_stream_chain_append_internal.annobin_i_stream_chain_append.start.annobin_i_stream_chain_append.end.annobin_i_stream_chain_append_eof.start.annobin_i_stream_chain_append_eof.end.annobin_i_stream_create_chain.start.annobin_i_stream_create_chain.end.annobin_istream_concat.c.annobin_istream_concat.c_end.annobin_istream_concat.c.hot.annobin_istream_concat.c_end.hot.annobin_istream_concat.c.unlikely.annobin_istream_concat.c_end.unlikely.annobin_istream_concat.c.startup.annobin_istream_concat.c_end.startup.annobin_istream_concat.c.exit.annobin_istream_concat.c_end.exit.annobin_find_v_offset.start.annobin_find_v_offset.endfind_v_offset.annobin_i_stream_concat_seek.start.annobin_i_stream_concat_seek.endi_stream_concat_seeki_stream_concat_seek.cold.4__func__.5221.annobin_i_stream_concat_skip.start.annobin_i_stream_concat_skip.endi_stream_concat_skipi_stream_concat_skip.cold.5__func__.5191.annobin_i_stream_concat_read.start.annobin_i_stream_concat_read.endi_stream_concat_readi_stream_concat_read.cold.6__func__.5185__func__.5196.annobin_i_stream_concat_stat.start.annobin_i_stream_concat_stat.endi_stream_concat_stati_stream_concat_stat.cold.7__func__.5227.annobin_i_stream_concat_set_max_buffer_size.start.annobin_i_stream_concat_set_max_buffer_size.endi_stream_concat_set_max_buffer_sizei_stream_concat_set_max_buffer_size.cold.8__func__.5173.annobin_i_stream_concat_destroy.start.annobin_i_stream_concat_destroy.endi_stream_concat_destroyi_stream_concat_destroy.cold.9__func__.5163.annobin_i_stream_concat_close.start.annobin_i_stream_concat_close.endi_stream_concat_closei_stream_concat_close.cold.10__func__.5154.annobin_i_stream_create_concat.start.annobin_i_stream_create_concat.end__func__.5243i_stream_create_concat.cold.11.annobin_istream_crlf.c.annobin_istream_crlf.c_end.annobin_istream_crlf.c.hot.annobin_istream_crlf.c_end.hot.annobin_istream_crlf.c.unlikely.annobin_istream_crlf.c_end.unlikely.annobin_istream_crlf.c.startup.annobin_istream_crlf.c_end.startup.annobin_istream_crlf.c.exit.annobin_istream_crlf.c_end.exit.annobin_i_stream_crlf_read_common.start.annobin_i_stream_crlf_read_common.endi_stream_crlf_read_commoni_stream_crlf_read_common.cold.3__func__.5000.annobin_i_stream_crlf_read_lf.start.annobin_i_stream_crlf_read_lf.endi_stream_crlf_read_lfi_stream_crlf_read_lf.cold.4__func__.5033.annobin_i_stream_crlf_read_crlf.start.annobin_i_stream_crlf_read_crlf.endi_stream_crlf_read_crlfi_stream_crlf_read_crlf.cold.5.annobin_i_stream_create_crlf_full.start.annobin_i_stream_create_crlf_full.endi_stream_create_crlf_full.annobin_i_stream_create_crlf.start.annobin_i_stream_create_crlf.end.annobin_i_stream_create_lf.start.annobin_i_stream_create_lf.end.annobin_istream_data.c.annobin_istream_data.c_end.annobin_istream_data.c.hot.annobin_istream_data.c_end.hot.annobin_istream_data.c.unlikely.annobin_istream_data.c_end.unlikely.annobin_istream_data.c.startup.annobin_istream_data.c_end.startup.annobin_istream_data.c.exit.annobin_istream_data.c_end.exit.annobin_i_stream_data_read.start.annobin_i_stream_data_read.endi_stream_data_read.annobin_i_stream_data_seek.start.annobin_i_stream_data_seek.endi_stream_data_seek.annobin_i_stream_copied_data_free.start.annobin_i_stream_copied_data_free.endi_stream_copied_data_free.annobin_i_stream_create_from_data.start.annobin_i_stream_create_from_data.end.annobin_i_stream_create_copy_from_data.start.annobin_i_stream_create_copy_from_data.end.annobin_istream_failure_at.c.annobin_istream_failure_at.c_end.annobin_istream_failure_at.c.hot.annobin_istream_failure_at.c_end.hot.annobin_istream_failure_at.c.unlikely.annobin_istream_failure_at.c_end.unlikely.annobin_istream_failure_at.c.startup.annobin_istream_failure_at.c_end.startup.annobin_istream_failure_at.c.exit.annobin_istream_failure_at.c_end.exit.annobin_i_stream_failure_at_destroy.start.annobin_i_stream_failure_at_destroy.endi_stream_failure_at_destroy.annobin_i_stream_failure_at_read.start.annobin_i_stream_failure_at_read.endi_stream_failure_at_readi_stream_failure_at_read.cold.1__func__.5009.annobin_i_stream_create_failure_at.start.annobin_i_stream_create_failure_at.end.annobin_i_stream_create_failure_at_eof.start.annobin_i_stream_create_failure_at_eof.end.annobin_istream_file.c.annobin_istream_file.c_end.annobin_istream_file.c.hot.annobin_istream_file.c_end.hot.annobin_istream_file.c.unlikely.annobin_istream_file.c_end.unlikely.annobin_istream_file.c.startup.annobin_istream_file.c_end.startup.annobin_istream_file.c.exit.annobin_istream_file.c_end.exit.annobin_i_stream_file_sync.start.annobin_i_stream_file_sync.endi_stream_file_sync.annobin_i_stream_file_close.start.annobin_i_stream_file_close.end.annobin_i_stream_file_seek.start.annobin_i_stream_file_seek.endi_stream_file_seeki_stream_file_seek.cold.1.annobin_i_stream_file_read.start.annobin_i_stream_file_read.endi_stream_file_read.cold.2__func__.7092.annobin_i_stream_file_stat.start.annobin_i_stream_file_stat.endi_stream_file_stat.annobin_i_stream_create_file_common.start.annobin_i_stream_create_file_common.endi_stream_create_file_common.cold.3__func__.7119.annobin_i_stream_create_fd.start.annobin_i_stream_create_fd.endi_stream_create_fd.cold.4__func__.7125.annobin_i_stream_create_fd_autoclose.start.annobin_i_stream_create_fd_autoclose.endi_stream_create_fd_autoclose.cold.5__func__.7132.annobin_i_stream_create_file.start.annobin_i_stream_create_file.end.annobin_istream_hash.c.annobin_istream_hash.c_end.annobin_istream_hash.c.hot.annobin_istream_hash.c_end.hot.annobin_istream_hash.c.unlikely.annobin_istream_hash.c_end.unlikely.annobin_istream_hash.c.startup.annobin_istream_hash.c_end.startup.annobin_istream_hash.c.exit.annobin_istream_hash.c_end.exit.annobin_i_stream_hash_seek.start.annobin_i_stream_hash_seek.endi_stream_hash_seek.annobin_i_stream_hash_read.start.annobin_i_stream_hash_read.endi_stream_hash_readi_stream_hash_read.cold.1__func__.5161.annobin_i_stream_create_hash.start.annobin_i_stream_create_hash.end.annobin_istream_jsonstr.c.annobin_istream_jsonstr.c_end.annobin_istream_jsonstr.c.hot.annobin_istream_jsonstr.c_end.hot.annobin_istream_jsonstr.c.unlikely.annobin_istream_jsonstr.c_end.unlikely.annobin_istream_jsonstr.c.startup.annobin_istream_jsonstr.c_end.startup.annobin_istream_jsonstr.c.exit.annobin_istream_jsonstr.c_end.exit.annobin_i_stream_jsonstr_read_parent.start.annobin_i_stream_jsonstr_read_parent.endi_stream_jsonstr_read_parent.annobin_i_stream_jsonstr_read.start.annobin_i_stream_jsonstr_read.endi_stream_jsonstr_readi_stream_jsonstr_read.cold.2__func__.5249.annobin_i_stream_create_jsonstr.start.annobin_i_stream_create_jsonstr.end.annobin_istream_limit.c.annobin_istream_limit.c_end.annobin_istream_limit.c.hot.annobin_istream_limit.c_end.hot.annobin_istream_limit.c.unlikely.annobin_istream_limit.c_end.unlikely.annobin_istream_limit.c.startup.annobin_istream_limit.c_end.startup.annobin_istream_limit.c.exit.annobin_istream_limit.c_end.exit.annobin_i_stream_limit_stat.start.annobin_i_stream_limit_stat.endi_stream_limit_stat.annobin_i_stream_limit_destroy.start.annobin_i_stream_limit_destroy.endi_stream_limit_destroy.annobin_i_stream_limit_read.start.annobin_i_stream_limit_read.endi_stream_limit_readi_stream_limit_read.cold.2__func__.5001.annobin_i_stream_limit_get_size.start.annobin_i_stream_limit_get_size.endi_stream_limit_get_size.annobin_i_stream_create_limit.start.annobin_i_stream_create_limit.end.annobin_i_stream_create_range.start.annobin_i_stream_create_range.end.annobin_istream_multiplex.c.annobin_istream_multiplex.c_end.annobin_istream_multiplex.c.hot.annobin_istream_multiplex.c_end.hot.annobin_istream_multiplex.c.unlikely.annobin_istream_multiplex.c_end.unlikely.annobin_istream_multiplex.c.startup.annobin_istream_multiplex.c_end.startup.annobin_istream_multiplex.c.exit.annobin_istream_multiplex.c_end.exit.annobin_i_stream_multiplex_ichannel_close.start.annobin_i_stream_multiplex_ichannel_close.endi_stream_multiplex_ichannel_close.annobin_i_stream_multiplex_ichannel_destroy.start.annobin_i_stream_multiplex_ichannel_destroy.endi_stream_multiplex_ichannel_destroy.annobin_i_stream_multiplex_ichannel_switch_ioloop_to.start.annobin_i_stream_multiplex_ichannel_switch_ioloop_to.endi_stream_multiplex_ichannel_switch_ioloop_to.annobin_i_stream_add_channel_real.start.annobin_i_stream_add_channel_real.endi_stream_add_channel_reali_stream_multiplex_ichannel_read.annobin_get_channel.start.annobin_get_channel.endget_channelget_channel.cold.6.annobin_propagate_eof.isra.3.start.annobin_propagate_eof.isra.3.endpropagate_eof.isra.3.annobin_i_stream_multiplex_ichannel_read.start.annobin_i_stream_multiplex_ichannel_read.endi_stream_multiplex_read.annobin_i_stream_multiplex_read.start.annobin_i_stream_multiplex_read.endi_stream_multiplex_read.cold.7__func__.5642.annobin_i_stream_multiplex_add_channel.start.annobin_i_stream_multiplex_add_channel.endi_stream_multiplex_add_channel.cold.8__func__.5694.annobin_i_stream_create_multiplex.start.annobin_i_stream_create_multiplex.end.annobin_i_stream_multiplex_get_channel_id.start.annobin_i_stream_multiplex_get_channel_id.end.annobin_istream_rawlog.c.annobin_istream_rawlog.c_end.annobin_istream_rawlog.c.hot.annobin_istream_rawlog.c_end.hot.annobin_istream_rawlog.c.unlikely.annobin_istream_rawlog.c_end.unlikely.annobin_istream_rawlog.c.startup.annobin_istream_rawlog.c_end.startup.annobin_istream_rawlog.c.exit.annobin_istream_rawlog.c_end.exit.annobin_i_stream_rawlog_destroy.start.annobin_i_stream_rawlog_destroy.endi_stream_rawlog_destroy.annobin_i_stream_rawlog_close.start.annobin_i_stream_rawlog_close.endi_stream_rawlog_close.annobin_i_stream_rawlog_read.start.annobin_i_stream_rawlog_read.endi_stream_rawlog_readi_stream_rawlog_read.cold.1__func__.5534.annobin_i_stream_create_rawlog_from_stream.start.annobin_i_stream_create_rawlog_from_stream.end.annobin_i_stream_create_rawlog.start.annobin_i_stream_create_rawlog.endi_stream_create_rawlog.cold.2__func__.5543.annobin_istream_seekable.c.annobin_istream_seekable.c_end.annobin_istream_seekable.c.hot.annobin_istream_seekable.c_end.hot.annobin_istream_seekable.c.unlikely.annobin_istream_seekable.c_end.unlikely.annobin_istream_seekable.c.startup.annobin_istream_seekable.c_end.startup.annobin_istream_seekable.c.exit.annobin_istream_seekable.c_end.exit.annobin_i_stream_seekable_seek.start.annobin_i_stream_seekable_seek.endi_stream_seekable_seek.annobin_i_stream_seekable_set_max_buffer_size.start.annobin_i_stream_seekable_set_max_buffer_size.endi_stream_seekable_set_max_buffer_size.annobin_i_stream_seekable_destroy.start.annobin_i_stream_seekable_destroy.endi_stream_seekable_destroy.annobin_i_stream_seekable_close.start.annobin_i_stream_seekable_close.endi_stream_seekable_close.annobin_seekable_fd_callback.start.annobin_seekable_fd_callback.endseekable_fd_callback.annobin_i_stream_seekable_snapshot.start.annobin_i_stream_seekable_snapshot.endi_stream_seekable_snapshot.annobin_read_more.part.2.start.annobin_read_more.part.2.endread_more.part.2.annobin_read_from_buffer.start.annobin_read_from_buffer.endread_from_bufferread_from_buffer.cold.6__func__.6176.annobin_i_stream_seekable_read.start.annobin_i_stream_seekable_read.endi_stream_seekable_read__func__.6156i_stream_seekable_read.cold.7__func__.6194__func__.6185.annobin_i_stream_seekable_stat.start.annobin_i_stream_seekable_stat.endi_stream_seekable_stati_stream_seekable_stat.cold.8__func__.6206.annobin_i_streams_merge.start.annobin_i_streams_merge.end__func__.6230i_streams_merge.cold.9.annobin_i_stream_create_seekable.start.annobin_i_stream_create_seekable.endi_stream_create_seekable.cold.10.annobin_i_stream_create_seekable_path.start.annobin_i_stream_create_seekable_path.endi_stream_create_seekable_path.cold.11.annobin_istream_sized.c.annobin_istream_sized.c_end.annobin_istream_sized.c.hot.annobin_istream_sized.c_end.hot.annobin_istream_sized.c.unlikely.annobin_istream_sized.c_end.unlikely.annobin_istream_sized.c.startup.annobin_istream_sized.c_end.startup.annobin_istream_sized.c.exit.annobin_istream_sized.c_end.exit.annobin_i_stream_create_sized_default_error_callback.start.annobin_i_stream_create_sized_default_error_callback.endi_stream_create_sized_default_error_callback.annobin_i_stream_sized_stat.start.annobin_i_stream_sized_stat.endi_stream_sized_stat.annobin_i_stream_sized_destroy.start.annobin_i_stream_sized_destroy.endi_stream_sized_destroy.annobin_i_stream_sized_parent_read.start.annobin_i_stream_sized_parent_read.endi_stream_sized_parent_read.annobin_i_stream_sized_read.start.annobin_i_stream_sized_read.endi_stream_sized_readi_stream_sized_read.cold.1.annobin_i_stream_create_sized_common.start.annobin_i_stream_create_sized_common.endi_stream_create_sized_common.annobin_i_stream_create_sized.start.annobin_i_stream_create_sized.end.annobin_i_stream_create_sized_range.start.annobin_i_stream_create_sized_range.end.annobin_i_stream_create_min_sized.start.annobin_i_stream_create_min_sized.end.annobin_i_stream_create_min_sized_range.start.annobin_i_stream_create_min_sized_range.end.annobin_i_stream_create_sized_with_callback.start.annobin_i_stream_create_sized_with_callback.end.annobin_istream_tee.c.annobin_istream_tee.c_end.annobin_istream_tee.c.hot.annobin_istream_tee.c_end.hot.annobin_istream_tee.c.unlikely.annobin_istream_tee.c_end.unlikely.annobin_istream_tee.c.startup.annobin_istream_tee.c_end.startup.annobin_istream_tee.c.exit.annobin_istream_tee.c_end.exit.annobin_i_stream_tee_stat.start.annobin_i_stream_tee_stat.endi_stream_tee_stat.annobin_i_stream_tee_set_max_buffer_size.start.annobin_i_stream_tee_set_max_buffer_size.endi_stream_tee_set_max_buffer_size.annobin_tee_streams_update_buffer.isra.0.start.annobin_tee_streams_update_buffer.isra.0.endtee_streams_update_buffer.isra.0tee_streams_update_buffer.isra.0.cold.1__func__.5008.annobin_tee_streams_skip.start.annobin_tee_streams_skip.endtee_streams_skip.annobin_i_stream_tee_sync.start.annobin_i_stream_tee_sync.endi_stream_tee_synci_stream_tee_sync.cold.2.annobin_i_stream_tee_destroy.start.annobin_i_stream_tee_destroy.endi_stream_tee_destroyi_stream_tee_destroy.cold.3__func__.5034.annobin_i_stream_tee_close.start.annobin_i_stream_tee_close.endi_stream_tee_close.annobin_i_stream_tee_read.start.annobin_i_stream_tee_read.endi_stream_tee_readi_stream_tee_read.cold.4__func__.5049.annobin_tee_i_stream_create.start.annobin_tee_i_stream_create.end.annobin_tee_i_stream_create_child.start.annobin_tee_i_stream_create_child.end.annobin_tee_i_stream_child_is_waiting.start.annobin_tee_i_stream_child_is_waiting.end.annobin_istream_try.c.annobin_istream_try.c_end.annobin_istream_try.c.hot.annobin_istream_try.c_end.hot.annobin_istream_try.c.unlikely.annobin_istream_try.c_end.unlikely.annobin_istream_try.c.startup.annobin_istream_try.c_end.startup.annobin_istream_try.c.exit.annobin_istream_try.c_end.exit.annobin_i_stream_unref_try_inputs.isra.1.start.annobin_i_stream_unref_try_inputs.isra.1.endi_stream_unref_try_inputs.isra.1.annobin_i_stream_try_read.start.annobin_i_stream_try_read.endi_stream_try_read.annobin_i_stream_try_close.start.annobin_i_stream_try_close.endi_stream_try_close.annobin_istream_try_create.start.annobin_istream_try_create.end.annobin_istream_timeout.c.annobin_istream_timeout.c_end.annobin_istream_timeout.c.hot.annobin_istream_timeout.c_end.hot.annobin_istream_timeout.c.unlikely.annobin_istream_timeout.c_end.unlikely.annobin_istream_timeout.c.startup.annobin_istream_timeout.c_end.startup.annobin_istream_timeout.c.exit.annobin_istream_timeout.c_end.exit.annobin_i_stream_timeout_close.start.annobin_i_stream_timeout_close.endi_stream_timeout_close.annobin_i_stream_timeout.start.annobin_i_stream_timeout.endi_stream_timeout.annobin_i_stream_timeout_read.start.annobin_i_stream_timeout_read.endi_stream_timeout_read.annobin_i_stream_timeout_switch_ioloop_to.start.annobin_i_stream_timeout_switch_ioloop_to.endi_stream_timeout_switch_ioloop_to.annobin_i_stream_create_timeout.start.annobin_i_stream_create_timeout.end.annobin_istream_unix.c.annobin_istream_unix.c_end.annobin_istream_unix.c.hot.annobin_istream_unix.c_end.hot.annobin_istream_unix.c.unlikely.annobin_istream_unix.c_end.unlikely.annobin_istream_unix.c.startup.annobin_istream_unix.c_end.startup.annobin_istream_unix.c.exit.annobin_istream_unix.c_end.exit.annobin_i_stream_unix_close.start.annobin_i_stream_unix_close.endi_stream_unix_close__func__.5030.annobin_i_stream_unix_read.start.annobin_i_stream_unix_read.endi_stream_unix_readi_stream_unix_read.cold.2.annobin_i_stream_create_unix.start.annobin_i_stream_create_unix.endi_stream_create_unix.cold.3__func__.5044.annobin_i_stream_unix_set_read_fd.start.annobin_i_stream_unix_set_read_fd.end.annobin_i_stream_unix_unset_read_fd.start.annobin_i_stream_unix_unset_read_fd.end.annobin_i_stream_unix_get_read_fd.start.annobin_i_stream_unix_get_read_fd.end.annobin_ioloop.c.annobin_ioloop.c_end.annobin_ioloop.c.hot.annobin_ioloop.c_end.hot.annobin_ioloop.c.unlikely.annobin_ioloop.c_end.unlikely.annobin_ioloop.c.startup.annobin_ioloop.c_end.startup.annobin_ioloop.c.exit.annobin_ioloop.c_end.exit.annobin_timeout_update_next.start.annobin_timeout_update_next.endtimeout_update_next.annobin_timeout_get_wait_time.start.annobin_timeout_get_wait_time.endtimeout_get_wait_timetimeout_get_wait_time.cold.18.annobin_timeout_cmp.start.annobin_timeout_cmp.end.annobin_io_loop_get_wait_time.start.annobin_io_loop_get_wait_time.endio_loop_get_wait_timeio_loop_get_wait_time.cold.19__func__.6793.annobin_io_loop_default_time_moved.start.annobin_io_loop_default_time_moved.endio_loop_default_time_moved.annobin_io_switch_callbacks_free.start.annobin_io_switch_callbacks_free.endio_switch_callbacks_freeio_switch_callbacks.annobin_io_destroy_callbacks_free.start.annobin_io_destroy_callbacks_free.endio_destroy_callbacks_freeio_destroy_callbacks.annobin_io_loop_timeouts_update.isra.11.start.annobin_io_loop_timeouts_update.isra.11.endio_loop_timeouts_update.isra.11.annobin_io_set_pending.start.annobin_io_set_pending.endio_set_pending.cold.20__func__.6683.annobin_io_is_pending.start.annobin_io_is_pending.end.annobin_io_set_never_wait_alone.start.annobin_io_set_never_wait_alone.end.annobin_timeout_reset.start.annobin_timeout_reset.endtimeout_reset.cold.21__func__.6776.annobin_io_loop_run_get_wait_time.start.annobin_io_loop_run_get_wait_time.end.annobin_io_loop_stop.start.annobin_io_loop_stop.end.annobin_io_loop_stop_delayed.start.annobin_io_loop_stop_delayed.end.annobin_io_loop_set_running.start.annobin_io_loop_set_running.end.annobin_io_loop_set_max_fd_count.start.annobin_io_loop_set_max_fd_count.end.annobin_io_loop_is_running.start.annobin_io_loop_is_running.end.annobin_io_loop_time_refresh.start.annobin_io_loop_time_refresh.end.annobin_io_loop_set_time_moved_callback.start.annobin_io_loop_set_time_moved_callback.end.annobin_io_loop_set_current.start.annobin_io_loop_set_current.endio_loop_set_current.cold.22.annobin_io_loop_create.start.annobin_io_loop_create.endpanic_on_leak_setpanic_on_leak.annobin_io_loop_get_root.start.annobin_io_loop_get_root.end.annobin_io_loop_add_switch_callback.start.annobin_io_loop_add_switch_callback.end.annobin_io_loop_remove_switch_callback.start.annobin_io_loop_remove_switch_callback.endio_loop_remove_switch_callback.cold.23.annobin_io_loop_add_destroy_callback.start.annobin_io_loop_add_destroy_callback.end.annobin_io_loop_remove_destroy_callback.start.annobin_io_loop_remove_destroy_callback.endio_loop_remove_destroy_callback.cold.24.annobin_io_loop_context_new.start.annobin_io_loop_context_new.end.annobin_io_loop_context_ref.start.annobin_io_loop_context_ref.endio_loop_context_ref.cold.25__func__.7017.annobin_io_add_file.start.annobin_io_add_file.endio_add_fileio_add_file.cold.26.annobin_io_add_to.start.annobin_io_add_to.endio_add_to.cold.27__func__.6637.annobin_io_add.start.annobin_io_add.end.annobin_io_add_istream_to.start.annobin_io_add_istream_to.end.annobin_io_add_istream.start.annobin_io_add_istream.end.annobin_timeout_add_common.start.annobin_timeout_add_common.endtimeout_add_common.annobin_timeout_add_to.start.annobin_timeout_add_to.end.annobin_timeout_add.start.annobin_timeout_add.end.annobin_timeout_add_short.start.annobin_timeout_add_short.end.annobin_timeout_add_short_to.start.annobin_timeout_add_short_to.end.annobin_timeout_add_absolute_to.start.annobin_timeout_add_absolute_to.end.annobin_timeout_add_absolute.start.annobin_timeout_add_absolute.end.annobin_io_loop_context_unref.start.annobin_io_loop_context_unref.endio_loop_context_unref.cold.28__func__.7022.annobin_io_remove_full.start.annobin_io_remove_full.endio_remove_fullio_remove_full.cold.29__func__.6670.annobin_io_remove.start.annobin_io_remove.end.annobin_io_remove_closed.start.annobin_io_remove_closed.endio_remove_closed.cold.30__func__.6679.annobin_timeout_free.start.annobin_timeout_free.endtimeout_free.annobin_timeout_remove.start.annobin_timeout_remove.end.annobin_io_loop_context_add_callbacks.start.annobin_io_loop_context_add_callbacks.end.annobin_io_loop_context_remove_callbacks.start.annobin_io_loop_context_remove_callbacks.endio_loop_context_remove_callbacks.cold.31.annobin_io_loop_context_activate.start.annobin_io_loop_context_activate.endio_loop_context_activate.cold.32__func__.7071.annobin_io_loop_context_deactivate.start.annobin_io_loop_context_deactivate.endio_loop_context_deactivate.cold.33__func__.7081__func__.7063.annobin_io_loop_handle_timeouts.start.annobin_io_loop_handle_timeouts.enddata_stack_last_free_unusedio_loop_handle_timeouts.cold.34__func__.6862.annobin_io_loop_call_io.start.annobin_io_loop_call_io.endio_loop_call_io.cold.35__func__.6876.annobin_io_loop_handler_run.start.annobin_io_loop_handler_run.endio_loop_handler_run.cold.36__func__.6823__func__.6896.annobin_io_loop_run.start.annobin_io_loop_run.endio_loop_run.cold.37__func__.6880.annobin_io_loop_context_switch.start.annobin_io_loop_context_switch.end.annobin_io_loop_get_current_context.start.annobin_io_loop_get_current_context.end.annobin_io_loop_move_io_to.start.annobin_io_loop_move_io_to.endio_loop_move_io_to.cold.38__func__.7100.annobin_io_loop_move_io.start.annobin_io_loop_move_io.end.annobin_io_loop_move_timeout_to.start.annobin_io_loop_move_timeout_to.endio_loop_move_timeout_to.cold.39__func__.6755.annobin_io_loop_move_timeout.start.annobin_io_loop_move_timeout.end.annobin_io_loop_have_ios.start.annobin_io_loop_have_ios.end.annobin_io_loop_have_immediate_timeouts.start.annobin_io_loop_have_immediate_timeouts.end.annobin_io_loop_is_empty.start.annobin_io_loop_is_empty.end.annobin_io_loop_get_wait_usecs.start.annobin_io_loop_get_wait_usecs.end.annobin_io_loop_find_fd_conditions.start.annobin_io_loop_find_fd_conditions.endio_loop_find_fd_conditions.cold.40.annobin_io_wait_timer_add_to.start.annobin_io_wait_timer_add_to.end.annobin_io_wait_timer_add.start.annobin_io_wait_timer_add.end.annobin_io_wait_timer_move_to.start.annobin_io_wait_timer_move_to.end.annobin_io_wait_timer_move.start.annobin_io_wait_timer_move.end.annobin_io_wait_timer_remove.start.annobin_io_wait_timer_remove.end.annobin_io_loop_destroy.start.annobin_io_loop_destroy.endio_loop_destroy.cold.41__func__.6927.annobin_io_wait_timer_get_usecs.start.annobin_io_wait_timer_get_usecs.end.annobin_io_loop_get_active_global_root.start.annobin_io_loop_get_active_global_root.end.annobin_ioloop_iolist.c.annobin_ioloop_iolist.c_end.annobin_ioloop_iolist.c.hot.annobin_ioloop_iolist.c_end.hot.annobin_ioloop_iolist.c.unlikely.annobin_ioloop_iolist.c_end.unlikely.annobin_ioloop_iolist.c.startup.annobin_ioloop_iolist.c_end.startup.annobin_ioloop_iolist.c.exit.annobin_ioloop_iolist.c_end.exit.annobin_ioloop_iolist_add.start.annobin_ioloop_iolist_add.endioloop_iolist_add.cold.0.annobin_ioloop_iolist_del.start.annobin_ioloop_iolist_del.end.annobin_ioloop_notify_none.c.annobin_ioloop_notify_none.c_end.annobin_ioloop_notify_none.c.hot.annobin_ioloop_notify_none.c_end.hot.annobin_ioloop_notify_none.c.unlikely.annobin_ioloop_notify_none.c_end.unlikely.annobin_ioloop_notify_none.c.startup.annobin_ioloop_notify_none.c_end.startup.annobin_ioloop_notify_none.c.exit.annobin_ioloop_notify_none.c_end.exit.annobin_ioloop_notify_fd.c.annobin_ioloop_notify_fd.c_end.annobin_ioloop_notify_fd.c.hot.annobin_ioloop_notify_fd.c_end.hot.annobin_ioloop_notify_fd.c.unlikely.annobin_ioloop_notify_fd.c_end.unlikely.annobin_ioloop_notify_fd.c.startup.annobin_ioloop_notify_fd.c_end.startup.annobin_ioloop_notify_fd.c.exit.annobin_ioloop_notify_fd.c_end.exit.annobin_io_notify_fd_add.start.annobin_io_notify_fd_add.end.annobin_io_notify_fd_free.start.annobin_io_notify_fd_free.end.annobin_io_notify_fd_find.start.annobin_io_notify_fd_find.end.annobin_ioloop_notify_inotify.c.annobin_ioloop_notify_inotify.c_end.annobin_ioloop_notify_inotify.c.hot.annobin_ioloop_notify_inotify.c_end.hot.annobin_ioloop_notify_inotify.c.unlikely.annobin_ioloop_notify_inotify.c_end.unlikely.annobin_ioloop_notify_inotify.c.startup.annobin_ioloop_notify_inotify.c_end.startup.annobin_ioloop_notify_inotify.c.exit.annobin_ioloop_notify_inotify.c_end.exit.annobin_ioloop_inotify_user_limit_exceeded.start.annobin_ioloop_inotify_user_limit_exceeded.endioloop_inotify_user_limit_exceeded.annobin_inotify_input_more.isra.0.start.annobin_inotify_input_more.isra.0.endinotify_input_more.isra.0inotify_input_more.isra.0.cold.2__func__.8464.annobin_inotify_input.start.annobin_inotify_input.endinotify_input.annobin_io_add_notify.start.annobin_io_add_notify.endio_add_notify.cold.3.annobin_io_loop_notify_remove.start.annobin_io_loop_notify_remove.endio_loop_notify_remove.cold.4.annobin_io_loop_notify_handler_deinit.start.annobin_io_loop_notify_handler_deinit.end__func__.8509.annobin_io_loop_extract_notify_fd.start.annobin_io_loop_extract_notify_fd.endio_loop_extract_notify_fd.cold.5.annobin_ioloop_notify_kqueue.c.annobin_ioloop_notify_kqueue.c_end.annobin_ioloop_notify_kqueue.c.hot.annobin_ioloop_notify_kqueue.c_end.hot.annobin_ioloop_notify_kqueue.c.unlikely.annobin_ioloop_notify_kqueue.c_end.unlikely.annobin_ioloop_notify_kqueue.c.startup.annobin_ioloop_notify_kqueue.c_end.startup.annobin_ioloop_notify_kqueue.c.exit.annobin_ioloop_notify_kqueue.c_end.exit.annobin_ioloop_poll.c.annobin_ioloop_poll.c_end.annobin_ioloop_poll.c.hot.annobin_ioloop_poll.c_end.hot.annobin_ioloop_poll.c.unlikely.annobin_ioloop_poll.c_end.unlikely.annobin_ioloop_poll.c.startup.annobin_ioloop_poll.c_end.startup.annobin_ioloop_poll.c.exit.annobin_ioloop_poll.c_end.exit.annobin_ioloop_select.c.annobin_ioloop_select.c_end.annobin_ioloop_select.c.hot.annobin_ioloop_select.c_end.hot.annobin_ioloop_select.c.unlikely.annobin_ioloop_select.c_end.unlikely.annobin_ioloop_select.c.startup.annobin_ioloop_select.c_end.startup.annobin_ioloop_select.c.exit.annobin_ioloop_select.c_end.exit.annobin_ioloop_epoll.c.annobin_ioloop_epoll.c_end.annobin_ioloop_epoll.c.hot.annobin_ioloop_epoll.c_end.hot.annobin_ioloop_epoll.c.unlikely.annobin_ioloop_epoll.c_end.unlikely.annobin_ioloop_epoll.c.startup.annobin_ioloop_epoll.c_end.startup.annobin_ioloop_epoll.c.exit.annobin_ioloop_epoll.c_end.exit.annobin_epoll_event_mask.start.annobin_epoll_event_mask.endepoll_event_mask.annobin_io_loop_handler_init.start.annobin_io_loop_handler_init.endio_loop_handler_init.cold.4.annobin_io_loop_handler_deinit.start.annobin_io_loop_handler_deinit.endio_loop_handler_deinit.cold.5.annobin_io_loop_handle_add.start.annobin_io_loop_handle_add.endio_loop_handle_add.cold.6.annobin_io_loop_handle_remove.start.annobin_io_loop_handle_remove.endio_loop_handle_remove.cold.7.annobin_io_loop_handler_run_internal.start.annobin_io_loop_handler_run_internal.endio_loop_handler_run_internal.cold.8.annobin_ioloop_kqueue.c.annobin_ioloop_kqueue.c_end.annobin_ioloop_kqueue.c.hot.annobin_ioloop_kqueue.c_end.hot.annobin_ioloop_kqueue.c.unlikely.annobin_ioloop_kqueue.c_end.unlikely.annobin_ioloop_kqueue.c.startup.annobin_ioloop_kqueue.c_end.startup.annobin_ioloop_kqueue.c.exit.annobin_ioloop_kqueue.c_end.exit.annobin_json_parser.c.annobin_json_parser.c_end.annobin_json_parser.c.hot.annobin_json_parser.c_end.hot.annobin_json_parser.c.unlikely.annobin_json_parser.c_end.unlikely.annobin_json_parser.c.startup.annobin_json_parser.c_end.startup.annobin_json_parser.c.exit.annobin_json_parser.c_end.exit.annobin_json_parser_update_input_pos.start.annobin_json_parser_update_input_pos.endjson_parser_update_input_pos.annobin_json_parse_whitespace.start.annobin_json_parse_whitespace.endjson_parse_whitespace.annobin_json_parser_object_open.start.annobin_json_parser_object_open.endjson_parser_object_open.annobin_json_parse_denest.start.annobin_json_parse_denest.endjson_parse_denestjson_parse_denest.cold.11__func__.5426.annobin_json_skip_string.start.annobin_json_skip_string.endjson_skip_string.annobin_json_parser_read_more.start.annobin_json_parser_read_more.endjson_parser_read_morejson_parser_read_more.cold.12__func__.5322.annobin_json_append_escaped_char.start.annobin_json_append_escaped_char.endjson_append_escaped_char.annobin_json_strinput_destroyed.start.annobin_json_strinput_destroyed.endjson_strinput_destroyedjson_strinput_destroyed.cold.13__func__.5490.annobin_json_parse_digits.part.5.start.annobin_json_parse_digits.part.5.endjson_parse_digits.part.5.annobin_json_parse_atom.isra.6.start.annobin_json_parse_atom.isra.6.endjson_parse_atom.isra.6.annobin_json_parse_string.start.annobin_json_parse_string.endjson_parse_string.annobin_json_parser_init_flags.start.annobin_json_parser_init_flags.end.annobin_json_parser_init.start.annobin_json_parser_init.end.annobin_json_parser_deinit.start.annobin_json_parser_deinit.end.annobin_json_parse_next.start.annobin_json_parse_next.endjson_parse_next.cold.14__func__.5449__func__.5472.annobin_json_parse_skip_next.start.annobin_json_parse_skip_next.end__func__.5482json_parse_skip_next.cold.15.annobin_json_parse_skip.start.annobin_json_parse_skip.end__func__.5486json_parse_skip.cold.16.annobin_json_parse_next_stream.start.annobin_json_parse_next_stream.end__func__.5501json_parse_next_stream.cold.17.annobin_json_append_escaped_ucs4.start.annobin_json_append_escaped_ucs4.end.annobin_ostream_escaped_json_format.start.annobin_ostream_escaped_json_format.end.annobin_json_append_escaped_data.start.annobin_json_append_escaped_data.end.annobin_json_append_escaped.start.annobin_json_append_escaped.end.annobin_json_tree.c.annobin_json_tree.c_end.annobin_json_tree.c.hot.annobin_json_tree.c_end.hot.annobin_json_tree.c.unlikely.annobin_json_tree.c_end.unlikely.annobin_json_tree.c.startup.annobin_json_tree.c_end.startup.annobin_json_tree.c.exit.annobin_json_tree.c_end.exit.annobin_json_tree_append_child.start.annobin_json_tree_append_child.endjson_tree_append_child.annobin_json_tree_set_cur.isra.2.part.3.start.annobin_json_tree_set_cur.isra.2.part.3.endjson_tree_set_cur.isra.2.part.3.annobin_json_tree_append_value.start.annobin_json_tree_append_value.endjson_tree_append_value.annobin_json_tree_init_type.start.annobin_json_tree_init_type.end.annobin_json_tree_deinit.start.annobin_json_tree_deinit.end.annobin_json_tree_append.start.annobin_json_tree_append.end.annobin_json_tree_root.start.annobin_json_tree_root.end.annobin_json_tree_find_key.start.annobin_json_tree_find_key.endjson_tree_find_key.cold.5__func__.4727.annobin_json_tree_find_child_with.start.annobin_json_tree_find_child_with.endjson_tree_find_child_with.cold.6__func__.4737.annobin_lib.c.annobin_lib.c_end.annobin_lib.c.hot.annobin_lib.c_end.hot.annobin_lib.c.unlikely.annobin_lib.c_end.unlikely.annobin_lib.c.startup.annobin_lib.c_end.startup.annobin_lib.c.exit.annobin_lib.c_end.exit.annobin_atexit_callback_priority_cmp.start.annobin_atexit_callback_priority_cmp.endatexit_callback_priority_cmp.annobin_lib_atexit_handler.start.annobin_lib_atexit_handler.endlib_atexit_handlerlib_clean_exit.annobin_i_unlink.start.annobin_i_unlink.endi_unlink.cold.8.annobin_i_unlink_if_exists.start.annobin_i_unlink_if_exists.endi_unlink_if_exists.cold.9.annobin_i_getopt_reset.start.annobin_i_getopt_reset.end.annobin_lib_atexit_priority.start.annobin_lib_atexit_priority.endatexit_callbackslib_atexit_priority.cold.10__func__.6001.annobin_lib_atexit.start.annobin_lib_atexit.end.annobin_lib_atexit_run.start.annobin_lib_atexit_run.end.annobin_lib_set_clean_exit.start.annobin_lib_set_clean_exit.end.annobin_lib_exit.start.annobin_lib_exit.end.annobin_lib_init.start.annobin_lib_init.endlib_initializedlib_init.cold.11.annobin_lib_is_initialized.start.annobin_lib_is_initialized.end.annobin_lib_deinit.start.annobin_lib_deinit.endlib_deinit.cold.12.annobin_lib_event.c.annobin_lib_event.c_end.annobin_lib_event.c.hot.annobin_lib_event.c_end.hot.annobin_lib_event.c.unlikely.annobin_lib_event.c_end.unlikely.annobin_lib_event.c.startup.annobin_lib_event.c_end.startup.annobin_lib_event.c.exit.annobin_lib_event.c_end.exit.annobin_event_call_callbacks.start.annobin_event_call_callbacks.endevent_call_callbacksevent_handlersevent_call_callbacks.cold.20.annobin_event_call_callbacks_noargs.start.annobin_event_call_callbacks_noargs.endevent_call_callbacks_noargs.annobin_event_reason_code_module_validate.start.annobin_event_reason_code_module_validate.endevent_reason_code_module_validate.annobin_event_set_log_prefix.start.annobin_event_set_log_prefix.endevent_set_log_prefix.annobin_get_self_rusage.start.annobin_get_self_rusage.endget_self_rusageget_self_rusage.cold.21.annobin_event_find_category.isra.5.start.annobin_event_find_category.isra.5.endevent_find_category.isra.5event_find_category.isra.5.cold.22.annobin_last_passthrough_event.part.7.start.annobin_last_passthrough_event.part.7.endlast_passthrough_event.part.7__func__.5815.annobin_event_passthrough_event.start.annobin_event_passthrough_event.endevent_passthrough_eventevent_last_passthroughevent_passthrough_event.cold.23.annobin_event_import_tv.start.annobin_event_import_tv.endevent_import_tv.annobin_event_category_register.start.annobin_event_category_register.endevent_category_registerevent_registered_categories_internalevent_registered_categories_representativeevent_category_callbacksevent_category_register.cold.24.annobin_event_has_all_categories.start.annobin_event_has_all_categories.end.annobin_event_ref.start.annobin_event_ref.endevent_ref.cold.25__func__.5951.annobin_event_create_internal.start.annobin_event_create_internal.endevent_create_internalevent_id_counterevents.annobin_event_create.start.annobin_event_create.end.annobin_event_create_passthrough.start.annobin_event_create_passthrough.endevent_create_passthrough.cold.26.annobin_event_unref.start.annobin_event_unref.endcurrent_global_eventevent_unref.localalias.18event_unref.cold.27__func__.5956.annobin_events_get_head.start.annobin_events_get_head.end.annobin_event_push_global.start.annobin_event_push_global.endglobal_event_stackevent_push_global.cold.28__func__.5963.annobin_event_pop_global.start.annobin_event_pop_global.endevent_pop_global.cold.29.annobin_event_get_global.start.annobin_event_get_global.end.annobin_event_reason_end.start.annobin_event_reason_end.endevent_reason_end.cold.30__func__.5983.annobin_event_reason_code_prefix.start.annobin_event_reason_code_prefix.endevent_reason_code_prefix.cold.31.annobin_event_reason_code.start.annobin_event_reason_code.end.annobin_event_set_append_log_prefix.start.annobin_event_set_append_log_prefix.end.annobin_event_passthrough_set_append_log_prefix.start.annobin_event_passthrough_set_append_log_prefix.endevent_passthrough_set_append_log_prefixevent_passthrough_set_append_log_prefix.cold.32.annobin_event_replace_log_prefix.start.annobin_event_replace_log_prefix.end.annobin_event_passthrough_replace_log_prefix.start.annobin_event_passthrough_replace_log_prefix.endevent_passthrough_replace_log_prefixevent_passthrough_replace_log_prefix.cold.33.annobin_event_drop_parent_log_prefixes.start.annobin_event_drop_parent_log_prefixes.end.annobin_event_set_log_prefix_callback.start.annobin_event_set_log_prefix_callback.end.annobin_event_set_log_message_callback.start.annobin_event_set_log_message_callback.end.annobin_event_unset_log_message_callback.start.annobin_event_unset_log_message_callback.endevent_unset_log_message_callback.cold.34__func__.6053.annobin_event_set_name.start.annobin_event_set_name.end.annobin_event_passthrough_set_name.start.annobin_event_passthrough_set_name.endevent_passthrough_set_nameevent_passthrough_set_name.cold.35.annobin_event_set_source.start.annobin_event_set_source.end.annobin_event_passthrough_set_source.start.annobin_event_passthrough_set_source.endevent_passthrough_set_sourceevent_passthrough_set_source.cold.36.annobin_event_set_always_log_source.start.annobin_event_set_always_log_source.end.annobin_event_passthrough_set_always_log_source.start.annobin_event_passthrough_set_always_log_source.endevent_passthrough_set_always_log_sourceevent_passthrough_set_always_log_source.cold.37.annobin_event_set_min_log_level.start.annobin_event_set_min_log_level.end.annobin_event_get_min_log_level.start.annobin_event_get_min_log_level.end.annobin_event_set_ptr.start.annobin_event_set_ptr.end.annobin_event_get_ptr.start.annobin_event_get_ptr.end.annobin_event_category_find_registered.start.annobin_event_category_find_registered.end.annobin_event_get_registered_categories.start.annobin_event_get_registered_categories.end.annobin_event_add_categories.start.annobin_event_add_categories.end.annobin_event_passthrough_add_categories.start.annobin_event_passthrough_add_categories.endevent_passthrough_add_categoriesevent_passthrough_add_categories.cold.38.annobin_event_add_category.start.annobin_event_add_category.end.annobin_event_passthrough_add_category.start.annobin_event_passthrough_add_category.endevent_passthrough_add_categoryevent_passthrough_add_category.cold.39.annobin_event_find_field_nonrecursive.start.annobin_event_find_field_nonrecursive.end.annobin_event_has_all_fields.start.annobin_event_has_all_fields.end.annobin_event_get_recursive_strlist.start.annobin_event_get_recursive_strlist.endevent_get_recursive_strlist.annobin_event_get_field.start.annobin_event_get_field.endevent_get_field.annobin_event_find_field_recursive.start.annobin_event_find_field_recursive.end.annobin_event_find_field_recursive_str.start.annobin_event_find_field_recursive_str.end.annobin_event_add_str.start.annobin_event_add_str.end.annobin_event_passthrough_add_str.start.annobin_event_passthrough_add_str.endevent_passthrough_add_strevent_passthrough_add_str.cold.40.annobin_event_strlist_append.start.annobin_event_strlist_append.end.annobin_event_reason_begin.start.annobin_event_reason_begin.end.annobin_event_passthrough_strlist_append.start.annobin_event_passthrough_strlist_append.endevent_passthrough_strlist_appendevent_passthrough_strlist_append.cold.41.annobin_event_strlist_replace.start.annobin_event_strlist_replace.end.annobin_event_passthrough_strlist_replace.start.annobin_event_passthrough_strlist_replace.endevent_passthrough_strlist_replaceevent_passthrough_strlist_replace.cold.42.annobin_event_strlist_copy_recursive.start.annobin_event_strlist_copy_recursive.endevent_strlist_copy_recursive.cold.43.annobin_event_add_int.start.annobin_event_add_int.end.annobin_event_passthrough_add_int.start.annobin_event_passthrough_add_int.endevent_passthrough_add_intevent_passthrough_add_int.cold.44.annobin_event_add_int_nonzero.start.annobin_event_add_int_nonzero.end.annobin_event_passthrough_add_int_nonzero.start.annobin_event_passthrough_add_int_nonzero.endevent_passthrough_add_int_nonzeroevent_passthrough_add_int_nonzero.cold.45.annobin_event_inc_int.start.annobin_event_inc_int.end.annobin_event_passthrough_inc_int.start.annobin_event_passthrough_inc_int.endevent_passthrough_inc_intevent_passthrough_inc_int.cold.46.annobin_event_add_timeval.start.annobin_event_add_timeval.end.annobin_event_copy_fields.start.annobin_event_copy_fields.end.annobin_event_passthrough_add_timeval.start.annobin_event_passthrough_add_timeval.endevent_passthrough_add_timevalevent_passthrough_add_timeval.cold.47.annobin_event_add_fields.start.annobin_event_add_fields.end.annobin_event_passthrough_add_fields.start.annobin_event_passthrough_add_fields.endevent_passthrough_add_fieldsevent_passthrough_add_fields.cold.48.annobin_event_field_clear.start.annobin_event_field_clear.end.annobin_event_passthrough_clear_field.start.annobin_event_passthrough_clear_field.endevent_passthrough_clear_fieldevent_passthrough_clear_field.cold.49.annobin_event_get_parent.start.annobin_event_get_parent.end.annobin_event_get_create_time.start.annobin_event_get_create_time.end.annobin_event_get_last_send_time.start.annobin_event_get_last_send_time.end.annobin_event_get_last_duration.start.annobin_event_get_last_duration.endevent_get_last_duration.cold.50__func__.6295.annobin_event_get_fields.start.annobin_event_get_fields.end.annobin_event_get_categories.start.annobin_event_get_categories.end.annobin_event_copy_categories.start.annobin_event_copy_categories.end.annobin_event_flatten_recurse.start.annobin_event_flatten_recurse.endevent_flatten_recurse.annobin_event_flatten.start.annobin_event_flatten.end.annobin_event_send_abort.start.annobin_event_send_abort.end.annobin_event_vsend.start.annobin_event_vsend.end.annobin_event_send.start.annobin_event_send.end.annobin_event_export.start.annobin_event_export.end.annobin_event_import_unescaped.start.annobin_event_import_unescaped.end.annobin_event_import.start.annobin_event_import.end.annobin_event_dup.start.annobin_event_dup.end.annobin_event_minimize.start.annobin_event_minimize.end.annobin_event_register_callback.start.annobin_event_register_callback.end.annobin_event_unregister_callback.start.annobin_event_unregister_callback.endevent_unregister_callback.cold.51.annobin_event_category_register_callback.start.annobin_event_category_register_callback.end.annobin_event_category_unregister_callback.start.annobin_event_category_unregister_callback.endevent_category_unregister_callback.cold.52.annobin_event_enable_user_cpu_usecs.start.annobin_event_enable_user_cpu_usecs.end.annobin_lib_event_init.start.annobin_lib_event_init.end.annobin_lib_event_deinit.start.annobin_lib_event_deinit.end.annobin_lib_signals.c.annobin_lib_signals.c_end.annobin_lib_signals.c.hot.annobin_lib_signals.c_end.hot.annobin_lib_signals.c.unlikely.annobin_lib_signals.c_end.unlikely.annobin_lib_signals.c.startup.annobin_lib_signals.c_end.startup.annobin_lib_signals.c.exit.annobin_lib_signals.c_end.exit.annobin_sig_ignore.start.annobin_sig_ignore.endsig_ignore.annobin_lib_signals_ioloop_unref.start.annobin_lib_signals_ioloop_unref.endlib_signals_ioloop_unrefsignal_ioloopslib_signals_ioloop_unref.cold.9__func__.6956.annobin_signal_handler_free.start.annobin_signal_handler_free.endsignal_handler_free.annobin_lib_signals_ioloop_destroyed.start.annobin_lib_signals_ioloop_destroyed.endlib_signals_ioloop_destroyed.annobin_lib_signals_set.start.annobin_lib_signals_set.endlib_signals_setsig_handlerlib_signals_set.cold.10.annobin_lib_signals_ignore_forced.start.annobin_lib_signals_ignore_forced.endlib_signals_ignore_forcedlib_signals_ignore_forced.cold.11.annobin_lib_signals_ioloop_ref.start.annobin_lib_signals_ioloop_ref.endlib_signals_ioloop_refsig_pipe_fdsignal_readsignals_expectedlib_signals_ioloop_ref.cold.12__func__.6946.annobin_signal_handler_switch_ioloop.start.annobin_signal_handler_switch_ioloop.endsignal_handler_switch_ioloophave_missing_ioloops.annobin_lib_signals_ioloop_switch.part.4.start.annobin_lib_signals_ioloop_switch.part.4.endlib_signals_ioloop_switch.part.4signal_handlers.annobin_lib_signals_update_expected_signals.start.annobin_lib_signals_update_expected_signals.endlib_signals_update_expected_signalslib_signals_update_expected_signals.cold.13__func__.7018.annobin_signal_read.start.annobin_signal_read.endhave_pending_signalspending_shadowed_signalssignal_read.cold.14__func__.6971__func__.6990__func__.7006.annobin_signal_check_shadowed.start.annobin_signal_check_shadowed.endsignal_check_shadowed.annobin_lib_signals_ioloop_switched.start.annobin_lib_signals_ioloop_switched.endlib_signals_ioloop_switched.annobin_lib_signal_code_to_str.start.annobin_lib_signal_code_to_str.end.annobin_lib_signals_ioloop_detach.start.annobin_lib_signals_ioloop_detach.end.annobin_lib_signals_ioloop_attach.start.annobin_lib_signals_ioloop_attach.end.annobin_lib_signals_set_handler.start.annobin_lib_signals_set_handler.endsignals_initializedlib_signals_set_handler.cold.15__func__.7066.annobin_lib_signals_ignore.start.annobin_lib_signals_ignore.endlib_signals_ignore.cold.16__func__.7076.annobin_lib_signals_clear_handlers_and_ignore.start.annobin_lib_signals_clear_handlers_and_ignore.end.annobin_lib_signals_unset_handler.start.annobin_lib_signals_unset_handler.endlib_signals_unset_handler.cold.17.annobin_lib_signals_set_expected.start.annobin_lib_signals_set_expected.endlib_signals_set_expected.cold.18.annobin_lib_signals_switch_ioloop.start.annobin_lib_signals_switch_ioloop.endlib_signals_switch_ioloop.cold.19__func__.7111.annobin_lib_signals_syscall_error.start.annobin_lib_signals_syscall_error.end.annobin_sig_handler.start.annobin_sig_handler.end.annobin_lib_signals_init.start.annobin_lib_signals_init.end.annobin_lib_signals_deinit.start.annobin_lib_signals_deinit.endlib_signals_deinit.cold.20__func__.7137.annobin_log_throttle.c.annobin_log_throttle.c_end.annobin_log_throttle.c.hot.annobin_log_throttle.c_end.hot.annobin_log_throttle.c.unlikely.annobin_log_throttle.c_end.unlikely.annobin_log_throttle.c.startup.annobin_log_throttle.c_end.startup.annobin_log_throttle.c.exit.annobin_log_throttle.c_end.exit.annobin_log_throttle_callback.start.annobin_log_throttle_callback.endlog_throttle_callback.annobin_log_throttle_init.start.annobin_log_throttle_init.endlog_throttle_init.cold.1__func__.4920.annobin_log_throttle_deinit.start.annobin_log_throttle_deinit.end.annobin_log_throttle_accept.start.annobin_log_throttle_accept.end.annobin_md4.c.annobin_md4.c_end.annobin_md4.c.hot.annobin_md4.c_end.hot.annobin_md4.c.unlikely.annobin_md4.c_end.unlikely.annobin_md4.c.startup.annobin_md4.c_end.startup.annobin_md4.c.exit.annobin_md4.c_end.exit.annobin_body.start.annobin_body.end.annobin_md4_init.start.annobin_md4_init.end.annobin_hash_method_init_md4.start.annobin_hash_method_init_md4.endhash_method_init_md4.annobin_md4_update.start.annobin_md4_update.end.annobin_hash_method_loop_md4.start.annobin_hash_method_loop_md4.endhash_method_loop_md4.annobin_md4_final.start.annobin_md4_final.end.annobin_hash_method_result_md4.start.annobin_hash_method_result_md4.endhash_method_result_md4.annobin_md4_get_digest.start.annobin_md4_get_digest.end.annobin_md5.c.annobin_md5.c_end.annobin_md5.c.hot.annobin_md5.c_end.hot.annobin_md5.c.unlikely.annobin_md5.c_end.unlikely.annobin_md5.c.startup.annobin_md5.c_end.startup.annobin_md5.c.exit.annobin_md5.c_end.exit.annobin_md5_init.start.annobin_md5_init.end.annobin_hash_method_init_md5.start.annobin_hash_method_init_md5.endhash_method_init_md5.annobin_md5_update.start.annobin_md5_update.end.annobin_hash_method_loop_md5.start.annobin_hash_method_loop_md5.endhash_method_loop_md5.annobin_md5_final.start.annobin_md5_final.end.annobin_hash_method_result_md5.start.annobin_hash_method_result_md5.endhash_method_result_md5.annobin_md5_get_digest.start.annobin_md5_get_digest.end.annobin_memarea.c.annobin_memarea.c_end.annobin_memarea.c.hot.annobin_memarea.c_end.hot.annobin_memarea.c.unlikely.annobin_memarea.c_end.unlikely.annobin_memarea.c.startup.annobin_memarea.c_end.startup.annobin_memarea.c.exit.annobin_memarea.c_end.exit.annobin_memarea_init.start.annobin_memarea_init.endmemarea_init.cold.2__func__.4543.annobin_memarea_init_empty.start.annobin_memarea_init_empty.endmemarea_emptymemarea_init_empty.cold.3__func__.4547.annobin_memarea_ref.start.annobin_memarea_ref.endmemarea_ref.cold.4__func__.4551.annobin_memarea_unref.start.annobin_memarea_unref.endmemarea_unref.cold.5__func__.4556.annobin_memarea_get_refcount.start.annobin_memarea_get_refcount.endmemarea_get_refcount.cold.6__func__.4565.annobin_memarea_free_without_callback.start.annobin_memarea_free_without_callback.endmemarea_free_without_callback.cold.7__func__.4561.annobin_memarea_get.start.annobin_memarea_get.end.annobin_memarea_get_size.start.annobin_memarea_get_size.end.annobin_memarea_free_callback_noop.start.annobin_memarea_free_callback_noop.end.annobin_mempool.c.annobin_mempool.c_end.annobin_mempool.c.hot.annobin_mempool.c_end.hot.annobin_mempool.c.unlikely.annobin_mempool.c_end.unlikely.annobin_mempool.c.startup.annobin_mempool.c_end.startup.annobin_mempool.c.exit.annobin_mempool.c_end.exit.annobin_pool_get_exp_grown_size.start.annobin_pool_get_exp_grown_size.endpool_get_exp_grown_size.cold.0__func__.4512.annobin_mempool_allocfree.c.annobin_mempool_allocfree.c_end.annobin_mempool_allocfree.c.hot.annobin_mempool_allocfree.c_end.hot.annobin_mempool_allocfree.c.unlikely.annobin_mempool_allocfree.c_end.unlikely.annobin_mempool_allocfree.c.startup.annobin_mempool_allocfree.c_end.startup.annobin_mempool_allocfree.c.exit.annobin_mempool_allocfree.c_end.exit.annobin_pool_allocfree_get_name.start.annobin_pool_allocfree_get_name.endpool_allocfree_get_name.annobin_pool_allocfree_get_max_easy_alloc_size.start.annobin_pool_allocfree_get_max_easy_alloc_size.endpool_allocfree_get_max_easy_alloc_size.annobin_pool_block_detach.start.annobin_pool_block_detach.endpool_block_detachpool_block_detach.cold.5__func__.4579.annobin_pool_allocfree_free.start.annobin_pool_allocfree_free.endpool_allocfree_free.annobin_pool_block_attach.part.0.start.annobin_pool_block_attach.part.0.endpool_block_attach.part.0__func__.4574.annobin_pool_allocfree_realloc.start.annobin_pool_allocfree_realloc.endpool_allocfree_reallocpool_allocfree_realloc.cold.6.annobin_pool_allocfree_ref.start.annobin_pool_allocfree_ref.endpool_allocfree_refpool_allocfree_ref.cold.7__func__.4563.annobin_pool_allocfree_clear.start.annobin_pool_allocfree_clear.endpool_allocfree_clearpool_allocfree_clear.cold.8__func__.4611.annobin_pool_allocfree_unref.start.annobin_pool_allocfree_unref.endpool_allocfree_unrefpool_allocfree_unref.cold.9__func__.4569.annobin_pool_allocfree_malloc.start.annobin_pool_allocfree_malloc.endpool_allocfree_mallocpool_allocfree_malloc.cold.10.annobin_pool_allocfree_create.start.annobin_pool_allocfree_create.endstatic_allocfree_pool_vfuncspool_allocfree_create.cold.11.annobin_pool_allocfree_create_clean.start.annobin_pool_allocfree_create_clean.end.annobin_pool_allocfree_get_total_used_size.start.annobin_pool_allocfree_get_total_used_size.end.annobin_pool_allocfree_get_total_alloc_size.start.annobin_pool_allocfree_get_total_alloc_size.end.annobin_mempool_alloconly.c.annobin_mempool_alloconly.c_end.annobin_mempool_alloconly.c.hot.annobin_mempool_alloconly.c_end.hot.annobin_mempool_alloconly.c.unlikely.annobin_mempool_alloconly.c_end.unlikely.annobin_mempool_alloconly.c.startup.annobin_mempool_alloconly.c_end.startup.annobin_mempool_alloconly.c.exit.annobin_mempool_alloconly.c_end.exit.annobin_pool_alloconly_get_name.start.annobin_pool_alloconly_get_name.endpool_alloconly_get_name.annobin_pool_alloconly_ref.start.annobin_pool_alloconly_ref.endpool_alloconly_ref.annobin_pool_alloconly_get_max_easy_alloc_size.start.annobin_pool_alloconly_get_max_easy_alloc_size.endpool_alloconly_get_max_easy_alloc_size.annobin_pool_alloconly_free.start.annobin_pool_alloconly_free.endpool_alloconly_free.annobin_pool_alloconly_free_block.isra.1.start.annobin_pool_alloconly_free_block.isra.1.endpool_alloconly_free_block.isra.1.annobin_pool_alloconly_clear.start.annobin_pool_alloconly_clear.endpool_alloconly_clear.annobin_pool_alloconly_unref.start.annobin_pool_alloconly_unref.endpool_alloconly_unref.annobin_block_alloc.isra.2.start.annobin_block_alloc.isra.2.endblock_alloc.isra.2block_alloc.isra.2.cold.6__func__.4589.annobin_pool_alloconly_malloc.start.annobin_pool_alloconly_malloc.endpool_alloconly_malloc.annobin_pool_alloconly_realloc.start.annobin_pool_alloconly_realloc.endpool_alloconly_realloc.annobin_pool_alloconly_create.start.annobin_pool_alloconly_create.endstatic_alloconly_pool_vfuncspool_alloconly_create.cold.7__func__.4552.annobin_pool_alloconly_create_clean.start.annobin_pool_alloconly_create_clean.end.annobin_pool_alloconly_get_total_used_size.start.annobin_pool_alloconly_get_total_used_size.endpool_alloconly_get_total_used_size.cold.8__func__.4631.annobin_pool_alloconly_get_total_alloc_size.start.annobin_pool_alloconly_get_total_alloc_size.endpool_alloconly_get_total_alloc_size.cold.9__func__.4641.annobin_mempool_datastack.c.annobin_mempool_datastack.c_end.annobin_mempool_datastack.c.hot.annobin_mempool_datastack.c_end.hot.annobin_mempool_datastack.c.unlikely.annobin_mempool_datastack.c_end.unlikely.annobin_mempool_datastack.c.startup.annobin_mempool_datastack.c_end.startup.annobin_mempool_datastack.c.exit.annobin_mempool_datastack.c_end.exit.annobin_pool_data_stack_get_name.start.annobin_pool_data_stack_get_name.endpool_data_stack_get_name.annobin_pool_data_stack_clear.start.annobin_pool_data_stack_clear.endpool_data_stack_clear.annobin_pool_data_stack_get_max_easy_alloc_size.start.annobin_pool_data_stack_get_max_easy_alloc_size.endpool_data_stack_get_max_easy_alloc_size.annobin_pool_data_stack_free.start.annobin_pool_data_stack_free.endpool_data_stack_freepool_data_stack_free.cold.2.annobin_pool_data_stack_malloc.start.annobin_pool_data_stack_malloc.endpool_data_stack_mallocpool_data_stack_malloc.cold.3.annobin_pool_data_stack_ref.start.annobin_pool_data_stack_ref.endpool_data_stack_refpool_data_stack_ref.cold.4.annobin_pool_data_stack_unref.start.annobin_pool_data_stack_unref.endpool_data_stack_unrefpool_data_stack_unref.cold.5.annobin_pool_data_stack_realloc.start.annobin_pool_data_stack_realloc.endpool_data_stack_reallocpool_data_stack_realloc.cold.6.annobin_pool_datastack_create.start.annobin_pool_datastack_create.endstatic_data_stack_pool_vfuncs.annobin_mempool_system.c.annobin_mempool_system.c_end.annobin_mempool_system.c.hot.annobin_mempool_system.c_end.hot.annobin_mempool_system.c.unlikely.annobin_mempool_system.c_end.unlikely.annobin_mempool_system.c.startup.annobin_mempool_system.c_end.startup.annobin_mempool_system.c.exit.annobin_mempool_system.c_end.exit.annobin_pool_system_get_name.start.annobin_pool_system_get_name.endpool_system_get_name.annobin_pool_system_ref.start.annobin_pool_system_ref.endpool_system_ref.annobin_pool_system_get_max_easy_alloc_size.start.annobin_pool_system_get_max_easy_alloc_size.endpool_system_get_max_easy_alloc_size.annobin_pool_system_clear.start.annobin_pool_system_clear.endpool_system_clear.annobin_pool_system_malloc.start.annobin_pool_system_malloc.endpool_system_mallocpool_system_malloc.cold.1.annobin_pool_system_free.start.annobin_pool_system_free.end.annobin_pool_system_realloc.start.annobin_pool_system_realloc.endpool_system_reallocpool_system_realloc.cold.2__func__.5167.annobin_pool_system_unref.start.annobin_pool_system_unref.endpool_system_unrefstatic_system_pool_vfuncs.annobin_mempool_unsafe_datastack.c.annobin_mempool_unsafe_datastack.c_end.annobin_mempool_unsafe_datastack.c.hot.annobin_mempool_unsafe_datastack.c_end.hot.annobin_mempool_unsafe_datastack.c.unlikely.annobin_mempool_unsafe_datastack.c_end.unlikely.annobin_mempool_unsafe_datastack.c.startup.annobin_mempool_unsafe_datastack.c_end.startup.annobin_mempool_unsafe_datastack.c.exit.annobin_mempool_unsafe_datastack.c_end.exit.annobin_pool_unsafe_data_stack_get_name.start.annobin_pool_unsafe_data_stack_get_name.endpool_unsafe_data_stack_get_name.annobin_pool_unsafe_data_stack_ref.start.annobin_pool_unsafe_data_stack_ref.endpool_unsafe_data_stack_ref.annobin_pool_unsafe_data_stack_free.start.annobin_pool_unsafe_data_stack_free.endpool_unsafe_data_stack_free.annobin_pool_unsafe_data_stack_get_max_easy_alloc_size.start.annobin_pool_unsafe_data_stack_get_max_easy_alloc_size.endpool_unsafe_data_stack_get_max_easy_alloc_size.annobin_pool_unsafe_data_stack_malloc.start.annobin_pool_unsafe_data_stack_malloc.endpool_unsafe_data_stack_malloc.annobin_pool_unsafe_data_stack_realloc.start.annobin_pool_unsafe_data_stack_realloc.endpool_unsafe_data_stack_realloc.annobin_pool_unsafe_data_stack_clear.start.annobin_pool_unsafe_data_stack_clear.endpool_unsafe_data_stack_clear.annobin_pool_unsafe_data_stack_unref.start.annobin_pool_unsafe_data_stack_unref.endpool_unsafe_data_stack_unrefstatic_unsafe_data_stack_poolstatic_unsafe_data_stack_pool_vfuncs.annobin_mkdir_parents.c.annobin_mkdir_parents.c_end.annobin_mkdir_parents.c.hot.annobin_mkdir_parents.c_end.hot.annobin_mkdir_parents.c.unlikely.annobin_mkdir_parents.c_end.unlikely.annobin_mkdir_parents.c.startup.annobin_mkdir_parents.c_end.startup.annobin_mkdir_parents.c.exit.annobin_mkdir_parents.c_end.exit.annobin_mkdir_chown_full.start.annobin_mkdir_chown_full.endmkdir_chown_full__func__.5901mkdir_chown_full.cold.1.annobin_mkdir_parents_chown_full.start.annobin_mkdir_parents_chown_full.endmkdir_parents_chown_fullmkdir_parents_chown_full.cold.2.annobin_mkdir_chown.start.annobin_mkdir_chown.end.annobin_mkdir_chgrp.start.annobin_mkdir_chgrp.end.annobin_mkdir_parents_chown.start.annobin_mkdir_parents_chown.end.annobin_mkdir_parents_chgrp.start.annobin_mkdir_parents_chgrp.end.annobin_mkdir_parents.start.annobin_mkdir_parents.end.annobin_stat_first_parent.start.annobin_stat_first_parent.end.annobin_mmap_anon.c.annobin_mmap_anon.c_end.annobin_mmap_anon.c.hot.annobin_mmap_anon.c_end.hot.annobin_mmap_anon.c.unlikely.annobin_mmap_anon.c_end.unlikely.annobin_mmap_anon.c.startup.annobin_mmap_anon.c_end.startup.annobin_mmap_anon.c.exit.annobin_mmap_anon.c_end.exit.annobin_mmap_anon.start.annobin_mmap_anon.end.annobin_mremap_anon.start.annobin_mremap_anon.end.annobin_munmap_anon.start.annobin_munmap_anon.end.annobin_mmap_util.c.annobin_mmap_util.c_end.annobin_mmap_util.c.hot.annobin_mmap_util.c_end.hot.annobin_mmap_util.c.unlikely.annobin_mmap_util.c_end.unlikely.annobin_mmap_util.c.startup.annobin_mmap_util.c_end.startup.annobin_mmap_util.c.exit.annobin_mmap_util.c_end.exit.annobin_mmap_file.start.annobin_mmap_file.endmmap_file.cold.1__func__.5586.annobin_mmap_ro_file.start.annobin_mmap_ro_file.end.annobin_mmap_rw_file.start.annobin_mmap_rw_file.end.annobin_my_madvise.start.annobin_my_madvise.end.annobin_mmap_get_page_size.start.annobin_mmap_get_page_size.endsize.5603.annobin_module_dir.c.annobin_module_dir.c_end.annobin_module_dir.c.hot.annobin_module_dir.c_end.hot.annobin_module_dir.c.unlikely.annobin_module_dir.c_end.unlikely.annobin_module_dir.c.startup.annobin_module_dir.c_end.startup.annobin_module_dir.c.exit.annobin_module_dir.c_end.exit.annobin_module_name_cmp.start.annobin_module_name_cmp.endmodule_name_cmp.annobin_module_name_drop_suffix.start.annobin_module_name_drop_suffix.endmodule_name_drop_suffix.annobin_module_free.start.annobin_module_free.endmodule_freemodule_free.cold.8.annobin_module_get_symbol_quiet.start.annobin_module_get_symbol_quiet.end.annobin_module_get_symbol.start.annobin_module_get_symbol.endmodule_get_symbol.cold.9.annobin_module_dir_find.start.annobin_module_dir_find.end.annobin_module_dir_init.start.annobin_module_dir_init.endmodule_dir_init.cold.10.annobin_module_dir_deinit.start.annobin_module_dir_deinit.endmodule_dir_deinit.cold.11.annobin_module_dir_unload.start.annobin_module_dir_unload.end.annobin_module_file_get_name.start.annobin_module_file_get_name.end.annobin_module_dir_try_load_missing.start.annobin_module_dir_try_load_missing.endmodule_dir_try_load_missing.cold.12.annobin_module_dir_load_missing.start.annobin_module_dir_load_missing.endmodule_dir_load_missing.cold.13.annobin_module_dir_load.start.annobin_module_dir_load.end.annobin_module_get_plugin_name.start.annobin_module_get_plugin_name.end.annobin_mountpoint.c.annobin_mountpoint.c_end.annobin_mountpoint.c.hot.annobin_mountpoint.c_end.hot.annobin_mountpoint.c.unlikely.annobin_mountpoint.c_end.unlikely.annobin_mountpoint.c.startup.annobin_mountpoint.c_end.startup.annobin_mountpoint.c.exit.annobin_mountpoint.c_end.exit.annobin_mountpoint_iter_init.start.annobin_mountpoint_iter_init.endmountpoint_iter_init.cold.1.annobin_mountpoint_iter_next.start.annobin_mountpoint_iter_next.end.annobin_mountpoint_iter_deinit.start.annobin_mountpoint_iter_deinit.end.annobin_mountpoint_get.start.annobin_mountpoint_get.endmountpoint_get.cold.2.annobin_net.c.annobin_net.c_end.annobin_net.c.hot.annobin_net.c_end.hot.annobin_net.c.unlikely.annobin_net.c_end.unlikely.annobin_net.c.startup.annobin_net.c_end.startup.annobin_net.c.exit.annobin_net.c_end.exit.annobin_net_ip_cmp.start.annobin_net_ip_cmp.end.annobin_net_ip_compare.start.annobin_net_ip_compare.end.annobin_net_ip_hash.start.annobin_net_ip_hash.end.annobin_net_try_bind.start.annobin_net_try_bind.end__func__.7316net_try_bind.cold.6.annobin_net_disconnect.start.annobin_net_disconnect.endnet_disconnect.cold.7.annobin_net_set_nonblock.start.annobin_net_set_nonblock.end.annobin_net_connect_unix.start.annobin_net_connect_unix.endnet_connect_unix.cold.8.annobin_net_connect_unix_with_retries.start.annobin_net_connect_unix_with_retries.end.annobin_net_set_cork.start.annobin_net_set_cork.end.annobin_net_set_tcp_nodelay.start.annobin_net_set_tcp_nodelay.end.annobin_net_set_tcp_quickack.start.annobin_net_set_tcp_quickack.end.annobin_net_set_send_buffer_size.start.annobin_net_set_send_buffer_size.end.annobin_net_set_recv_buffer_size.start.annobin_net_set_recv_buffer_size.end.annobin_net_listen_unix.start.annobin_net_listen_unix.end__func__.7396net_listen_unix.cold.9.annobin_net_listen_unix_unlink_stale.start.annobin_net_listen_unix_unlink_stale.end__func__.7403.annobin_net_accept.start.annobin_net_accept.endnet_accept.cold.10.annobin_net_receive.start.annobin_net_receive.endnet_receive.cold.11__func__.7422.annobin_net_gethostbyaddr.start.annobin_net_gethostbyaddr.end.annobin_net_getsockname.start.annobin_net_getsockname.endnet_getsockname.cold.12__func__.7456.annobin_net_getpeername.start.annobin_net_getpeername.endnet_getpeername.cold.13.annobin_net_getunixname.start.annobin_net_getunixname.end.annobin_net_getunixcred.start.annobin_net_getunixcred.endnet_getunixcred.cold.14.annobin_net_ip2addr.start.annobin_net_ip2addr.end.annobin_net_connect_ip_full.start.annobin_net_connect_ip_full.endnet_connect_ip_full__func__.7284net_connect_ip_full.cold.15.annobin_net_connect_ip.start.annobin_net_connect_ip.end.annobin_net_connect_ip_blocking.start.annobin_net_connect_ip_blocking.end.annobin_net_connect_udp.start.annobin_net_connect_udp.end.annobin_net_listen_full.start.annobin_net_listen_full.end__func__.7386net_listen_full.cold.16.annobin_net_listen.start.annobin_net_listen.end.annobin_net_addr2ip.start.annobin_net_addr2ip.endnet_addr2ip.cold.17.annobin_net_gethostbyname.start.annobin_net_gethostbyname.end.annobin_net_str2port.start.annobin_net_str2port.end.annobin_net_str2port_zero.start.annobin_net_str2port_zero.end.annobin_net_str2hostport.start.annobin_net_str2hostport.end.annobin_net_ipport2str.start.annobin_net_ipport2str.end.annobin_net_ipv6_mapped_ipv4_convert.start.annobin_net_ipv6_mapped_ipv4_convert.endv4_prefix.7525.annobin_net_geterror.start.annobin_net_geterror.end.annobin_net_gethosterror.start.annobin_net_gethosterror.endnet_gethosterror.cold.18.annobin_net_get_hosterror_type.start.annobin_net_get_hosterror_type.end.annobin_net_hosterror_notfound.start.annobin_net_hosterror_notfound.end.annobin_net_getservbyport.start.annobin_net_getservbyport.end.annobin_is_ipv4_address.start.annobin_is_ipv4_address.end.annobin_is_ipv6_address.start.annobin_is_ipv6_address.end.annobin_net_parse_range.start.annobin_net_parse_range.end.annobin_net_is_in_network.start.annobin_net_is_in_network.endnet_is_in_network.cold.19.annobin_nfs_workarounds.c.annobin_nfs_workarounds.c_end.annobin_nfs_workarounds.c.hot.annobin_nfs_workarounds.c_end.hot.annobin_nfs_workarounds.c.unlikely.annobin_nfs_workarounds.c_end.unlikely.annobin_nfs_workarounds.c.startup.annobin_nfs_workarounds.c_end.startup.annobin_nfs_workarounds.c.exit.annobin_nfs_workarounds.c_end.exit.annobin_nfs_safe_open_callback.start.annobin_nfs_safe_open_callback.endnfs_safe_open_callback.annobin_nfs_safe_stat_callback.start.annobin_nfs_safe_stat_callback.endnfs_safe_stat_callback.annobin_nfs_safe_lstat_callback.start.annobin_nfs_safe_lstat_callback.endnfs_safe_lstat_callback.annobin_nfs_flush_chown_uid.start.annobin_nfs_flush_chown_uid.endnfs_flush_chown_uidnfs_flush_file_handle_cache_parent_dirnfs_flush_chown_uid.cold.1.annobin_nfs_flush_file_handle_cache_parent_dir.start.annobin_nfs_flush_file_handle_cache_parent_dir.endnfs_flush_file_handle_cache_parent_dir.cold.2.annobin_nfs_safe_link.start.annobin_nfs_safe_link.end.annobin_nfs_flush_attr_cache_unlocked.start.annobin_nfs_flush_attr_cache_unlocked.end__func__.5664.annobin_nfs_flush_attr_cache_maybe_locked.start.annobin_nfs_flush_attr_cache_maybe_locked.end.annobin_nfs_flush_attr_cache_fd_locked.start.annobin_nfs_flush_attr_cache_fd_locked.end.annobin_nfs_flush_file_handle_cache.start.annobin_nfs_flush_file_handle_cache.end.annobin_nfs_safe_do.start.annobin_nfs_safe_do.endnfs_safe_do.annobin_nfs_safe_open.start.annobin_nfs_safe_open.endnfs_safe_open.cold.3__func__.5623.annobin_nfs_safe_stat.start.annobin_nfs_safe_stat.end.annobin_nfs_safe_lstat.start.annobin_nfs_safe_lstat.end.annobin_nfs_flush_read_cache_locked.start.annobin_nfs_flush_read_cache_locked.end.annobin_nfs_flush_read_cache_unlocked.start.annobin_nfs_flush_read_cache_unlocked.endlocks_disabled.5657nfs_flush_read_cache_unlocked.cold.4.annobin_numpack.c.annobin_numpack.c_end.annobin_numpack.c.hot.annobin_numpack.c_end.hot.annobin_numpack.c.unlikely.annobin_numpack.c_end.unlikely.annobin_numpack.c.startup.annobin_numpack.c_end.startup.annobin_numpack.c.exit.annobin_numpack.c_end.exit.annobin_numpack_encode.start.annobin_numpack_encode.end.annobin_numpack_decode.start.annobin_numpack_decode.end.annobin_numpack_decode32.start.annobin_numpack_decode32.end.annobin_ostream.c.annobin_ostream.c_end.annobin_ostream.c.hot.annobin_ostream.c_end.hot.annobin_ostream.c.unlikely.annobin_ostream.c_end.unlikely.annobin_ostream.c.startup.annobin_ostream.c_end.startup.annobin_ostream.c.exit.annobin_ostream.c_end.exit.annobin_o_stream_default_seek.start.annobin_o_stream_default_seek.endo_stream_default_seek.annobin_o_stream_default_write_at.start.annobin_o_stream_default_write_at.endo_stream_default_write_at.annobin_o_stream_sendv_int.start.annobin_o_stream_sendv_int.endo_stream_sendv_into_stream_sendv_int.cold.8.annobin_o_stream_set_name.start.annobin_o_stream_set_name.end.annobin_o_stream_get_name.start.annobin_o_stream_get_name.end.annobin_o_stream_get_fd.start.annobin_o_stream_get_fd.end.annobin_o_stream_get_error.start.annobin_o_stream_get_error.end.annobin_o_stream_get_disconnect_reason.start.annobin_o_stream_get_disconnect_reason.end.annobin_o_stream_ref.start.annobin_o_stream_ref.end.annobin_o_stream_unref.start.annobin_o_stream_unref.end.annobin_o_stream_default_destroy.start.annobin_o_stream_default_destroy.end.annobin_o_stream_add_destroy_callback.start.annobin_o_stream_add_destroy_callback.end.annobin_o_stream_remove_destroy_callback.start.annobin_o_stream_remove_destroy_callback.end.annobin_o_stream_set_flush_callback.start.annobin_o_stream_set_flush_callback.end.annobin_o_stream_default_set_flush_callback.start.annobin_o_stream_default_set_flush_callback.endo_stream_default_set_flush_callback.annobin_o_stream_unset_flush_callback.start.annobin_o_stream_unset_flush_callback.end.annobin_o_stream_set_max_buffer_size.start.annobin_o_stream_set_max_buffer_size.end.annobin_o_stream_default_set_max_buffer_size.start.annobin_o_stream_default_set_max_buffer_size.endo_stream_default_set_max_buffer_size.annobin_o_stream_get_max_buffer_size.start.annobin_o_stream_get_max_buffer_size.end.annobin_o_stream_cork.start.annobin_o_stream_cork.end.annobin_o_stream_uncork.start.annobin_o_stream_uncork.end.annobin_o_stream_is_corked.start.annobin_o_stream_is_corked.end.annobin_o_stream_set_flush_pending.start.annobin_o_stream_set_flush_pending.end.annobin_o_stream_default_set_flush_pending.start.annobin_o_stream_default_set_flush_pending.endo_stream_default_set_flush_pending.annobin_o_stream_get_buffer_used_size.start.annobin_o_stream_get_buffer_used_size.end.annobin_o_stream_default_get_buffer_avail_size.start.annobin_o_stream_default_get_buffer_avail_size.endo_stream_default_get_buffer_avail_size.annobin_o_stream_default_get_buffer_used_size.start.annobin_o_stream_default_get_buffer_used_size.endo_stream_default_get_buffer_used_size.annobin_o_stream_get_buffer_avail_size.start.annobin_o_stream_get_buffer_avail_size.end.annobin_o_stream_seek.start.annobin_o_stream_seek.endo_stream_seek.cold.9.annobin_o_stream_sendv.start.annobin_o_stream_sendv.end.annobin_o_stream_send.start.annobin_o_stream_send.end.annobin_o_stream_send_str.start.annobin_o_stream_send_str.end.annobin_o_stream_nsendv.start.annobin_o_stream_nsendv.end.annobin_o_stream_nsend.start.annobin_o_stream_nsend.end.annobin_o_stream_nsend_str.start.annobin_o_stream_nsend_str.end.annobin_o_stream_set_finish_also_parent.start.annobin_o_stream_set_finish_also_parent.end.annobin_o_stream_set_finish_via_child.start.annobin_o_stream_set_finish_via_child.end.annobin_o_stream_ignore_last_errors.start.annobin_o_stream_ignore_last_errors.end.annobin_o_stream_flush.start.annobin_o_stream_flush.endo_stream_flush.cold.10__func__.5500.annobin_o_stream_close_full.start.annobin_o_stream_close_full.endo_stream_close_fullo_stream_close_full.cold.11__func__.5442.annobin_o_stream_destroy.start.annobin_o_stream_destroy.end.annobin_o_stream_close.start.annobin_o_stream_close.end.annobin_o_stream_finish.start.annobin_o_stream_finish.end.annobin_o_stream_default_cork.start.annobin_o_stream_default_cork.endo_stream_default_cork.annobin_o_stream_default_close.start.annobin_o_stream_default_close.end.annobin_o_stream_abort.start.annobin_o_stream_abort.end.annobin_o_stream_set_no_error_handling.start.annobin_o_stream_set_no_error_handling.end.annobin_o_stream_send_istream.start.annobin_o_stream_send_istream.endo_stream_send_istream.cold.12__func__.5598.annobin_o_stream_nsend_istream.start.annobin_o_stream_nsend_istream.endo_stream_nsend_istream.cold.13__func__.5609.annobin_o_stream_pwrite.start.annobin_o_stream_pwrite.endo_stream_pwrite.cold.14.annobin_o_stream_get_last_write_time.start.annobin_o_stream_get_last_write_time.end.annobin_io_stream_copy.start.annobin_io_stream_copy.endio_stream_copy.cold.15.annobin_o_stream_default_send_istream.start.annobin_o_stream_default_send_istream.endo_stream_default_send_istream.annobin_o_stream_switch_ioloop_to.start.annobin_o_stream_switch_ioloop_to.end.annobin_o_stream_default_switch_ioloop_to.start.annobin_o_stream_default_switch_ioloop_to.endo_stream_default_switch_ioloop_to.annobin_o_stream_switch_ioloop.start.annobin_o_stream_switch_ioloop.end.annobin_o_stream_copy_error_from_parent.start.annobin_o_stream_copy_error_from_parent.endo_stream_copy_error_from_parent.cold.16__func__.5669.annobin_o_stream_default_sendv.start.annobin_o_stream_default_sendv.endo_stream_default_sendv.annobin_o_stream_flush_parent_if_needed.start.annobin_o_stream_flush_parent_if_needed.end.annobin_o_stream_flush_parent.start.annobin_o_stream_flush_parent.endo_stream_flush_parent.cold.17__func__.5677.annobin_o_stream_default_flush.start.annobin_o_stream_default_flush.endo_stream_default_flush.annobin_o_stream_create.start.annobin_o_stream_create.end.annobin_o_stream_create_error.start.annobin_o_stream_create_error.end.annobin_o_stream_create_error_str.start.annobin_o_stream_create_error_str.end.annobin_o_stream_create_passthrough.start.annobin_o_stream_create_passthrough.end.annobin_ostream_buffer.c.annobin_ostream_buffer.c_end.annobin_ostream_buffer.c.hot.annobin_ostream_buffer.c_end.hot.annobin_ostream_buffer.c.unlikely.annobin_ostream_buffer.c_end.unlikely.annobin_ostream_buffer.c.startup.annobin_ostream_buffer.c_end.startup.annobin_ostream_buffer.c.exit.annobin_ostream_buffer.c_end.exit.annobin_o_stream_buffer_seek.start.annobin_o_stream_buffer_seek.endo_stream_buffer_seek.annobin_o_stream_buffer_get_buffer_used_size.start.annobin_o_stream_buffer_get_buffer_used_size.endo_stream_buffer_get_buffer_used_size.annobin_o_stream_buffer_write_at.start.annobin_o_stream_buffer_write_at.endo_stream_buffer_write_at.annobin_o_stream_buffer_sendv.start.annobin_o_stream_buffer_sendv.endo_stream_buffer_sendv.annobin_o_stream_create_buffer.start.annobin_o_stream_create_buffer.end.annobin_ostream_failure_at.c.annobin_ostream_failure_at.c_end.annobin_ostream_failure_at.c.hot.annobin_ostream_failure_at.c_end.hot.annobin_ostream_failure_at.c.unlikely.annobin_ostream_failure_at.c_end.unlikely.annobin_ostream_failure_at.c.startup.annobin_ostream_failure_at.c_end.startup.annobin_ostream_failure_at.c.exit.annobin_ostream_failure_at.c_end.exit.annobin_o_stream_failure_at_destroy.start.annobin_o_stream_failure_at_destroy.endo_stream_failure_at_destroy.annobin_o_stream_failure_at_sendv.start.annobin_o_stream_failure_at_sendv.endo_stream_failure_at_sendvo_stream_failure_at_sendv.cold.1.annobin_o_stream_failure_at_flush.start.annobin_o_stream_failure_at_flush.endo_stream_failure_at_flush.annobin_o_stream_create_failure_at.start.annobin_o_stream_create_failure_at.end.annobin_o_stream_create_failure_at_flush.start.annobin_o_stream_create_failure_at_flush.end.annobin_ostream_file.c.annobin_ostream_file.c_end.annobin_ostream_file.c.hot.annobin_ostream_file.c_end.hot.annobin_ostream_file.c.unlikely.annobin_ostream_file.c_end.unlikely.annobin_ostream_file.c.startup.annobin_ostream_file.c_end.startup.annobin_ostream_file.c.exit.annobin_ostream_file.c_end.exit.annobin_o_stream_file_destroy.start.annobin_o_stream_file_destroy.endo_stream_file_destroy.annobin_stream_closed.start.annobin_stream_closed.endstream_closed.annobin_o_stream_file_close.start.annobin_o_stream_file_close.end.annobin_o_stream_file_flush_pending.start.annobin_o_stream_file_flush_pending.endo_stream_file_flush_pendingstream_send_io.annobin_o_stream_grow_buffer.start.annobin_o_stream_grow_buffer.endo_stream_grow_buffer.annobin_fstream_init_file.start.annobin_fstream_init_file.endfstream_init_file.annobin_get_unused_space.start.annobin_get_unused_space.endget_unused_space.annobin_o_stream_file_get_buffer_used_size.start.annobin_o_stream_file_get_buffer_used_size.endo_stream_file_get_buffer_used_size.annobin_o_stream_add.start.annobin_o_stream_add.endo_stream_add.annobin_o_stream_lseek.start.annobin_o_stream_lseek.endo_stream_lseek.annobin_o_stream_file_writev.start.annobin_o_stream_file_writev.endo_stream_file_writev.cold.6__func__.7380.annobin_o_stream_socket_cork.start.annobin_o_stream_socket_cork.endo_stream_socket_cork.annobin_o_stream_file_writev_full.start.annobin_o_stream_file_writev_full.endo_stream_file_writev_full__func__.7407o_stream_file_writev_full.cold.7.annobin_buffer_flush.start.annobin_buffer_flush.endbuffer_flushbuffer_flush.cold.8__func__.7363.annobin_o_stream_file_flush.start.annobin_o_stream_file_flush.endo_stream_file_flush.annobin_stream_send_io.start.annobin_stream_send_io.end.annobin_o_stream_file_write_at.start.annobin_o_stream_file_write_at.endo_stream_file_write_ato_stream_file_write_at.cold.9__func__.7512.annobin_o_stream_file_cork.start.annobin_o_stream_file_cork.endo_stream_file_corko_stream_file_cork.cold.10__func__.7430.annobin_o_stream_file_sendv.start.annobin_o_stream_file_sendv.endo_stream_file_sendv.cold.11__func__.7500.annobin_o_stream_file_send_istream.start.annobin_o_stream_file_send_istream.endo_stream_file_send_istreamo_stream_file_send_istream.cold.12__func__.7558__func__.7571__func__.5974.annobin_o_stream_file_seek.start.annobin_o_stream_file_seek.endo_stream_file_seek.annobin_o_stream_file_switch_ioloop_to.start.annobin_o_stream_file_switch_ioloop_to.endo_stream_file_switch_ioloop_to.annobin_o_stream_create_file_common.start.annobin_o_stream_create_file_common.end.annobin_o_stream_create_fd_common.start.annobin_o_stream_create_fd_common.endo_stream_create_fd_common.annobin_o_stream_create_fd.start.annobin_o_stream_create_fd.end.annobin_o_stream_create_fd_autoclose.start.annobin_o_stream_create_fd_autoclose.end.annobin_o_stream_create_fd_file.start.annobin_o_stream_create_fd_file.end.annobin_o_stream_create_fd_file_autoclose.start.annobin_o_stream_create_fd_file_autoclose.end.annobin_o_stream_create_file.start.annobin_o_stream_create_file.end.annobin_ostream_hash.c.annobin_ostream_hash.c_end.annobin_ostream_hash.c.hot.annobin_ostream_hash.c_end.hot.annobin_ostream_hash.c.unlikely.annobin_ostream_hash.c_end.unlikely.annobin_ostream_hash.c.startup.annobin_ostream_hash.c_end.startup.annobin_ostream_hash.c.exit.annobin_ostream_hash.c_end.exit.annobin_o_stream_hash_sendv.start.annobin_o_stream_hash_sendv.endo_stream_hash_sendv.annobin_o_stream_create_hash.start.annobin_o_stream_create_hash.end.annobin_ostream_multiplex.c.annobin_ostream_multiplex.c_end.annobin_ostream_multiplex.c.hot.annobin_ostream_multiplex.c_end.hot.annobin_ostream_multiplex.c.unlikely.annobin_ostream_multiplex.c_end.unlikely.annobin_ostream_multiplex.c.startup.annobin_ostream_multiplex.c_end.startup.annobin_ostream_multiplex.c.exit.annobin_ostream_multiplex.c_end.exit.annobin_o_stream_multiplex_ochannel_set_flush_callback.start.annobin_o_stream_multiplex_ochannel_set_flush_callback.endo_stream_multiplex_ochannel_set_flush_callback.annobin_o_stream_multiplex_ochannel_destroy.start.annobin_o_stream_multiplex_ochannel_destroy.endo_stream_multiplex_ochannel_destroyo_stream_multiplex_flusho_stream_multiplex_ochannel_destroy.cold.4__func__.5528.annobin_o_stream_multiplex_ochannel_get_buffer_avail_size.start.annobin_o_stream_multiplex_ochannel_get_buffer_avail_size.endo_stream_multiplex_ochannel_get_buffer_avail_size.annobin_o_stream_multiplex_sendv.start.annobin_o_stream_multiplex_sendv.endo_stream_multiplex_sendvo_stream_multiplex_sendv.cold.5__func__.5451.annobin_o_stream_multiplex_flush.start.annobin_o_stream_multiplex_flush.end.annobin_o_stream_multiplex_ochannel_flush.start.annobin_o_stream_multiplex_ochannel_flush.endo_stream_multiplex_ochannel_flush.annobin_o_stream_multiplex_ochannel_cork.start.annobin_o_stream_multiplex_ochannel_cork.endo_stream_multiplex_ochannel_cork.annobin_o_stream_multiplex_ochannel_close.start.annobin_o_stream_multiplex_ochannel_close.endo_stream_multiplex_ochannel_close.annobin_o_stream_multiplex_ochannel_get_buffer_used_size.start.annobin_o_stream_multiplex_ochannel_get_buffer_used_size.endo_stream_multiplex_ochannel_get_buffer_used_size.annobin_o_stream_multiplex_ochannel_sendv.start.annobin_o_stream_multiplex_ochannel_sendv.endo_stream_multiplex_ochannel_sendv.annobin_o_stream_add_channel_real.start.annobin_o_stream_add_channel_real.endo_stream_add_channel_real.annobin_o_stream_multiplex_add_channel.start.annobin_o_stream_multiplex_add_channel.end__func__.5549o_stream_multiplex_add_channel.cold.6__func__.5412.annobin_o_stream_create_multiplex.start.annobin_o_stream_create_multiplex.end.annobin_o_stream_multiplex_get_channel_id.start.annobin_o_stream_multiplex_get_channel_id.end.annobin_ostream_null.c.annobin_ostream_null.c_end.annobin_ostream_null.c.hot.annobin_ostream_null.c_end.hot.annobin_ostream_null.c.unlikely.annobin_ostream_null.c_end.unlikely.annobin_ostream_null.c.startup.annobin_ostream_null.c_end.startup.annobin_ostream_null.c.exit.annobin_ostream_null.c_end.exit.annobin_o_stream_null_sendv.start.annobin_o_stream_null_sendv.endo_stream_null_sendv.annobin_o_stream_create_null.start.annobin_o_stream_create_null.end.annobin_ostream_rawlog.c.annobin_ostream_rawlog.c_end.annobin_ostream_rawlog.c.hot.annobin_ostream_rawlog.c_end.hot.annobin_ostream_rawlog.c.unlikely.annobin_ostream_rawlog.c_end.unlikely.annobin_ostream_rawlog.c.startup.annobin_ostream_rawlog.c_end.startup.annobin_ostream_rawlog.c.exit.annobin_ostream_rawlog.c_end.exit.annobin_o_stream_rawlog_close.start.annobin_o_stream_rawlog_close.endo_stream_rawlog_close.annobin_o_stream_rawlog_sendv.start.annobin_o_stream_rawlog_sendv.endo_stream_rawlog_sendv.annobin_o_stream_create_rawlog_from_stream.start.annobin_o_stream_create_rawlog_from_stream.end.annobin_o_stream_create_rawlog.start.annobin_o_stream_create_rawlog.endo_stream_create_rawlog.cold.1__func__.5188.annobin_ostream_unix.c.annobin_ostream_unix.c_end.annobin_ostream_unix.c.hot.annobin_ostream_unix.c_end.hot.annobin_ostream_unix.c.unlikely.annobin_ostream_unix.c_end.unlikely.annobin_ostream_unix.c.startup.annobin_ostream_unix.c_end.startup.annobin_ostream_unix.c.exit.annobin_ostream_unix.c_end.exit.annobin_o_stream_unix_writev.start.annobin_o_stream_unix_writev.endo_stream_unix_writevo_stream_unix_writev.cold.1.annobin_o_stream_unix_close.start.annobin_o_stream_unix_close.endo_stream_unix_close__func__.5179.annobin_o_stream_create_unix.start.annobin_o_stream_create_unix.endo_stream_create_unix.cold.2__func__.5195.annobin_o_stream_unix_write_fd.start.annobin_o_stream_unix_write_fd.endo_stream_unix_write_fd.cold.3__func__.5201.annobin_ostream_wrapper.c.annobin_ostream_wrapper.c_end.annobin_ostream_wrapper.c.hot.annobin_ostream_wrapper.c_end.hot.annobin_ostream_wrapper.c.unlikely.annobin_ostream_wrapper.c_end.unlikely.annobin_ostream_wrapper.c.startup.annobin_ostream_wrapper.c_end.startup.annobin_ostream_wrapper.c.exit.annobin_ostream_wrapper.c_end.exit.annobin_wrapper_ostream_get_buffer_avail_size.start.annobin_wrapper_ostream_get_buffer_avail_size.endwrapper_ostream_get_buffer_avail_size.annobin_wrapper_ostream_get_buffer_used_size.start.annobin_wrapper_ostream_get_buffer_used_size.endwrapper_ostream_get_buffer_used_size.annobin_wrapper_ostream_close.start.annobin_wrapper_ostream_close.endwrapper_ostream_close.annobin_wrapper_ostream_destroy.start.annobin_wrapper_ostream_destroy.endwrapper_ostream_destroy.annobin_wrapper_ostream_output_start.part.1.start.annobin_wrapper_ostream_output_start.part.1.endwrapper_ostream_output_start.part.1.annobin_wrapper_ostream_send_prepare.start.annobin_wrapper_ostream_send_prepare.endwrapper_ostream_send_prepare.annobin_wrapper_ostream_output_halt.part.2.start.annobin_wrapper_ostream_output_halt.part.2.endwrapper_ostream_output_halt.part.2.annobin_wrapper_ostream_switch_ioloop_to.start.annobin_wrapper_ostream_switch_ioloop_to.endwrapper_ostream_switch_ioloop_to.annobin_wrapper_ostream_output_ready.part.5.start.annobin_wrapper_ostream_output_ready.part.5.endwrapper_ostream_output_ready.part.5.annobin_wrapper_ostream_copy_parent_error.start.annobin_wrapper_ostream_copy_parent_error.endwrapper_ostream_copy_parent_errorwrapper_ostream_copy_parent_error.cold.17__func__.5339.annobin_wrapper_ostream_handle_parent_error.start.annobin_wrapper_ostream_handle_parent_error.endwrapper_ostream_handle_parent_error.annobin_wrapper_ostream_writev.start.annobin_wrapper_ostream_writev.endwrapper_ostream_writevwrapper_ostream_writev.cold.18__func__.5411.annobin_wrapper_ostream_flush_pending.start.annobin_wrapper_ostream_flush_pending.endwrapper_ostream_flush_pendingwrapper_ostream_handle_eventwrapper_ostream_flush_pending.cold.19.annobin_wrapper_ostream_set_flush_callback.start.annobin_wrapper_ostream_set_flush_callback.endwrapper_ostream_set_flush_callback.annobin_wrapper_ostream_handle_pending_error.part.9.start.annobin_wrapper_ostream_handle_pending_error.part.9.endwrapper_ostream_handle_pending_error.part.9.annobin_wrapper_ostream_finish.start.annobin_wrapper_ostream_finish.endwrapper_ostream_finish__func__.5386wrapper_ostream_finish.cold.20.annobin_wrapper_ostream_output_update_timeouts.part.11.start.annobin_wrapper_ostream_output_update_timeouts.part.11.endwrapper_ostream_output_update_timeouts.part.11.annobin_wrapper_ostream_output_manage.start.annobin_wrapper_ostream_output_manage.endwrapper_ostream_output_manage.annobin_wrapper_ostream_flush_wait.start.annobin_wrapper_ostream_flush_wait.endwrapper_ostream_flush_waitwrapper_ostream_flush_wait.cold.21__func__.5394.annobin_wrapper_ostream_writev_full.part.12.start.annobin_wrapper_ostream_writev_full.part.12.endwrapper_ostream_writev_full.part.12wrapper_ostream_writev_full.part.12.cold.22.annobin_wrapper_ostream_flush_buffer.start.annobin_wrapper_ostream_flush_buffer.endwrapper_ostream_flush_bufferwrapper_ostream_flush_buffer.cold.23__func__.5439.annobin_wrapper_ostream_flush.start.annobin_wrapper_ostream_flush.endwrapper_ostream_flushwrapper_ostream_flush.cold.24__func__.5531__func__.5447__func__.5403.annobin_wrapper_ostream_callback.start.annobin_wrapper_ostream_callback.endwrapper_ostream_callback.annobin_wrapper_ostream_cork.start.annobin_wrapper_ostream_cork.endwrapper_ostream_corkwrapper_ostream_cork.cold.25.annobin_wrapper_ostream_sendv.start.annobin_wrapper_ostream_sendv.endwrapper_ostream_sendv__func__.5483wrapper_ostream_sendv.cold.26__func__.5467.annobin_wrapper_ostream_create.start.annobin_wrapper_ostream_create.end.annobin_wrapper_ostream_continue.start.annobin_wrapper_ostream_continue.endwrapper_ostream_continue.cold.27__func__.5579.annobin_wrapper_ostream_handle_event.start.annobin_wrapper_ostream_handle_event.end.annobin_wrapper_ostream_trigger_flush.start.annobin_wrapper_ostream_trigger_flush.end.annobin_wrapper_ostream_get_buffered_size.start.annobin_wrapper_ostream_get_buffered_size.endwrapper_ostream_get_buffered_size.cold.28__func__.5594.annobin_wrapper_ostream_output_available.start.annobin_wrapper_ostream_output_available.endwrapper_ostream_output_available.cold.29__func__.5599.annobin_wrapper_ostream_output_destroyed.start.annobin_wrapper_ostream_output_destroyed.end.annobin_wrapper_ostream_set_error.start.annobin_wrapper_ostream_set_error.endwrapper_ostream_set_error.cold.30__func__.5610.annobin_wrapper_ostream_notify_error.start.annobin_wrapper_ostream_notify_error.end.annobin_path_util.c.annobin_path_util.c_end.annobin_path_util.c.hot.annobin_path_util.c_end.hot.annobin_path_util.c.unlikely.annobin_path_util.c_end.unlikely.annobin_path_util.c.startup.annobin_path_util.c_end.startup.annobin_path_util.c.exit.annobin_path_util.c_end.exit.annobin_t_getcwd_noalloc.start.annobin_t_getcwd_noalloc.endt_getcwd_noalloc.annobin_path_normalize.start.annobin_path_normalize.endpath_normalizepath_normalize.cold.3__func__.5737.annobin_t_normpath.start.annobin_t_normpath.end.annobin_t_normpath_to.start.annobin_t_normpath_to.endt_normpath_to.cold.4__func__.5778.annobin_t_realpath.start.annobin_t_realpath.end.annobin_t_realpath_to.start.annobin_t_realpath_to.endt_realpath_to.cold.5.annobin_t_abspath_to.start.annobin_t_abspath_to.endt_abspath_to.cold.6__func__.5803.annobin_t_get_working_dir.start.annobin_t_get_working_dir.endt_get_working_dir.cold.7__func__.5809.annobin_t_abspath.start.annobin_t_abspath.endt_abspath.cold.8.annobin_t_readlink.start.annobin_t_readlink.endt_readlink.cold.9.annobin_t_binary_abspath.start.annobin_t_binary_abspath.end.annobin_pkcs5.c.annobin_pkcs5.c_end.annobin_pkcs5.c.hot.annobin_pkcs5.c_end.hot.annobin_pkcs5.c.unlikely.annobin_pkcs5.c_end.unlikely.annobin_pkcs5.c.startup.annobin_pkcs5.c_end.startup.annobin_pkcs5.c.exit.annobin_pkcs5.c_end.exit.annobin_pkcs5_pbkdf2.start.annobin_pkcs5_pbkdf2.endpkcs5_pbkdf2.annobin_pkcs5_pbkdf.start.annobin_pkcs5_pbkdf.endpkcs5_pbkdf.cold.0.annobin_primes.c.annobin_primes.c_end.annobin_primes.c.hot.annobin_primes.c_end.hot.annobin_primes.c.unlikely.annobin_primes.c_end.unlikely.annobin_primes.c.startup.annobin_primes.c_end.startup.annobin_primes.c.exit.annobin_primes.c_end.exit.annobin_primes_closest.start.annobin_primes_closest.endprimes.annobin_printf_format_fix.c.annobin_printf_format_fix.c_end.annobin_printf_format_fix.c.hot.annobin_printf_format_fix.c_end.hot.annobin_printf_format_fix.c.unlikely.annobin_printf_format_fix.c_end.unlikely.annobin_printf_format_fix.c.startup.annobin_printf_format_fix.c_end.startup.annobin_printf_format_fix.c.exit.annobin_printf_format_fix.c_end.exit.annobin_verify_length.start.annobin_verify_length.endverify_length.annobin_printf_format_fix_noalloc.start.annobin_printf_format_fix_noalloc.endprintf_format_fix_noallocprintf_format_fix_noalloc.cold.1__func__.4522.annobin_printf_format_fix_get_len.start.annobin_printf_format_fix_get_len.end.annobin_printf_format_fix.start.annobin_printf_format_fix.end.annobin_printf_format_fix_unsafe.start.annobin_printf_format_fix_unsafe.end.annobin_process_stat.c.annobin_process_stat.c_end.annobin_process_stat.c.hot.annobin_process_stat.c_end.hot.annobin_process_stat.c.unlikely.annobin_process_stat.c_end.unlikely.annobin_process_stat.c.startup.annobin_process_stat.c_end.startup.annobin_process_stat.c.exit.annobin_process_stat.c_end.exit.annobin_open_fd.start.annobin_open_fd.endopen_fd.annobin_read_file.start.annobin_read_file.endread_file__func__.6299.annobin_parse_stat_file.start.annobin_parse_stat_file.endparse_stat_file.annobin_parse_key_val_file.start.annobin_parse_key_val_file.endparse_key_val_file.annobin_parse_all_stats.start.annobin_parse_all_stats.endparse_all_stats.annobin_process_stat_read_start.start.annobin_process_stat_read_start.end.annobin_process_stat_read_finish.start.annobin_process_stat_read_finish.end.annobin_process_title.c.annobin_process_title.c_end.annobin_process_title.c.hot.annobin_process_title.c_end.hot.annobin_process_title.c.unlikely.annobin_process_title.c_end.unlikely.annobin_process_title.c.startup.annobin_process_title.c_end.startup.annobin_process_title.c.exit.annobin_process_title.c_end.exit.annobin_argv_dup.start.annobin_argv_dup.endargv_dupargv_dup.cold.0__func__.5410.annobin_process_title_init.start.annobin_process_title_init.endargv_memblockenviron_memblockprocess_title_lenprocess_title_clean_posprocess_nameprocess_title_init.cold.1.annobin_process_title_set.start.annobin_process_title_set.endcurrent_process_titleprocess_title_counterprocess_title_set.cold.2__func__.5425.annobin_process_title_get.start.annobin_process_title_get.end.annobin_process_title_get_counter.start.annobin_process_title_get_counter.end.annobin_process_title_deinit.start.annobin_process_title_deinit.end.annobin_priorityq.c.annobin_priorityq.c_end.annobin_priorityq.c.hot.annobin_priorityq.c_end.hot.annobin_priorityq.c.unlikely.annobin_priorityq.c_end.unlikely.annobin_priorityq.c.startup.annobin_priorityq.c_end.startup.annobin_priorityq.c.exit.annobin_priorityq.c_end.exit.annobin_heap_items_swap.start.annobin_heap_items_swap.endheap_items_swapheap_items_swap.cold.10.annobin_heap_item_bubble_up.start.annobin_heap_item_bubble_up.endheap_item_bubble_upheap_item_bubble_up.cold.11__func__.4823.annobin_priorityq_remove_idx.start.annobin_priorityq_remove_idx.endpriorityq_remove_idxpriorityq_remove_idx.cold.12__func__.4849.annobin_priorityq_init.start.annobin_priorityq_init.end.annobin_priorityq_deinit.start.annobin_priorityq_deinit.end.annobin_priorityq_count.start.annobin_priorityq_count.end.annobin_priorityq_add.start.annobin_priorityq_add.end.annobin_priorityq_remove.start.annobin_priorityq_remove.end.annobin_priorityq_peek.start.annobin_priorityq_peek.endpriorityq_peek.cold.13.annobin_priorityq_pop.start.annobin_priorityq_pop.end.annobin_priorityq_items.start.annobin_priorityq_items.endpriorityq_items.cold.14.annobin_randgen.c.annobin_randgen.c_end.annobin_randgen.c.hot.annobin_randgen.c_end.hot.annobin_randgen.c.unlikely.annobin_randgen.c_end.unlikely.annobin_randgen.c.startup.annobin_randgen.c_end.startup.annobin_randgen.c.exit.annobin_randgen.c_end.exit.annobin_random_open_urandom.start.annobin_random_open_urandom.endrandom_open_urandomurandom_fdrandom_open_urandom.cold.2.annobin_random_read.part.0.start.annobin_random_read.part.0.endrandom_read.part.0getrandom_present.annobin_random_fill.start.annobin_random_fill.endrandom_nextrandom_next_posrandom_next_sizerandom_fill.cold.3__func__.5450.annobin_random_init.start.annobin_random_init.end.annobin_random_deinit.start.annobin_random_deinit.end.annobin_rand.c.annobin_rand.c_end.annobin_rand.c.hot.annobin_rand.c_end.hot.annobin_rand.c.unlikely.annobin_rand.c_end.unlikely.annobin_rand.c.startup.annobin_rand.c_end.startup.annobin_rand.c.exit.annobin_rand.c_end.exit.annobin_i_rand.start.annobin_i_rand.end.annobin_i_rand_limit.start.annobin_i_rand_limit.endi_rand_limit.cold.0__func__.4519.annobin_read_full.c.annobin_read_full.c_end.annobin_read_full.c.hot.annobin_read_full.c_end.hot.annobin_read_full.c.unlikely.annobin_read_full.c_end.unlikely.annobin_read_full.c.startup.annobin_read_full.c_end.startup.annobin_read_full.c.exit.annobin_read_full.c_end.exit.annobin_read_full.start.annobin_read_full.end.annobin_pread_full.start.annobin_pread_full.end.annobin_restrict_access.c.annobin_restrict_access.c_end.annobin_restrict_access.c.hot.annobin_restrict_access.c_end.hot.annobin_restrict_access.c.unlikely.annobin_restrict_access.c_end.unlikely.annobin_restrict_access.c.startup.annobin_restrict_access.c_end.startup.annobin_restrict_access.c.exit.annobin_restrict_access.c_end.exit.annobin_get_uid_str.start.annobin_get_uid_str.endget_uid_str.annobin_get_gid_str.start.annobin_get_gid_str.endget_gid_str.annobin_restrict_access_init.start.annobin_restrict_access_init.end.annobin_restrict_get_groups_list.start.annobin_restrict_get_groups_list.endrestrict_get_groups_list.cold.2.annobin_restrict_access.start.annobin_restrict_access.endprocess_primary_gidprocess_privileged_gidchroot_dirrestrict_access.cold.3__func__.6969.annobin_restrict_access_set_env.start.annobin_restrict_access_set_env.end.annobin_restrict_access_get_env.start.annobin_restrict_access_get_env.endrestrict_access_get_env.cold.4.annobin_restrict_access_by_env.start.annobin_restrict_access_by_env.end.annobin_restrict_access_get_current_chroot.start.annobin_restrict_access_get_current_chroot.end.annobin_restrict_access_set_dumpable.start.annobin_restrict_access_set_dumpable.endrestrict_access_set_dumpable.cold.5.annobin_restrict_access_get_dumpable.start.annobin_restrict_access_get_dumpable.endrestrict_access_get_dumpable.cold.6.annobin_restrict_access_allow_coredumps.start.annobin_restrict_access_allow_coredumps.end.annobin_restrict_access_use_priv_gid.start.annobin_restrict_access_use_priv_gid.endprocess_using_priv_gidrestrict_access_use_priv_gid.cold.7__func__.7003.annobin_restrict_access_drop_priv_gid.start.annobin_restrict_access_drop_priv_gid.endrestrict_access_drop_priv_gid.cold.8.annobin_restrict_access_have_priv_gid.start.annobin_restrict_access_have_priv_gid.end.annobin_restrict_access_deinit.start.annobin_restrict_access_deinit.end.annobin_restrict_process_size.c.annobin_restrict_process_size.c_end.annobin_restrict_process_size.c.hot.annobin_restrict_process_size.c_end.hot.annobin_restrict_process_size.c.unlikely.annobin_restrict_process_size.c_end.unlikely.annobin_restrict_process_size.c.startup.annobin_restrict_process_size.c_end.startup.annobin_restrict_process_size.c.exit.annobin_restrict_process_size.c_end.exit.annobin_restrict_process_size.start.annobin_restrict_process_size.endrestrict_process_size.cold.0.annobin_restrict_process_count.start.annobin_restrict_process_count.endrestrict_process_count.cold.1.annobin_restrict_fd_limit.start.annobin_restrict_fd_limit.endrestrict_fd_limit.cold.2.annobin_restrict_get_process_size.start.annobin_restrict_get_process_size.endrestrict_get_process_size.cold.3.annobin_restrict_get_core_limit.start.annobin_restrict_get_core_limit.endrestrict_get_core_limit.cold.4.annobin_restrict_get_process_limit.start.annobin_restrict_get_process_limit.endrestrict_get_process_limit.cold.5.annobin_restrict_get_fd_limit.start.annobin_restrict_get_fd_limit.endrestrict_get_fd_limit.cold.6.annobin_safe_memset.c.annobin_safe_memset.c_end.annobin_safe_memset.c.hot.annobin_safe_memset.c_end.hot.annobin_safe_memset.c.unlikely.annobin_safe_memset.c_end.unlikely.annobin_safe_memset.c.startup.annobin_safe_memset.c_end.startup.annobin_safe_memset.c.exit.annobin_safe_memset.c_end.exit.annobin_safe_memset.start.annobin_safe_memset.end.annobin_safe_mkdir.c.annobin_safe_mkdir.c_end.annobin_safe_mkdir.c.hot.annobin_safe_mkdir.c_end.hot.annobin_safe_mkdir.c.unlikely.annobin_safe_mkdir.c_end.unlikely.annobin_safe_mkdir.c.startup.annobin_safe_mkdir.c_end.startup.annobin_safe_mkdir.c.exit.annobin_safe_mkdir.c_end.exit.annobin_safe_mkdir.start.annobin_safe_mkdir.endsafe_mkdir.cold.0.annobin_safe_mkstemp.c.annobin_safe_mkstemp.c_end.annobin_safe_mkstemp.c.hot.annobin_safe_mkstemp.c_end.hot.annobin_safe_mkstemp.c.unlikely.annobin_safe_mkstemp.c_end.unlikely.annobin_safe_mkstemp.c.startup.annobin_safe_mkstemp.c_end.startup.annobin_safe_mkstemp.c.exit.annobin_safe_mkstemp.c_end.exit.annobin_safe_mkstemp_full.start.annobin_safe_mkstemp_full.endsafe_mkstemp_full.annobin_safe_mkstemp.start.annobin_safe_mkstemp.end.annobin_safe_mkstemp_group.start.annobin_safe_mkstemp_group.end.annobin_safe_mkstemp_hostpid.start.annobin_safe_mkstemp_hostpid.end.annobin_safe_mkstemp_hostpid_group.start.annobin_safe_mkstemp_hostpid_group.end.annobin_sendfile_util.c.annobin_sendfile_util.c_end.annobin_sendfile_util.c.hot.annobin_sendfile_util.c_end.hot.annobin_sendfile_util.c.unlikely.annobin_sendfile_util.c_end.unlikely.annobin_sendfile_util.c.startup.annobin_sendfile_util.c_end.startup.annobin_sendfile_util.c.exit.annobin_sendfile_util.c_end.exit.annobin_safe_sendfile.start.annobin_safe_sendfile.endsafe_sendfile.cold.0__func__.4523.annobin_seq_range_array.c.annobin_seq_range_array.c_end.annobin_seq_range_array.c.hot.annobin_seq_range_array.c_end.hot.annobin_seq_range_array.c.unlikely.annobin_seq_range_array.c_end.unlikely.annobin_seq_range_array.c.startup.annobin_seq_range_array.c_end.startup.annobin_seq_range_array.c.exit.annobin_seq_range_array.c_end.exit.annobin_seq_range_lookup.start.annobin_seq_range_lookup.endseq_range_lookupseq_range_lookup.cold.12.annobin_seq_range_array_add_range_internal.start.annobin_seq_range_array_add_range_internal.endseq_range_array_add_range_internal__func__.4900seq_range_array_add_range_internal.cold.13.annobin_seq_range_length.isra.4.part.5.start.annobin_seq_range_length.isra.4.part.5.endseq_range_length.isra.4.part.5__func__.4780.annobin_seq_range_array_add.start.annobin_seq_range_array_add.end__func__.4875seq_range_array_add.cold.14__func__.4866.annobin_seq_range_array_add_with_init.start.annobin_seq_range_array_add_with_init.end.annobin_seq_range_array_add_range.start.annobin_seq_range_array_add_range.end.annobin_seq_range_array_add_range_count.start.annobin_seq_range_array_add_range_count.end.annobin_seq_range_array_merge.start.annobin_seq_range_array_merge.endseq_range_array_merge.cold.15.annobin_seq_range_array_merge_n.start.annobin_seq_range_array_merge_n.end.annobin_seq_range_array_remove.start.annobin_seq_range_array_remove.endseq_range_array_remove.cold.16.annobin_seq_range_array_remove_range.start.annobin_seq_range_array_remove_range.endseq_range_array_remove_range.cold.17.annobin_seq_range_array_remove_seq_range.start.annobin_seq_range_array_remove_seq_range.endseq_range_array_remove_seq_range.cold.18__func__.4972.annobin_seq_range_array_intersect.start.annobin_seq_range_array_intersect.endseq_range_array_intersect.cold.19.annobin_seq_range_exists.start.annobin_seq_range_exists.end.annobin_seq_range_array_have_common.start.annobin_seq_range_array_have_common.end.annobin_seq_range_count.start.annobin_seq_range_count.endseq_range_count.cold.20__func__.5022.annobin_seq_range_array_invert.start.annobin_seq_range_array_invert.endseq_range_array_invert.cold.21__func__.5036.annobin_seq_range_array_iter_init.start.annobin_seq_range_array_iter_init.end.annobin_seq_range_array_iter_nth.start.annobin_seq_range_array_iter_nth.endseq_range_array_iter_nth.cold.22.annobin_seq_range_array_remove_nth.start.annobin_seq_range_array_remove_nth.end.annobin_seq_set_builder.c.annobin_seq_set_builder.c_end.annobin_seq_set_builder.c.hot.annobin_seq_set_builder.c_end.hot.annobin_seq_set_builder.c.unlikely.annobin_seq_set_builder.c_end.unlikely.annobin_seq_set_builder.c.startup.annobin_seq_set_builder.c_end.startup.annobin_seq_set_builder.c.exit.annobin_seq_set_builder.c_end.exit.annobin_seqset_builder_init.start.annobin_seqset_builder_init.end.annobin_seqset_builder_add.start.annobin_seqset_builder_add.endseqset_builder_add.cold.4__func__.4740.annobin_seqset_builder_try_add.start.annobin_seqset_builder_try_add.end.annobin_seqset_builder_deinit.start.annobin_seqset_builder_deinit.end.annobin_sha1.c.annobin_sha1.c_end.annobin_sha1.c.hot.annobin_sha1.c_end.hot.annobin_sha1.c.unlikely.annobin_sha1.c_end.unlikely.annobin_sha1.c.startup.annobin_sha1.c_end.startup.annobin_sha1.c.exit.annobin_sha1.c_end.exit.annobin_sha1_step.start.annobin_sha1_step.endsha1_step.annobin_sha1_init.start.annobin_sha1_init.end.annobin_hash_method_init_sha1.start.annobin_hash_method_init_sha1.endhash_method_init_sha1.annobin_sha1_pad.start.annobin_sha1_pad.end.annobin_sha1_loop.start.annobin_sha1_loop.end.annobin_hash_method_loop_sha1.start.annobin_hash_method_loop_sha1.endhash_method_loop_sha1.annobin_sha1_result_libmysqlclient_craps_all_over.start.annobin_sha1_result_libmysqlclient_craps_all_over.end.annobin_hash_method_result_sha1.start.annobin_hash_method_result_sha1.endhash_method_result_sha1.annobin_sha1_get_digest.start.annobin_sha1_get_digest.end.annobin_sha2.c.annobin_sha2.c_end.annobin_sha2.c.hot.annobin_sha2.c_end.hot.annobin_sha2.c.unlikely.annobin_sha2.c_end.unlikely.annobin_sha2.c.startup.annobin_sha2.c_end.startup.annobin_sha2.c.exit.annobin_sha2.c_end.exit.annobin_sha256_transf.start.annobin_sha256_transf.endsha256_transfsha256_k.annobin_sha384_transf.start.annobin_sha384_transf.endsha384_transfsha512_k.annobin_sha512_transf.start.annobin_sha512_transf.endsha512_transf.annobin_sha256_init.start.annobin_sha256_init.end.annobin_hash_method_init_sha256.start.annobin_hash_method_init_sha256.endhash_method_init_sha256.annobin_sha256_loop.start.annobin_sha256_loop.end.annobin_hash_method_loop_sha256.start.annobin_hash_method_loop_sha256.endhash_method_loop_sha256.annobin_sha256_result.start.annobin_sha256_result.end.annobin_hash_method_result_sha256.start.annobin_hash_method_result_sha256.endhash_method_result_sha256.annobin_sha256_get_digest.start.annobin_sha256_get_digest.end.annobin_sha384_init.start.annobin_sha384_init.end.annobin_hash_method_init_sha384.start.annobin_hash_method_init_sha384.endhash_method_init_sha384.annobin_sha384_loop.start.annobin_sha384_loop.end.annobin_hash_method_loop_sha384.start.annobin_hash_method_loop_sha384.endhash_method_loop_sha384.annobin_sha384_result.start.annobin_sha384_result.end.annobin_hash_method_result_sha384.start.annobin_hash_method_result_sha384.endhash_method_result_sha384.annobin_sha384_get_digest.start.annobin_sha384_get_digest.end.annobin_sha512_init.start.annobin_sha512_init.end.annobin_hash_method_init_sha512.start.annobin_hash_method_init_sha512.endhash_method_init_sha512.annobin_sha512_loop.start.annobin_sha512_loop.end.annobin_hash_method_loop_sha512.start.annobin_hash_method_loop_sha512.endhash_method_loop_sha512.annobin_sha512_result.start.annobin_sha512_result.end.annobin_hash_method_result_sha512.start.annobin_hash_method_result_sha512.endhash_method_result_sha512.annobin_sha512_get_digest.start.annobin_sha512_get_digest.end.annobin_sha3.c.annobin_sha3.c_end.annobin_sha3.c.hot.annobin_sha3.c_end.hot.annobin_sha3.c.unlikely.annobin_sha3.c_end.unlikely.annobin_sha3.c.startup.annobin_sha3.c_end.startup.annobin_sha3.c.exit.annobin_sha3.c_end.exit.annobin_keccakf.start.annobin_keccakf.endkeccakfkeccakf_pilnkeccakf_rotckeccakf_rndc.annobin_sha3_finalize.start.annobin_sha3_finalize.endsha3_finalize.annobin_sha3_256_init.start.annobin_sha3_256_init.end.annobin_hash_method_init_sha3_256.start.annobin_hash_method_init_sha3_256.endhash_method_init_sha3_256.annobin_sha3_512_init.start.annobin_sha3_512_init.end.annobin_hash_method_init_sha3_512.start.annobin_hash_method_init_sha3_512.endhash_method_init_sha3_512.annobin_sha3_loop.start.annobin_sha3_loop.endsha3_loop.cold.0__func__.5296.annobin_hash_method_loop_sha3.start.annobin_hash_method_loop_sha3.endhash_method_loop_sha3.annobin_sha3_256_result.start.annobin_sha3_256_result.end.annobin_hash_method_result_sha3_256.start.annobin_hash_method_result_sha3_256.endhash_method_result_sha3_256.annobin_sha3_512_result.start.annobin_sha3_512_result.end.annobin_hash_method_result_sha3_512.start.annobin_hash_method_result_sha3_512.endhash_method_result_sha3_512.annobin_sha3_256_get_digest.start.annobin_sha3_256_get_digest.end.annobin_sha3_512_get_digest.start.annobin_sha3_512_get_digest.end.annobin_sleep.c.annobin_sleep.c_end.annobin_sleep.c.hot.annobin_sleep.c_end.hot.annobin_sleep.c.unlikely.annobin_sleep.c_end.unlikely.annobin_sleep.c.startup.annobin_sleep.c_end.startup.annobin_sleep.c.exit.annobin_sleep.c_end.exit.annobin_sleep_timespec.start.annobin_sleep_timespec.endsleep_timespecsleep_timespec.cold.0.annobin_i_sleep_usecs.start.annobin_i_sleep_usecs.end.annobin_i_sleep_msecs.start.annobin_i_sleep_msecs.end.annobin_i_sleep_secs.start.annobin_i_sleep_secs.end.annobin_i_sleep_intr_usecs.start.annobin_i_sleep_intr_usecs.end.annobin_i_sleep_intr_msecs.start.annobin_i_sleep_intr_msecs.end.annobin_i_sleep_intr_secs.start.annobin_i_sleep_intr_secs.end.annobin_sort.c.annobin_sort.c_end.annobin_sort.c.hot.annobin_sort.c_end.hot.annobin_sort.c.unlikely.annobin_sort.c_end.unlikely.annobin_sort.c.startup.annobin_sort.c_end.startup.annobin_sort.c.exit.annobin_sort.c_end.exit.annobin_bsearch_strcmp.start.annobin_bsearch_strcmp.end.annobin_bsearch_strcasecmp.start.annobin_bsearch_strcasecmp.end.annobin_stats_dist.c.annobin_stats_dist.c_end.annobin_stats_dist.c.hot.annobin_stats_dist.c_end.hot.annobin_stats_dist.c.unlikely.annobin_stats_dist.c_end.unlikely.annobin_stats_dist.c.startup.annobin_stats_dist.c_end.startup.annobin_stats_dist.c.exit.annobin_stats_dist.c_end.exit.annobin_uint64_cmp.start.annobin_uint64_cmp.enduint64_cmp.annobin_stats_dist_init_with_size.start.annobin_stats_dist_init_with_size.endstats_dist_init_with_size.cold.2__func__.4567.annobin_stats_dist_init.start.annobin_stats_dist_init.end.annobin_stats_dist_deinit.start.annobin_stats_dist_deinit.end.annobin_stats_dist_reset.start.annobin_stats_dist_reset.end.annobin_stats_dist_add.start.annobin_stats_dist_add.end.annobin_stats_dist_get_count.start.annobin_stats_dist_get_count.end.annobin_stats_dist_get_sum.start.annobin_stats_dist_get_sum.end.annobin_stats_dist_get_min.start.annobin_stats_dist_get_min.end.annobin_stats_dist_get_max.start.annobin_stats_dist_get_max.end.annobin_stats_dist_get_avg.start.annobin_stats_dist_get_avg.end.annobin_stats_dist_get_median.start.annobin_stats_dist_get_median.end.annobin_stats_dist_get_variance.start.annobin_stats_dist_get_variance.end.annobin_stats_dist_get_percentile.start.annobin_stats_dist_get_percentile.end.annobin_stats_dist_get_samples.start.annobin_stats_dist_get_samples.end.annobin_str.c.annobin_str.c_end.annobin_str.c.hot.annobin_str.c_end.hot.annobin_str.c.unlikely.annobin_str.c_end.unlikely.annobin_str.c.startup.annobin_str.c_end.startup.annobin_str.c.exit.annobin_str.c_end.exit.annobin_str_add_nul.start.annobin_str_add_nul.endstr_add_nul.annobin_str_new.start.annobin_str_new.end.annobin_str_new_const.start.annobin_str_new_const.endstr_new_const.cold.4__func__.5351.annobin_t_str_new.start.annobin_t_str_new.end.annobin_t_str_new_const.start.annobin_t_str_new_const.end.annobin_str_free.start.annobin_str_free.end.annobin_str_free_without_data.start.annobin_str_free_without_data.end.annobin_str_c.start.annobin_str_c.end.annobin_str_c_modifiable.start.annobin_str_c_modifiable.end.annobin_str_equals.start.annobin_str_equals.end.annobin_str_append_max.start.annobin_str_append_max.end.annobin_str_vprintfa.start.annobin_str_vprintfa.endstr_vprintfa.cold.5.annobin_str_printfa.start.annobin_str_printfa.end.annobin_str_truncate_utf8.start.annobin_str_truncate_utf8.end.annobin_str_find.c.annobin_str_find.c_end.annobin_str_find.c.hot.annobin_str_find.c_end.hot.annobin_str_find.c.unlikely.annobin_str_find.c_end.unlikely.annobin_str_find.c.startup.annobin_str_find.c_end.startup.annobin_str_find.c.exit.annobin_str_find.c_end.exit.annobin_str_find_init.start.annobin_str_find_init.endstr_find_init.cold.0__func__.4577.annobin_str_find_deinit.start.annobin_str_find_deinit.end.annobin_str_find_more.start.annobin_str_find_more.endstr_find_more.cold.1__func__.4602.annobin_str_find_get_match_end_pos.start.annobin_str_find_get_match_end_pos.end.annobin_str_find_reset.start.annobin_str_find_reset.end.annobin_str_sanitize.c.annobin_str_sanitize.c_end.annobin_str_sanitize.c.hot.annobin_str_sanitize.c_end.hot.annobin_str_sanitize.c.unlikely.annobin_str_sanitize.c_end.unlikely.annobin_str_sanitize.c.startup.annobin_str_sanitize.c_end.startup.annobin_str_sanitize.c.exit.annobin_str_sanitize.c_end.exit.annobin_str_sanitize_append.start.annobin_str_sanitize_append.endstr_sanitize_append.cold.3__func__.4833.annobin_str_sanitize_append_utf8.start.annobin_str_sanitize_append_utf8.endstr_sanitize_append_utf8.cold.4.annobin_str_sanitize.start.annobin_str_sanitize.endstr_sanitize.cold.5__func__.4814.annobin_str_sanitize_utf8.start.annobin_str_sanitize_utf8.endstr_sanitize_utf8.cold.6.annobin_str_table.c.annobin_str_table.c_end.annobin_str_table.c.hot.annobin_str_table.c_end.hot.annobin_str_table.c.unlikely.annobin_str_table.c_end.unlikely.annobin_str_table.c.startup.annobin_str_table.c_end.startup.annobin_str_table.c.exit.annobin_str_table.c_end.exit.annobin_str_table_init.start.annobin_str_table_init.end.annobin_str_table_deinit.start.annobin_str_table_deinit.end.annobin_str_table_is_empty.start.annobin_str_table_is_empty.end.annobin_str_table_ref.start.annobin_str_table_ref.endstr_table_ref.cold.1__func__.4623.annobin_str_table_unref.start.annobin_str_table_unref.endstr_table_unref.cold.2.annobin_strescape.c.annobin_strescape.c_end.annobin_strescape.c.hot.annobin_strescape.c_end.hot.annobin_strescape.c.unlikely.annobin_strescape.c_end.unlikely.annobin_strescape.c.startup.annobin_strescape.c_end.startup.annobin_strescape.c.exit.annobin_strescape.c_end.exit.annobin_str_tabunescape_from.start.annobin_str_tabunescape_from.endstr_tabunescape_from.annobin_p_strsplit_tabescaped_inplace.start.annobin_p_strsplit_tabescaped_inplace.endp_strsplit_tabescaped_inplacep_strsplit_tabescaped_inplace.cold.1__func__.4906.annobin_str_append_escaped.start.annobin_str_append_escaped.end.annobin_str_nescape.start.annobin_str_nescape.end.annobin_str_append_unescaped.start.annobin_str_append_unescaped.end.annobin_str_unescape.start.annobin_str_unescape.end.annobin_str_unescape_next.start.annobin_str_unescape_next.end.annobin_str_append_tabescaped_n.start.annobin_str_append_tabescaped_n.end.annobin_str_append_tabescaped.start.annobin_str_append_tabescaped.endstr_append_tabescaped.cold.2.annobin_str_tabescape.start.annobin_str_tabescape.end.annobin_str_append_tabunescaped.start.annobin_str_append_tabunescaped.end.annobin_str_tabunescape.start.annobin_str_tabunescape.end.annobin_t_str_tabunescape.start.annobin_t_str_tabunescape.end.annobin_t_strsplit_tabescaped_inplace.start.annobin_t_strsplit_tabescaped_inplace.end.annobin_p_strsplit_tabescaped.start.annobin_p_strsplit_tabescaped.end.annobin_t_strsplit_tabescaped.start.annobin_t_strsplit_tabescaped.end.annobin_strfuncs.c.annobin_strfuncs.c_end.annobin_strfuncs.c.hot.annobin_strfuncs.c_end.hot.annobin_strfuncs.c.unlikely.annobin_strfuncs.c_end.unlikely.annobin_strfuncs.c.startup.annobin_strfuncs.c_end.startup.annobin_strfuncs.c.exit.annobin_strfuncs.c_end.exit.annobin_str_trim_parse.start.annobin_str_trim_parse.endstr_trim_parse.annobin_i_snprintf.start.annobin_i_snprintf.endi_snprintf.cold.8.annobin_p_strdup.start.annobin_p_strdup.endp_strdup.cold.9.annobin_split_str.start.annobin_split_str.endsplit_strsplit_str.cold.10__func__.5908.annobin_p_memdup.start.annobin_p_memdup.endp_memdup.cold.11.annobin_p_strarray_join_n.start.annobin_p_strarray_join_n.endp_strarray_join_n.annobin_p_strdup_empty.start.annobin_p_strdup_empty.end.annobin_p_strdup_until.start.annobin_p_strdup_until.endp_strdup_until.cold.12.annobin_p_strndup.start.annobin_p_strndup.endp_strndup.cold.13.annobin_t_noalloc_strdup_vprintf.start.annobin_t_noalloc_strdup_vprintf.endt_noalloc_strdup_vprintf.cold.14__func__.5568.annobin_p_strdup_vprintf.start.annobin_p_strdup_vprintf.endp_strdup_vprintf.cold.15.annobin_p_strdup_printf.start.annobin_p_strdup_printf.end.annobin_vstrconcat.start.annobin_vstrconcat.endvstrconcat.cold.16__func__.5587.annobin_p_strconcat.start.annobin_p_strconcat.endp_strconcat.cold.17.annobin_t_strdup_noconst.start.annobin_t_strdup_noconst.end.annobin_t_strdup.start.annobin_t_strdup.end.annobin_t_strdup_empty.start.annobin_t_strdup_empty.end.annobin_t_strdup_until.start.annobin_t_strdup_until.endt_strdup_until.cold.18__func__.5619.annobin_t_strndup.start.annobin_t_strndup.endt_strndup.cold.19__func__.5624.annobin_t_strdup_printf.start.annobin_t_strdup_printf.end.annobin_t_strdup_vprintf.start.annobin_t_strdup_vprintf.end.annobin_t_strconcat.start.annobin_t_strconcat.endt_strconcat.cold.20.annobin_t_strcut.start.annobin_t_strcut.end.annobin_t_str_replace.start.annobin_t_str_replace.end.annobin_t_str_oneline.start.annobin_t_str_oneline.end.annobin_i_strocpy.start.annobin_i_strocpy.end.annobin_str_ucase.start.annobin_str_ucase.end.annobin_str_lcase.start.annobin_str_lcase.end.annobin_t_str_lcase.start.annobin_t_str_lcase.endt_str_lcase.cold.21.annobin_t_str_ucase.start.annobin_t_str_ucase.endt_str_ucase.cold.22__func__.5711.annobin_i_strstr_arr.start.annobin_i_strstr_arr.end.annobin_t_str_trim.start.annobin_t_str_trim.end.annobin_p_str_trim.start.annobin_p_str_trim.end.annobin_str_ltrim.start.annobin_str_ltrim.end.annobin_t_str_ltrim.start.annobin_t_str_ltrim.end.annobin_p_str_ltrim.start.annobin_p_str_ltrim.end.annobin_t_str_rtrim.start.annobin_t_str_rtrim.end.annobin_p_str_rtrim.start.annobin_p_str_rtrim.end.annobin_null_strcmp.start.annobin_null_strcmp.end.annobin_null_strcasecmp.start.annobin_null_strcasecmp.end.annobin_i_memcasecmp.start.annobin_i_memcasecmp.end.annobin_i_strcmp_p.start.annobin_i_strcmp_p.end.annobin_i_strcasecmp_p.start.annobin_i_strcasecmp_p.end.annobin_mem_equals_timing_safe.start.annobin_mem_equals_timing_safe.end.annobin_str_equals_timing_almost_safe.start.annobin_str_equals_timing_almost_safe.end.annobin_str_match.start.annobin_str_match.end.annobin_i_memspn.start.annobin_i_memspn.end__func__.5847.annobin_i_memcspn.start.annobin_i_memcspn.end__func__.5861.annobin_t_strsplit.start.annobin_t_strsplit.end.annobin_t_strsplit_spaces.start.annobin_t_strsplit_spaces.end.annobin_p_strsplit.start.annobin_p_strsplit.end.annobin_p_strsplit_spaces.start.annobin_p_strsplit_spaces.end.annobin_p_strsplit_free.start.annobin_p_strsplit_free.end.annobin_str_array_length.start.annobin_str_array_length.end.annobin_t_strarray_join.start.annobin_t_strarray_join.end.annobin_str_array_remove.start.annobin_str_array_remove.end.annobin_str_array_find.start.annobin_str_array_find.end.annobin_str_array_icase_find.start.annobin_str_array_icase_find.end.annobin_p_strarray_dup.start.annobin_p_strarray_dup.endp_strarray_dup.cold.23__func__.5998.annobin_dec2str_buf.start.annobin_dec2str_buf.enddec2str_buf.cold.24__func__.6009.annobin_dec2str.start.annobin_dec2str.end.annobin_p_array_const_string_join.start.annobin_p_array_const_string_join.endp_array_const_string_join.cold.25__func__.4777.annobin_strnum.c.annobin_strnum.c_end.annobin_strnum.c.hot.annobin_strnum.c_end.hot.annobin_strnum.c.unlikely.annobin_strnum.c_end.unlikely.annobin_strnum.c.startup.annobin_strnum.c_end.startup.annobin_strnum.c.exit.annobin_strnum.c_end.exit.annobin_str_is_numeric.start.annobin_str_is_numeric.end.annobin_str_is_float.start.annobin_str_is_float.end.annobin_str_parse_uintmax.start.annobin_str_parse_uintmax.end.annobin_str_parse_uint.start.annobin_str_parse_uint.endstr_parse_uint.localalias.6.annobin_str_parse_uint32.start.annobin_str_parse_uint32.end.annobin_str_parse_ulong.start.annobin_str_parse_ulong.endstr_parse_ulong.localalias.12.annobin_str_parse_uint64.start.annobin_str_parse_uint64.end.annobin_str_parse_ullong.start.annobin_str_parse_ullong.end.annobin_str_to_uintmax.start.annobin_str_to_uintmax.end.annobin_str_to_uint.start.annobin_str_to_uint.endstr_to_uint.localalias.3.annobin_str_to_uint32.start.annobin_str_to_uint32.end.annobin_str_to_ulong.start.annobin_str_to_ulong.endstr_to_ulong.localalias.9.annobin_str_to_uint64.start.annobin_str_to_uint64.end.annobin_str_to_ullong.start.annobin_str_to_ullong.end.annobin_str_uint_equals.start.annobin_str_uint_equals.end.annobin_str_parse_uintmax_hex.start.annobin_str_parse_uintmax_hex.end.annobin_str_parse_uint_hex.start.annobin_str_parse_uint_hex.endstr_parse_uint_hex.localalias.7.annobin_str_parse_uint32_hex.start.annobin_str_parse_uint32_hex.end.annobin_str_parse_ulong_hex.start.annobin_str_parse_ulong_hex.endstr_parse_ulong_hex.localalias.13.annobin_str_parse_uint64_hex.start.annobin_str_parse_uint64_hex.end.annobin_str_parse_ullong_hex.start.annobin_str_parse_ullong_hex.end.annobin_str_to_uintmax_hex.start.annobin_str_to_uintmax_hex.end.annobin_str_to_uint_hex.start.annobin_str_to_uint_hex.endstr_to_uint_hex.localalias.4.annobin_str_to_uint32_hex.start.annobin_str_to_uint32_hex.end.annobin_str_to_ulong_hex.start.annobin_str_to_ulong_hex.endstr_to_ulong_hex.localalias.10.annobin_str_to_uint64_hex.start.annobin_str_to_uint64_hex.end.annobin_str_to_ullong_hex.start.annobin_str_to_ullong_hex.end.annobin_str_parse_uintmax_oct.start.annobin_str_parse_uintmax_oct.end.annobin_str_parse_uint_oct.start.annobin_str_parse_uint_oct.endstr_parse_uint_oct.localalias.8.annobin_str_parse_uint32_oct.start.annobin_str_parse_uint32_oct.end.annobin_str_parse_ulong_oct.start.annobin_str_parse_ulong_oct.endstr_parse_ulong_oct.localalias.14.annobin_str_parse_uint64_oct.start.annobin_str_parse_uint64_oct.end.annobin_str_parse_ullong_oct.start.annobin_str_parse_ullong_oct.end.annobin_str_to_uintmax_oct.start.annobin_str_to_uintmax_oct.end.annobin_str_to_uint_oct.start.annobin_str_to_uint_oct.endstr_to_uint_oct.localalias.5.annobin_str_to_uint32_oct.start.annobin_str_to_uint32_oct.end.annobin_str_to_ulong_oct.start.annobin_str_to_ulong_oct.endstr_to_ulong_oct.localalias.11.annobin_str_to_uint64_oct.start.annobin_str_to_uint64_oct.end.annobin_str_to_ullong_oct.start.annobin_str_to_ullong_oct.end.annobin_str_parse_intmax.start.annobin_str_parse_intmax.end.annobin_str_parse_int.start.annobin_str_parse_int.endstr_parse_int.localalias.16.annobin_str_parse_int32.start.annobin_str_parse_int32.end.annobin_str_parse_long.start.annobin_str_parse_long.endstr_parse_long.localalias.18.annobin_str_parse_int64.start.annobin_str_parse_int64.end.annobin_str_parse_llong.start.annobin_str_parse_llong.end.annobin_str_to_intmax.start.annobin_str_to_intmax.end.annobin_str_to_int.start.annobin_str_to_int.endstr_to_int.localalias.15.annobin_str_to_int32.start.annobin_str_to_int32.end.annobin_str_to_long.start.annobin_str_to_long.endstr_to_long.localalias.17.annobin_str_to_int64.start.annobin_str_to_int64.end.annobin_str_to_llong.start.annobin_str_to_llong.end.annobin_str_to_uid.start.annobin_str_to_uid.endstr_to_uid.localalias.19.annobin_str_to_gid.start.annobin_str_to_gid.end.annobin_str_to_pid.start.annobin_str_to_pid.end.annobin_str_to_ino.start.annobin_str_to_ino.end.annobin_str_to_uoff.start.annobin_str_to_uoff.end.annobin_str_to_time.start.annobin_str_to_time.end.annobin_str_parse_uoff.start.annobin_str_parse_uoff.end.annobin_str_num_error.start.annobin_str_num_error.end.annobin_time_util.c.annobin_time_util.c_end.annobin_time_util.c.hot.annobin_time_util.c_end.hot.annobin_time_util.c.unlikely.annobin_time_util.c_end.unlikely.annobin_time_util.c.startup.annobin_time_util.c_end.startup.annobin_time_util.c.exit.annobin_time_util.c_end.exit.annobin_strftime_real.start.annobin_strftime_real.endstrftime_realstrftime_real.cold.1__func__.4721.annobin_i_gettimeofday.start.annobin_i_gettimeofday.endi_gettimeofday.cold.2.annobin_i_nanoseconds.start.annobin_i_nanoseconds.endi_nanoseconds.cold.3.annobin_timeval_cmp.start.annobin_timeval_cmp.end.annobin_timeval_cmp_margin.start.annobin_timeval_cmp_margin.endtimeval_cmp_margin.cold.4__func__.4695.annobin_timeval_diff_usecs.start.annobin_timeval_diff_usecs.end.annobin_timeval_diff_msecs.start.annobin_timeval_diff_msecs.end.annobin_time_to_local_day_start.start.annobin_time_to_local_day_start.endtime_to_local_day_start.cold.5__func__.4713.annobin_t_strftime.start.annobin_t_strftime.end.annobin_t_strflocaltime.start.annobin_t_strflocaltime.end.annobin_t_strfgmtime.start.annobin_t_strfgmtime.end.annobin_str_to_timeval.start.annobin_str_to_timeval.endstr_to_timeval.cold.6.annobin_unix_socket_create.c.annobin_unix_socket_create.c_end.annobin_unix_socket_create.c.hot.annobin_unix_socket_create.c_end.hot.annobin_unix_socket_create.c.unlikely.annobin_unix_socket_create.c_end.unlikely.annobin_unix_socket_create.c.startup.annobin_unix_socket_create.c_end.startup.annobin_unix_socket_create.c.exit.annobin_unix_socket_create.c_end.exit.annobin_unix_socket_create.start.annobin_unix_socket_create.end__func__.6347unix_socket_create.cold.0.annobin_unlink_directory.c.annobin_unlink_directory.c_end.annobin_unlink_directory.c.hot.annobin_unlink_directory.c_end.hot.annobin_unlink_directory.c.unlikely.annobin_unlink_directory.c_end.unlikely.annobin_unlink_directory.c.startup.annobin_unlink_directory.c_end.startup.annobin_unlink_directory.c.exit.annobin_unlink_directory.c_end.exit.annobin_unlink_directory_error.start.annobin_unlink_directory_error.endunlink_directory_errorunlink_directory_error.cold.0.annobin_unlink_directory_r.start.annobin_unlink_directory_r.endunlink_directory_r.annobin_unlink_directory.start.annobin_unlink_directory.endunlink_directory.cold.1.annobin_unlink_old_files.c.annobin_unlink_old_files.c_end.annobin_unlink_old_files.c.hot.annobin_unlink_old_files.c_end.hot.annobin_unlink_old_files.c.unlikely.annobin_unlink_old_files.c_end.unlikely.annobin_unlink_old_files.c.startup.annobin_unlink_old_files.c_end.startup.annobin_unlink_old_files.c.exit.annobin_unlink_old_files.c_end.exit.annobin_unlink_old_files.start.annobin_unlink_old_files.endunlink_old_files.cold.1.annobin_unichar.c.annobin_unichar.c_end.annobin_unichar.c.hot.annobin_unichar.c_end.hot.annobin_unichar.c.unlikely.annobin_unichar.c_end.unlikely.annobin_unichar.c.startup.annobin_unichar.c_end.startup.annobin_unichar.c.exit.annobin_unichar.c_end.exit.annobin_output_add_replacement_char.start.annobin_output_add_replacement_char.endoutput_add_replacement_char.annobin_uint16_find.part.0.start.annobin_uint16_find.part.0.enduint16_find.part.0.annobin_uint32_find.start.annobin_uint32_find.enduint32_find.annobin_uni_strlen.start.annobin_uni_strlen.end.annobin_uni_utf8_get_char_n.start.annobin_uni_utf8_get_char_n.endlowest_valid_chr_table.4893uni_utf8_get_char_n.cold.4.annobin_uni_utf8_get_char.start.annobin_uni_utf8_get_char.end.annobin_uni_utf8_find_invalid_pos.start.annobin_uni_utf8_find_invalid_pos.enduni_utf8_find_invalid_pos.annobin_uni_utf8_to_ucs4.start.annobin_uni_utf8_to_ucs4.end.annobin_uni_utf8_to_ucs4_n.start.annobin_uni_utf8_to_ucs4_n.end.annobin_uni_ucs4_to_utf8_c.start.annobin_uni_ucs4_to_utf8_c.end__func__.4944.annobin_uni_ucs4_to_utf8.start.annobin_uni_ucs4_to_utf8.end.annobin_uni_utf8_partial_strlen_n.start.annobin_uni_utf8_partial_strlen_n.end.annobin_uni_utf8_strlen_n.start.annobin_uni_utf8_strlen_n.end.annobin_uni_utf8_strlen.start.annobin_uni_utf8_strlen.end.annobin_uni_ucs4_to_titlecase.start.annobin_uni_ucs4_to_titlecase.endtitlecase16_keystitlecase32_keystitlecase32_valuestitlecase8_maptitlecase16_values.annobin_uni_utf8_to_decomposed_titlecase.start.annobin_uni_utf8_to_decomposed_titlecase.enduni8_decomp_mapuni16_decomp_keysmultidecomp_keysmultidecomp_offsetsmultidecomp_valuesuni32_decomp_keysuni32_decomp_valuesuni16_decomp_values.annobin_uni_utf8_get_valid_data.start.annobin_uni_utf8_get_valid_data.end.annobin_uni_utf8_str_is_valid.start.annobin_uni_utf8_str_is_valid.end.annobin_uni_utf8_data_is_valid.start.annobin_uni_utf8_data_is_valid.end.annobin_uni_utf8_data_truncate.start.annobin_uni_utf8_data_truncate.end.annobin_uri_util.c.annobin_uri_util.c_end.annobin_uri_util.c.hot.annobin_uri_util.c_end.hot.annobin_uri_util.c.unlikely.annobin_uri_util.c_end.unlikely.annobin_uri_util.c.startup.annobin_uri_util.c_end.startup.annobin_uri_util.c.exit.annobin_uri_util.c_end.exit.annobin_uri_parse_dec_octet.isra.4.start.annobin_uri_parse_dec_octet.isra.4.enduri_parse_dec_octet.isra.4.annobin_uri_parse_pct_encoded_data.start.annobin_uri_parse_pct_encoded_data.enduri_parse_pct_encoded_data.annobin_uri_parse_pct_encoded.start.annobin_uri_parse_pct_encoded.end.annobin_uri_do_parse_reg_name.start.annobin_uri_do_parse_reg_name.enduri_do_parse_reg_name_uri_char_lookup.annobin_uri_do_parse_host_name.start.annobin_uri_do_parse_host_name.enduri_do_parse_host_nameuri_do_parse_host_name.cold.10__func__.6117.annobin_uri_parse_unreserved.start.annobin_uri_parse_unreserved.end.annobin_uri_parse_unreserved_pct.start.annobin_uri_parse_unreserved_pct.end.annobin_uri_parse_scheme.start.annobin_uri_parse_scheme.end.annobin_uri_parse_path_segment.start.annobin_uri_parse_path_segment.end.annobin_uri_parse_path.start.annobin_uri_parse_path.enduri_parse_path.cold.11__func__.6221.annobin_uri_parse_query.start.annobin_uri_parse_query.end.annobin_uri_parse_fragment.start.annobin_uri_parse_fragment.end.annobin_uri_parser_init_data.start.annobin_uri_parser_init_data.end.annobin_uri_parser_init.start.annobin_uri_parser_init.end.annobin_uri_cut_scheme.start.annobin_uri_cut_scheme.end.annobin_uri_parser_get_tmpbuf.start.annobin_uri_parser_get_tmpbuf.end.annobin_uri_data_decode.start.annobin_uri_data_decode.end.annobin_uri_parse_reg_name.start.annobin_uri_parse_reg_name.end.annobin_uri_parse_host_name.start.annobin_uri_parse_host_name.end.annobin_uri_do_parse_host.start.annobin_uri_do_parse_host.enduri_do_parse_host.annobin_uri_parse_host.start.annobin_uri_parse_host.end.annobin_uri_do_parse_authority.start.annobin_uri_do_parse_authority.enduri_do_parse_authority.annobin_uri_parse_authority.start.annobin_uri_parse_authority.end.annobin_uri_do_parse_slashslash_authority.start.annobin_uri_do_parse_slashslash_authority.enduri_do_parse_slashslash_authority.annobin_uri_parse_slashslash_authority.start.annobin_uri_parse_slashslash_authority.end.annobin_uri_parse_slashslash_host_authority.start.annobin_uri_parse_slashslash_host_authority.end.annobin_uri_parse_host_authority.start.annobin_uri_parse_host_authority.end.annobin_uri_parse_absolute_generic.start.annobin_uri_parse_absolute_generic.enduri_parse_absolute_generic.cold.12__func__.6266.annobin_uri_host_copy.start.annobin_uri_host_copy.enduri_host_copy.cold.13__func__.6273.annobin_uri_check_data.start.annobin_uri_check_data.end.annobin_uri_check.start.annobin_uri_check.end.annobin_uri_data_encode.start.annobin_uri_data_encode.end.annobin_uri_append_scheme.start.annobin_uri_append_scheme.end.annobin_uri_append_user_data.start.annobin_uri_append_user_data.end.annobin_uri_append_userinfo.start.annobin_uri_append_userinfo.end.annobin_uri_append_host_name.start.annobin_uri_append_host_name.end.annobin_uri_append_host_ip.start.annobin_uri_append_host_ip.enduri_append_host_ip.cold.14.annobin_uri_append_host.start.annobin_uri_append_host.end.annobin_uri_append_port.start.annobin_uri_append_port.end.annobin_uri_append_path_segment_data.start.annobin_uri_append_path_segment_data.end.annobin_uri_append_path_data.start.annobin_uri_append_path_data.end.annobin_uri_append_path_segment.start.annobin_uri_append_path_segment.enduri_append_path_segment.localalias.8.annobin_uri_append_path.start.annobin_uri_append_path.end.annobin_uri_append_query_data.start.annobin_uri_append_query_data.enduri_append_query_data.localalias.9.annobin_uri_append_query.start.annobin_uri_append_query.end.annobin_uri_append_fragment_data.start.annobin_uri_append_fragment_data.end.annobin_uri_append_fragment.start.annobin_uri_append_fragment.end.annobin_uri_append_unreserved.start.annobin_uri_append_unreserved.end.annobin_uri_append_unreserved_path.start.annobin_uri_append_unreserved_path.end.annobin_utc_offset.c.annobin_utc_offset.c_end.annobin_utc_offset.c.hot.annobin_utc_offset.c_end.hot.annobin_utc_offset.c.unlikely.annobin_utc_offset.c_end.unlikely.annobin_utc_offset.c.startup.annobin_utc_offset.c_end.startup.annobin_utc_offset.c.exit.annobin_utc_offset.c_end.exit.annobin_utc_offset.start.annobin_utc_offset.end.annobin_utc_mktime.c.annobin_utc_mktime.c_end.annobin_utc_mktime.c.hot.annobin_utc_mktime.c_end.hot.annobin_utc_mktime.c.unlikely.annobin_utc_mktime.c_end.unlikely.annobin_utc_mktime.c.startup.annobin_utc_mktime.c_end.startup.annobin_utc_mktime.c.exit.annobin_utc_mktime.c_end.exit.annobin_utc_mktime.start.annobin_utc_mktime.end.annobin_var_expand.c.annobin_var_expand.c_end.annobin_var_expand.c.hot.annobin_var_expand.c_end.hot.annobin_var_expand.c.unlikely.annobin_var_expand.c_end.unlikely.annobin_var_expand.c.startup.annobin_var_expand.c_end.startup.annobin_var_expand.c.exit.annobin_var_expand.c_end.exit.annobin_var_get_key_range_full.start.annobin_var_get_key_range_full.endvar_get_key_range_fullmodifiers.annobin_m_str_trim.start.annobin_m_str_trim.endm_str_trim.annobin_m_str_md5.start.annobin_m_str_md5.endm_str_md5.annobin_m_str_newhash.start.annobin_m_str_newhash.endm_str_newhash.annobin_m_str_hash.start.annobin_m_str_hash.endm_str_hash.annobin_m_str_reverse.start.annobin_m_str_reverse.endm_str_reverse.annobin_m_str_hex.start.annobin_m_str_hex.endm_str_hex.annobin_m_str_escape.start.annobin_m_str_escape.endm_str_escape.annobin_m_str_ucase.start.annobin_m_str_ucase.endm_str_ucase.annobin_m_str_lcase.start.annobin_m_str_lcase.endm_str_lcase.annobin_m_str_ldap_dn.start.annobin_m_str_ldap_dn.endm_str_ldap_dn.annobin_var_expand_long.start.annobin_var_expand_long.endvar_expand_extensions.annobin_var_expand_with_funcs.start.annobin_var_expand_with_funcs.endvar_expand_with_funcs.cold.9__func__.6636.annobin_var_expand_hash.start.annobin_var_expand_hash.endvar_expand_hash.annobin_var_expand.start.annobin_var_expand.end.annobin_var_get_key.start.annobin_var_get_key.end.annobin_var_get_key_range.start.annobin_var_get_key_range.end.annobin_var_has_key.start.annobin_var_has_key.endvar_has_key.cold.10__func__.6697.annobin_var_expand_extensions_deinit.start.annobin_var_expand_extensions_deinit.end.annobin_var_expand_extensions_init.start.annobin_var_expand_extensions_init.end.annobin_var_expand_register_func_array.start.annobin_var_expand_register_func_array.endvar_expand_register_func_array.cold.11__func__.6723.annobin_var_expand_unregister_func_array.start.annobin_var_expand_unregister_func_array.endvar_expand_unregister_func_array.cold.12__func__.6731.annobin_var_expand_merge_tables.start.annobin_var_expand_merge_tables.end.annobin_var_expand_if.c.annobin_var_expand_if.c_end.annobin_var_expand_if.c.hot.annobin_var_expand_if.c_end.hot.annobin_var_expand_if.c.unlikely.annobin_var_expand_if.c_end.unlikely.annobin_var_expand_if.c.startup.annobin_var_expand_if.c_end.startup.annobin_var_expand_if.c.exit.annobin_var_expand_if.c_end.exit.annobin_var_expand_if.start.annobin_var_expand_if.endvar_expand_if.cold.7__func__.5026__func__.5095.annobin_wildcard_match.c.annobin_wildcard_match.c_end.annobin_wildcard_match.c.hot.annobin_wildcard_match.c_end.hot.annobin_wildcard_match.c.unlikely.annobin_wildcard_match.c_end.unlikely.annobin_wildcard_match.c.startup.annobin_wildcard_match.c_end.startup.annobin_wildcard_match.c.exit.annobin_wildcard_match.c_end.exit.annobin_wildcard_match_int.start.annobin_wildcard_match_int.endwildcard_match_int.annobin_wildcard_match.start.annobin_wildcard_match.end.annobin_wildcard_match_icase.start.annobin_wildcard_match_icase.end.annobin_write_full.c.annobin_write_full.c_end.annobin_write_full.c.hot.annobin_write_full.c_end.hot.annobin_write_full.c.unlikely.annobin_write_full.c_end.unlikely.annobin_write_full.c.startup.annobin_write_full.c_end.startup.annobin_write_full.c.exit.annobin_write_full.c_end.exit.annobin_write_full.start.annobin_write_full.end.annobin_pwrite_full.start.annobin_pwrite_full.end.annobin_atexit.c.annobin_atexit.c_end.annobin_atexit.c.hot.annobin_atexit.c_end.hot.annobin_atexit.c.unlikely.annobin_atexit.c_end.unlikely.annobin_atexit.c.startup.annobin_atexit.c_end.startup.annobin_atexit.c.exit.annobin_atexit.c_end.exit.annobin_atexit.start.annobin_atexit.endderegister_tm_clones__do_global_dtors_auxcompleted.7303__do_global_dtors_aux_fini_array_entryframe_dummy__frame_dummy_init_array_entry__FRAME_END___fini__dso_handle_DYNAMIC__GNU_EH_FRAME_HDR__TMC_END___GLOBAL_OFFSET_TABLE_message_get_body_sizejson_tree_rooti_stream_set_blockingevent_pop_globalstr_parse_ulong_hexsmtp_server_reply_ehlo_add_paramsarray_cmp_icharset_iconvi_syslog_error_handlerevent_set_log_message_callbackbase32hex_is_valid_charfile_lock_wait_get_total_usecs_http_token_char_masksmtp_server_command_input_lockfd_debug_verify_leaksbacktrace_gettiming_safety_unoptimizationhttp_server_initnfs_flush_attr_cache_fd_lockedfs_get_eventp_strdup_vprintf__ctype_toupper_loc@@GLIBC_2.3smtp_client_connection_get_stateimap_parse_datetimei_stream_encrypt_get_formati_stream_snapshot_freeiostream_proxy_stoparray_idx_modifiable_iiostream_proxy_get_istreamhttp_server_response_request_destroydata_stack_free_unusedstr_unescape_nextmessage_part_has_content_typeshttp_client_peer_shared_switch_ioloopi_stream_try_allocprogram_client_unix_createhttp_client_connection_start_request_timeoutsmtp_server_state_namesi_stream_free_buffert_binary_abspathe_loglib_signals_set_handlerfile_lock_set_close_on_freehttp_server_ostream_get_sizemaster_service_settings_cache_deinitevent_filter_category_from_log_typefs_class_dictnet_set_nonblockinet_ntop@@GLIBC_2.2.5var_get_key_rangesmtp_server_connection_add_extra_capabilitygetenv@@GLIBC_2.2.5numpack_decode32smtp_address_cmpio_loop_handle_addevent_filter_remove_queries_with_contextssl_iostream_has_valid_client_certsmtp_submit_session_deinitsmtp_server_cmd_bdatsmtp_client_transaction_add_rcpthash_table_cleario_notify_fd_addhttp_client_request_url_strstr_sanitize_append_utf8stats_dist_get_mineperm_error_get_chgrpdsasl_client_mech_oauthbearerhttp_url_clone_authoritystats_importsmtp_server_recipient_get_replydcrypt_ctx_sym_get_block_sizei_stream_unrefsmtp_client_transaction_get_state_namehttp_request_parser_pending_payloadauth_client_connection_remove_requestfile_cache_invalidatemessage_skip_virtualdcrypt_ctx_sym_get_ivmountpoint_getglobfree@@GLIBC_2.2.5dcrypt_ctx_hmac_set_keyo_stream_ignore_last_errorsssl_iostream_context_init_clienturi_append_schemehttp_server_response_unrefmaster_service_haproxy_newt_noalloc_strdup_vprintfsmtp_server_command_unregistersmtp_server_reply_create_ehloprogram_client_get_output_seekableevent_get_last_send_timehttp_client_request_errori_stream_readutime@@GLIBC_2.2.5i_panicsettings_parse_set_keys_expandedconnection_input_line_defaultbuffer_create_from_const_datahttp_client_peer_trigger_request_handleri_get_failure_prefixevent_reft_strdup_noconstsigprocmask@@GLIBC_2.2.5smtp_server_reply_prepend_textimap_bodystructure_parseauth_client_connection_deinitraise@@GLIBC_2.2.5hash_methodssha256_resultdcrypt_keypair_unrefiostream_pump_stopio_loop_get_active_global_rooti_set_failure_exit_callbackmessage_parser_read_morehttp_server_request_buffer_payloado_stream_nsendvevent_filter_parser__scan_bytesfs_file_init_parentstr_sanitize_utf8auth_client_connection_add_requestprogram_client_destroyi_stream_create_binary_convertermessage_header_encode_bsettings_parser_apply_changesrecv@@GLIBC_2.2.5hash2_removesmtp_params_rcpt_parsemaster_service_config_socket_try_openmessage_address_first_to_stringcpu_limit_get_usage_msecsi_stream_get_errorcpu_limit_deinitstr_uint_equalsi_stream_read_eofdcrypt_key_store_publicseq_range_array_mergebuffer_get_poolstr_table_refmessage_snippet_generatejson_tree_find_keyi_stream_file_closefs_stats_get_write_usecsendmntent@@GLIBC_2.2.5stats_dist_get_maxarray_bsearch_insert_pos_issl_iostream_has_broken_client_certbase64_decode_finishuri_parse_pathevent_filter_parser_lexdsasl_clients_deinitsmtp_server_transaction_resetuchar_empty_ptrostream_escaped_json_formattime_to_local_day_startp_strconcatdcrypt_keypair_generatestrcasecmp@@GLIBC_2.2.5ssl_iostream_context_unrefuni_utf8_get_char_nhttp_header_field_findfile_lock_get_pathstr_to_int64i_get_failure_handlerst_realpath_tojson_tree_find_child_withio_loop_createmail_html2text_initi_stream_read_more_memareasmtp_params_mail_add_to_eventprocess_stat_read_finishsha3_512_initversion_string_verifyfs_wrapper_readhmac_md5_set_cram_contextdict_transaction_unsupportedhttp_auth_credentials_clonedcrypt_key_get_id_publicnet_disconnectstats_parser_addlocaltime@@GLIBC_2.2.5smtp_address_parse_anyipc_client_cmd_abortfs_iter_set_async_callbackmaster_service_unset_process_shutdown_filterstats_dist_get_avgi_debugsmtp_client_command_input_replyio_remove_closedhttp_client_peer_shared_max_connectionso_stream_switch_ioloophttp_server_response_submithttp_client_request_set_payloadsmtp_server_command_remove_hooksevent_set_namestr_find_moreevents_get_headevent_has_all_fieldsuri_append_portsmtp_client_connection_next_transactionabort@@GLIBC_2.2.5event_filter_deinitio_stream_unrefsmtp_server_recipient_remove_hookpool_alloconly_create_cleano_stream_create_encrypti_stream_create_sized_rangei_stream_set_name__errno_location@@GLIBC_2.2.5settings_get_sizefdatasync@@GLIBC_2.2.5io_loop_context_refdcrypt_key_ref_publici_stream_remove_destroy_callbackguid_128_hashevent_filter_parsemodule_get_plugin_nameunlink@@GLIBC_2.2.5event_want_log_levelsmtp_server_cmd_vrfy_reply_defaultdcrypt_ctx_sym_set_ivsmtp_client_command_locko_stream_create_dotevent_category_register_callbacksmtp_server_event_initsmtp_address_clonefs_copyhttp_response_inito_stream_createo_stream_unix_write_fdio_loop_time_refreshi_reallocimap_parser_read_command_namemodule_get_symbol_quietsmtp_parser_initfs_switch_ioloopsmtp_server_command_remove_hookmaster_instance_list_deinitsmtp_client_connection_handle_output_errorstrncmp@@GLIBC_2.2.5p_strdup_printfmemarea_initsafe_mkstemp_hostpidmaster_service_ssl_initmaster_service_client_connection_createdp_str_ltrim_ITM_deregisterTMCloneTablehttp_header_field_addsmtp_server_cmd_ehlostdout@@GLIBC_2.2.5auth_client_request_is_abortedssl_iostream_cert_match_namenet_ip_comparefd_readsmtp_client_connection_get_capabilitiesmy_hostdomainmaster_service_stop_new_connectionso_stream_temp_move_to_memorysmtp_server_commands_initmessage_address_writedec2str_bufio_loop_handler_runseq_range_array_remove_rangei_stream_read_next_linehash_table_createt_hmac_datat_popo_stream_get_buffer_used_sizefs_wrapper_get_propertiesdcrypt_ecdh_derive_secrethttp_client_request_start_tunnelstats_have_changedsmtp_client_connection_close_exit@@GLIBC_2.2.5rfc822_parse_atomi_stream_create_fdmaster_getopt_str_is_validi_stream_set_persistent_bufferssmtp_client_command_unreft_push_namedsmtp_server_transaction_add_rcptnfs_flush_read_cache_unlockedfile_lock_wait_endchroot@@GLIBC_2.2.5iso8601_date_create_tmpool_allocfree_createsmtp_client_transaction_create_emptysmtp_address_detail_parsehttp_server_response_createmountpoint_iter_initio_loop_get_wait_usecsi_stream_create_chainstr_find_inithttp_client_peer_shared_unrefqp_encoder_initevent_filter_merge_with_contexttimeout_add_absolutemaster_service_init_finishmaster_service_client_connection_callbacki_stream_set_return_partial_linemaster_service_client_connection_acceptdsasl_client_freeevent_filter_match_sourcehttp_message_parser_get_poolevent_filter_match_iter_nexttest_subprocess_forkhttp_server_request_get_responsedict_transaction_memory_rollbackhash_table_iterate_initi_set_failure_internalhttp_client_connection_switch_ioloopuni_ucs4_to_titlecasenet_listen_unix_unlink_stalemkdir@@GLIBC_2.2.5env_backup_saveoauth2_json_tree_buildpriorityq_addhttp_client_queue_freesendmsg@@GLIBC_2.2.5json_tree_deinitsmtp_server_reply_ehlo_add_starttlsmaster_service_settings_cache_initi_stream_create_multiplexsmtp_server_reply_create_indexwritev@@GLIBC_2.2.5i_stream_get_last_read_timeo_stream_get_last_write_timehttp_server_request_fail_bad_methodhttp_server_response_request_freeevent_filter_parser_errorhttp_server_response_set_datewildcard_matchhttp_client_peer_switch_ioloopiconv@@GLIBC_2.2.5program_client_run_asynchttp_url_clone_with_userinfosmtp_client_connection_connectfuzzer_deinitevent_set_global_debug_send_filterwrapper_ostream_createi_stream_create_fd_autocloseevent_category_unregister_callbacki_set_failure_ignore_errorshttp_client_host_freestats_diffuni_utf8_get_valid_dataevent_filter_parser_get_outnet_str2hostportdcrypt_ctx_hmac_createsettings_parse_linei_stream_skipi_stream_set_input_pendingtee_i_stream_create_childstr_table_deinitsmtp_server_recipient_destroyhttp_client_request_delay_from_responsei_my_pwriteiostream_proxy_set_completion_callbackhttp_client_host_submit_requesthttp_server_request_add_response_headermaster_service_init_stats_clientjson_parse_next_streamstr_parse_int64fs_wrapper_read_streamuni_ucs4_to_utf8event_exportsmtp_params_rcpt_drop_extrasmtp_server_transaction_freehttp_server_response_set_payloadhttp_client_request_lookup_headerin6addr_any@@GLIBC_2.2.5http_client_peer_is_connectedqsort@@GLIBC_2.2.5i_stream_set_max_buffer_sizecharset_utf8_to_utf8_beginio_loop_stop_delayedt_abspatht_get_working_dirmaster_instance_iterate_list_nexto_stream_pwritesmtp_server_reply_ehlo_add_binarymimep_strdup_emptyisatty@@GLIBC_2.2.5master_instance_list_find_by_namestr_to_ullongfs_read_via_streamhttp_server_connection_reset_idle_timeoutsettings_parser_checkfile_cache_readsigaction@@GLIBC_2.2.5http_client_connection_handle_output_errort_pop_pass_strmd4_finalpread_fullseqset_builder_addhttp_auth_basic_credentials_initsmtp_client_command_writestr_to_uint32_octuri_append_unreserved_pathvar_get_keyhttp_message_parser_restartevent_unregister_callbackfs_write_stream_abort_errorsmtp_params_copydict_driver_failmessage_parse_header_initi_stream_create_sized_with_callbackhmac_md5_get_cram_contextsmtp_client_transaction_mail_abortuni_utf8_to_ucs4_ntest_expect_fatal_stringdsasl_client_mech_unregisterdns_lookup_switch_ioloophttp_server_response_refrfc822_parse_content_paramstdin@@GLIBC_2.2.5stats_exportsmtp_server_connection_uncorksmtp_server_reply_add_texti_stream_create_base64_encodersetsockopt@@GLIBC_2.2.5smtp_client_command_printfrfc822_parse_mime_tokenhttp_server_response_submit_closeiostream_rawlog_create_from_streamhttp_client_context_unrefevent_set_forced_debugbase64_decode_moremessage_address_parse_pathbacktrace_symbols@@GLIBC_2.2.5ssl_iostream_get_pfsnumpack_decodestr_parse_uintmaxmy_madviseevent_get_globaltest_istream_create_dataevent_vsendmemarea_get_refcountmaster_service_set_has_config_overridehttp_auth_basic_challenge_initi_stream_create_qp_decoderprocess_title_get_countersmtp_command_parser_set_streamdsasl_client_newmaster_service_close_config_fdsettings_var_expandi_gettimeofdayhash_format_resetio_loop_remove_destroy_callbackmemarea_getdict_post_api_callbackmaster_login_deinithash_method_sha1i_stream_create_decryptdns_ncomparehttp_server_request_get_payload_inputauth_master_user_list_inithttp_client_queue_claim_requesthttp_response_parser_get_last_offseti_set_info_handlerchild_wait_new_with_pidstr_to_int32t_str_new_constdns_client_switch_ioloopstr_append_tabescaped_nsettings_parser_get_errorio_loop_context_switchstr_array_findstr_csmtp_server_command_registerhttp_server_response_send_payloaddcrypt_key_get_curve_publicdcrypt_ctx_sym_finaljson_tree_init_typereadlink@@GLIBC_2.2.5smtp_parser_parse_quoted_stringimap_parser_finish_linei_stream_create_metawrapfcntl@@GLIBC_2.2.5fs_stats_get_read_usecsmem_equals_timing_safeclock_gettime@@GLIBC_2.17smtp_client_deinitmaster_service_inithttp_client_connection_next_requesti_stream_chain_appendsmtp_submit_run_asynchttp_client_request_unrefuni_utf8_to_ucs4smtp_server_connection_get_protocolfd_close_maybe_stdioimap_arg_get_stringo_stream_set_flush_pendingstats_dist_get_samplesiostream_temp_create_namedarray_bsearch_infs_flush_attr_cache_maybe_lockeddcrypt_key_set_usage_publicaqueue_deletesha256_get_digestt_strsplit_tabescapedqp_decoder_initimap_keepalive_interval_msecsevent_unset_global_core_log_filternet_gethosterrorlib_signals_clear_handlers_and_ignoremy_pidi_stream_grow_buffergetpid@@GLIBC_2.2.5http_auth_create_challengetest_istream_set_allow_eofhttp_client_request_finishdict_unescape_stringhttp_client_request_get_origin_urlsmtp_client_commands_list_abortfd_set_nonblocko_stream_is_corkedanvil_client_deinitsettings_parse_set_key_expandedsmtp_server_command_submit_replysmtp_server_command_executeimap_id_log_reply_appendstrfastcase_hashi_stream_create_qp_encoderevent_filter_parser_set_columncrc32_data_morehttp_date_create_tmauth_client_find_mecho_stream_create_errorhex2decevent_get_global_debug_log_filteruri_append_pathhttp_server_request_forward_payloadhttp_response_has_connection_optionhttp_client_request_get_peer_addrevent_add_int_nonzerorestrict_accessmaster_service_get_namechild_wait_inithttp_server_request_handle_payloadio_loop_get_rooti_stream_create_rangesettings_parse_set_expandedio_stream_freedcrypt_key_store_private_rawhttp_response_get_payload_sizei_stream_get_absolute_offsetsettings_parser_dyn_update_edatasettings_read_iguid_128_host_hash_getssl_iostream_settings_init_fromipwd_deinitevent_filter_parser_lex_destroydata_stack_deinit_eventhttp_server_response_add_auth_basicfs_wrapper_iter_nexti_unreachedsmtp_param_parsebuffer_truncate_rshift_bitshttp_header_field_deleteimap_args_to_strsettings_parser_get_rootsi_stream_callback_set_errortest_subprocess_notify_signal_resetstr_parse_uint64imap_escaped_utf8_hex_to_charfs_file_initfs_set_errorhttp_server_request_immune_refuri_host_copyi_sleep_intr_msecso_stream_destroydns_compare_labelso_stream_multiplex_add_channelmail_user_hashhttp_client_peer_pool_closeevent_filter_category_to_log_typedict_iterate_valuesstr_parse_intgetpeername@@GLIBC_2.2.5json_parser_init_flagsi_sleep_intr_secsrestrict_access_deinitevent_filter_parser_freesmtp_server_reply_earlybuffer_verify_poolp_str_rtrimhttp_url_createo_stream_get_namehttp_client_request_set_payload_dataimap_parse_system_flagsettings_parse_stream_readsmtp_server_reply_submitnet_connect_unix_with_retriesi_set_failure_prefixsettings_section_escape__open_2@@GLIBC_2.7http_server_request_update_eventlib_signals_ioloop_detachsettings_parse_filehttp_client_request_delay_msecssmtp_command_parse_nextbuffer_cmpevent_send_abortsmtp_client_initsmtp_client_connection_refiostream_rawlog_closemessage_part_has_parameterdns_lookup_abortfs_write_stream_finish_asyncsmtp_command_parse_auth_responseimap_seq_set_parsesmtp_client_connection_disconnectdcrypt_key_store_public_rawio_stream_closeio_wait_timer_removeevent_set_log_prefix_callbackipc_client_initiostream_pump_is_waiting_outputnet_get_hosterror_typesmtp_reply_write_one_linenet_connect_ip_blockingsmtp_server_reply_freeo_stream_cmp_equalslib_atexit_priorityevent_reason_endsmtp_server_reply_forwardhttp_client_request_set_auth_simplei_stream_create_lfsmtp_server_connection_is_ssl_securedhttp_client_request_send_morei_snprintfhttp_client_connection_is_idlesmtp_server_cmd_rset_reply_successio_loop_have_iossmtp_server_connection_input_resumesmtp_server_cmd_starttlsoptind@@GLIBC_2.2.5qp_encoder_moresmtp_reply_initt_malloc0opendir@@GLIBC_2.2.5io_loop_is_runningimap_parser_client_read_tagio_loop_stophttp_client_connection_check_readyt_imap_utf8_to_utf7fs_unlockio_loop_get_current_contextmd5_finali_stream_copy_fdnet_connect_ipsmtp_client_command_name_equalsauth_client_initimap_bodystructure_parse_fulluri_append_fragment_dataclearenv@@GLIBC_2.2.5event_filter_parser_restartshutdown@@GLIBC_2.2.5str_to_intevent_filter_parser_push_buffer_statesmtp_client_transaction_fail_replyseqset_builder_try_addsmtp_client_command_submitsmtp_command_parser_deinitmessage_header_decodenet_connect_udpnet_is_in_networknull_header_filter_callbackpool_alloconly_createtest_subprocess_notify_signal_waitsmtp_client_transaction_createhttp_client_connection_claim_idlepriorityq_deinituni_utf8_strlen_nstats_parser_valuet_str_onelineio_stream_remove_destroy_callbackmd5_get_digesthash_format_loopsmtp_server_cmd_mailtest_ostream_set_max_output_sizesmtp_server_recipient_approvedsmtp_command_parser_pending_dataauth_client_connection_connectnet_getsocknameistream_attachment_connector_addstr_vprintfaio_stream_set_max_buffer_sizefs_get_parentwrapper_ostream_notify_erroro_stream_send_strhttp_client_request_send_payloadexecvp_constconnection_handshake_args_defaultimap_envelope_parsebinary_to_hex_appendrmdir@@GLIBC_2.2.5smtp_server_connection_get_transaction_idsmtp_submit_deinitsmtp_server_recipient_createmaster_service_settings_detachi_stream_create_unixmaster_service_is_master_stoppedmaster_service_deinitio_loop_handler_deinitiostream_temp_create_sizedregfree@@GLIBC_2.2.5utc_mktimeguid_128_generatearray_reverse_io_stream_nsendssl_iostream_destroytest_beginuni_ucs4_to_utf8_chome_try_expandi_stream_nonseekable_try_seeknet_ip4_anyenv_backup_freeimap_arg_get_quotedhttp_request_parser_inithash_format_writestrlen@@GLIBC_2.2.5file_unlocki_log_typeprogram_client_set_labelbuffer_get_sizetest_assert_failed_strcmp_idxdict_driver_redissmtp_dcontent_char_maskanvil_client_is_connectedstr_to_ullong_octssl_iostream_check_cert_validitysmtp_client_connection_unrefi_stream_callback_get_bufferjson_parse_skip_nexti_stream_seek_markuri_parser_initsmtp_client_command_set_flagshttp_url_clonebacktrace@@GLIBC_2.2.5timeval_cmp_marginsmtp_client_command_rset_submitevent_filter_parser_lex_init_extraipc_client_cmdhttp_client_request_retrystr_parse_int32str_to_ulong_hexstats_client_initsmtp_client_transaction_rcpt_set_data_callbacksmtp_client_transaction_connection_result__lxstat@@GLIBC_2.2.5http_client_peer_claim_requestdcrypt_ctx_sym_updatefile_lock_method_to_strgetpwuid_r@@GLIBC_2.2.5smtp_server_command_pipeline_blockdcrypt_key_load_public_rawsmtp_client_transaction_state_namesi_getgrgidhttp_client_peer_link_queuetimeout_add_absolute_tohttp_client_request_set_proxy_socketnfs_flush_read_cache_lockedstats_dist_get_varianceio_wait_timer_move__stack_chk_fail@@GLIBC_2.4json_parse_skipsmtp_parser_parse_domainsmtp_reply_parse_nextmemarea_unrefhttp_server_response_set_payload_dataimap_parser_read_worduri_check_datamemarea_get_sizehttp_client_init_sharedpriorityq_counthttp_url_escape_pathi_memcspnstr_free_without_dataio_loop_move_io_todsasl_client_get_resultssl_iostream_test_settings_servergetuid@@GLIBC_2.2.5cpu_limit_initmaster_service_ssl_server_settings_to_iostream_setevent_filter_initsetresgid@@GLIBC_2.2.5mmap@@GLIBC_2.2.5sha3_loopsha3_512_resultoauth2_validation_key_cache_evictt_try_reallochttp_client_request_callbackfile_cache_writehook_build_updatedcrypt_ctx_sym_set_keyevent_want_levelevent_filter_matchi_fatalo_stream_send_istreamo_stream_get_buffer_avail_sizeuri_parse_slashslash_authorityt_str_replacesmtp_client_transaction_set_immediateiostream_rawlog_create_prefixcpu_limit_exceededhttp_url_create_hostnet_ipv6_mapped_ipv4_convertsmtp_capability_namessmtp_server_command_set_reply_countsmtp_client_connection_list_inithttp_client_context_switch_ioloopio_loop_run_get_wait_timebase64_encode_get_sizesmtp_params_rcpt_copyssl_iostream_has_handshake_failedio_loop_add_destroy_callbackvar_expand_register_func_arrayio_set_pendinghttp_server_request_get_authprocess_title_seti_stream_read_limitedmodule_dir_unloaddup2@@GLIBC_2.2.5str_parse_uint_hexsmtp_address_encode_raw_pathdict_driver_registersmtp_server_connection_pending_command_dataconnection_init_client_ip_fromsmtp_ehlo_greet_char_maskaqueue_delete_tailio_stream_refi_stream_chain_append_eofsmtp_client_command_abortio_loop_handle_timeoutssmtp_server_recipient_replydcrypt_key_set_id_privateauth_client_connectoauth2_try_parse_jwti_stream_unix_get_read_fdstrchr@@GLIBC_2.2.5http_header_parser_resetsmtp_params_rcpt_add_extrassl_iostream_test_settings_clientconnection_init_client_fdhttp_server_ostream_get_outputmodule_dir_load_missingmessage_parser_init_from_partsimap_parser_read_last_literalp_strsplit_freehash_format_initaqueue_cleari_strcasecmp_pdns_client_initio_loop_context_unrefhttp_client_connection_lost_peerio_loop_find_fd_conditionsiostream_pump_createsmtp_address_clone_temptest_subprocess_notify_signal_sendevent_filter_parser__scan_bufferhash_method_md4i_set_failure_sysloghttp_message_parse_bodyimap_to_datedcrypt_key_id_private_olddcrypt_key_id_public_oldmbox_from_parseo_stream_create_failure_at_flushmaster_instance_list_removemaster_service_init_log_with_pidhttp_server_connection_stop_idle_timeouttest_subprocess_kill_allsmtp_server_connection_get_proxy_dataio_stream_switch_ioloop_touri_append_path_dataio_loop_set_currentpool_datastack_createt_strdup_emptygetgrgid@@GLIBC_2.2.5fs_prefetchevent_importi_stream_attachment_extractor_can_retrysmtp_server_reply_set_statushttp_client_request_try_retryevent_dupsmtp_server_command_pipeline_unblocksmtp_client_transaction_get_state_destriptionoauth2_validation_key_cache_initjson_append_escapedconnection_set_handlersstr_to_uoffstr_num_errorimap_match_globs_equalhttp_client_connection_closedsasl_client_mech_registersmtp_server_reply_ehlo_add_dsniostream_rawlog_initsha1_initmail_html2text_morei_failure_handler_is_internalsmtp_server_transaction_receivedevent_has_all_categoriessmtp_command_parse_data_with_dotsettings_parser_info_updateimap_utf7_to_utf8_escapedhttp_client_inituri_append_userinfomountpoint_iter_nexto_stream_set_no_error_handlingnet_set_tcp_quickacknet_set_recv_buffer_sizesmtp_server_connection_input_lockis_ipv6_addressstr_to_ulongdcrypt_verifywildcard_match_icasestatic_system_pooldovecot_build_infonanosleep@@GLIBC_2.2.5http_client_request_set_dategai_strerror@@GLIBC_2.2.5strrchr@@GLIBC_2.2.5dcrypt_ctx_hmac_final_http_ctext_char_maskstr_array_removeimap_envelope_writesmtp_client_connection_accept_extra_capabilityiostream_pump_destroyuri_data_decodeftruncate@@GLIBC_2.2.5uname@@GLIBC_2.2.5nfs_safe_statsmtp_atext_char_maskdcrypt_ctx_sym_initmaster_service_ssl_settings_get_from_parsersmtp_server_reply_ehlo_add_xcliente_warningt_buffer_allocdup@@GLIBC_2.2.5lseek@@GLIBC_2.2.5dict_iterate_set_async_callbackstats_alloc_sizesmtp_server_cmd_rcptt_strduptest_assert_failedsmtp_server_command_get_replygettimeofday@@GLIBC_2.2.5sha3_256_resultevent_push_globalsmtp_xtext_char_maskbase32_decodemessage_search_more_get_decodedioloop_timevalsmtp_parser_parse_xtextevent_set_append_log_prefixhttp_server_connection_list_inithash2_remove_iteriostream_pump_get_inputvar_expand_extensions_deinitdict_transaction_memory_initfputs@@GLIBC_2.2.5lib_atexithttp_response_parser_initfile_wait_locksmtp_server_connection_resumeistream_attachment_connector_beginlib_signals_set_expectedhttp_server_connection_createi_stream_memarea_detachseq_range_countfs_wrapper_set_metadatafs_iter_nextdict_driver_memcached_asciihttp_client_request_submitauth_client_is_connectediostream_pump_switch_ioloop_todict_transaction_begindcrypt_key_get_usage_privatehttp_header_field_getfile_dotlock_createhttp_client_peer_shared_labelhttp_client_peer_pool_unrefmaster_auth_inithttp_message_parser_initmessage_search_resetsmtp_address_add_detail_tempsmtp_server_command_new_invalidsmtp_server_connection_get_security_stringio_loop_handler_run_internalevent_unset_forced_debugsmtp_address_detail_parse_temphash_method_sha512str_parse_uintmax_octexecv_constevent_set_min_log_level_http_char_lookupioloop_timesmtp_client_transaction_sendssl_iostream_get_server_nameevent_strlist_replacesmtp_server_connection_is_trustedguid_128_equalsdcrypt_ctx_sym_set_aadimap_arg_get_nstringnfs_safe_openhttp_request_parse_finish_payloadfailure_log_type_nameshttp_client_request_add_headerfs_locksmtp_server_recipient_refstats_connection_unrefimap_bodystructure_parse_argsimap_append_nstringhttp_client_request_connect_ipfs_get_propertiesfuzzer_io_as_fdguid_128_to_uuid_stringio_loop_is_emptymaster_service_settings_get_filtershttp_url_create_targettest_exitsmtp_server_command_reply_status_equalshttp_client_request_delaybuffer_set_used_sizesmtp_server_connection_unrefpool_allocfree_get_total_alloc_sizedcrypt_ctx_sym_get_keystats_dist_deinitmessage_binary_part_deserializeprocess_title_deinitbuffer_writememset@@GLIBC_2.2.5iostream_pump_set_completion_callbacknet_listen_fullio_loop_extract_notify_fduri_parse_absolute_genericbuffer_insertmessage_parse_header_set_limithash_table_iterate_deinitgeteuid@@GLIBC_2.2.5uri_append_host_namehostpid_deinitio_loop_notify_removeevent_reason_beginimap_parser_read_argsmaster_service_set_service_countauth_client_request_get_create_timefs_readconnection_init_client_unixchild_wait_add_pidmaster_service_set_idle_die_callbackdict_pre_api_callbacksmtp_server_cmd_data_check_sizei_stream_create_nonulsstats_dist_get_sumhttp_client_queue_host_lookup_donestr_to_timevalfile_lock_set_unlink_on_freeseq_range_array_have_commonimap_arg_get_literal_sizeguid_128_from_stringunlink_directorydcrypt_ctx_sym_createo_stream_finishnet_listen_unixsmtp_server_transaction_data_commandstr_is_floatevent_set_ptrfs_wrapper_existsmaster_login_stopi_syslog_fatal_handlergetcwd@@GLIBC_2.2.5i_stream_create_jsonstrio_notify_fd_freesettings_parser_getevent_filter_parser_reallocsmtp_server_connection_set_stateseq_range_array_addtest_run_named_with_fatalsjson_tree_appenddcrypt_signevent_filter_parser_get_linenohttp_client_get_global_contextimap_bodystructure_writenet_ipport2strstats_resetsmtp_server_connection_terminatesmtp_params_mail_get_extramessage_parse_header_has_nulssmtp_server_reply_createdcrypt_key_load_privatealarm@@GLIBC_2.2.5pwrite_fullhttp_server_request_unrefhttp_server_request_receivedstr_unescapesmtp_server_connection_send_lineevent_inc_inti_stream_create_error_strdata_stack_frame_containsfuzzer_initbuffer_free_without_datai_streams_mergerestrict_access_get_dumpableevent_filter_parser_get_columnsettings_parser_get_listrestrict_fd_limithttp_url_copy_with_userinfosetgroups@@GLIBC_2.2.5i_stream_add_destroy_callbackmaster_service_client_connection_handledsmtp_address_create_from_msgmd5_updatehttp_message_parse_finish_payloadmessage_search_more_decodedfile_dotlock_get_lock_pathsha256_initfs_class_posixi_stream_switch_ioloopstr_to_uintchild_wait_switch_ioloopqp_decoder_moremaster_service_ssl_server_setting_parser_infoi_randimap_utf7_is_validsmtp_client_connection_start_cmd_timeoutmessage_part_data_is_plain_7bithttp_header_createseq_range_array_intersectsafe_mkstemphttp_server_response_request_finishedstats_allocsmtp_server_connection_get_transactionfile_lock_method_parsesmtp_server_command_send_repliespipe@@GLIBC_2.2.5io_stream_set_verrorhttp_server_connection_get_statssmtp_reply_parser_initsmtp_client_connection_creategetnameinfo@@GLIBC_2.2.5fs_get_nlinksnet_ip6_loopbackis_ipv4_addresssmtp_client_connection_faili_stream_encrypt_get_flagshttp_server_request_fail_textclosedir@@GLIBC_2.2.5qp_decoder_finishmessage_parse_header_lower_limithttp_client_switch_ioloopi_stream_create_errorlib_event_initmessage_search_morehttp_auth_challenge_copyo_stream_create_nullsmtp_ehlo_params_str_is_validcrc32_dataposix_fadvise@@GLIBC_2.2.5auth_client_get_connect_idjson_append_escaped_ucs4printf_format_fixhttp_client_peer_shared_closesmtp_client_command_data_submit_aftersettings_parser_deinittest_forked_endfd_sendtest_assert_failed_ucmp_intmax_idxregcomp@@GLIBC_2.2.5fputc@@GLIBC_2.2.5smtp_client_transaction_get_stateepoll_ctl@@GLIBC_2.3.2dsasl_clients_initsmtp_server_cmd_xclientt_buffer_gethttp_client_request_get_attemptsio_add_tofs_file_init_with_eventi_close_fd_pathhttp_client_peer_connection_successi_stream_create_rawlogt_strsplit_spacesio_loop_destroysha512_loopstr_to_longfile_set_sizestrcspn@@GLIBC_2.2.5o_stream_set_namesmtp_reply_printfi_stream_create_header_filtermessage_id_get_nextipc_cmd_success_replyvar_expand_unregister_func_arrayhttp_server_resource_get_poolconnection_disconnect_reasonsmtp_client_command_rset_submit_afterevent_filter_parser_lex_initevent_filter_parser_set_linenombox_from_createsmtp_client_transaction_reset_http_qdtext_char_masksmtp_server_reply_ehlo_add_vrfyhash_table_freezeimap_id_args_get_log_replytimeval_diff_msecsmaster_service_get_socket_namerestrict_access_set_dumpablebsearch_insert_posistream_attachment_connector_abortimap_write_argsio_stream_create_ssl_serverjson_parser_initsafe_mkstemp_hostpid_groupnull_message_part_header_callbackevent_add_timevalfs_file_pathmalloc_usable_size@@GLIBC_2.2.5memchr@@GLIBC_2.2.5smtp_client_connection_state_namesmessage_parser_parse_next_blocknet_addr2ipsmtp_client_command_noop_submitdev_null_fdsmtp_server_connection_register_rcpt_paramdict_iter_unsupportedi_stream_get_root_iostr_parse_intmaxsmtp_client_commands_abort_delayedssl_iostream_client_context_cache_getsrand@@GLIBC_2.2.5ssl_iostream_is_handshakedevent_get_create_timememcmp@@GLIBC_2.2.5smtp_server_connection_haltmkdir_chgrpsmtp_parser_parse_stringseqset_builder_deinitsmtp_client_connection_create_ipfile_dotlock_deletefailure_log_type_prefixessmtp_client_command_rcpt_submitimap_parser_unrefi_memduphttp_client_connection_start_tunnelevent_field_clearanvil_client_inithttp_message_parser_deinithttp_client_connection_stop_request_timeoutdcrypt_ctx_hmac_get_keymaster_service_set_process_shutdown_filtersmtp_qtext_char_maskfs_get_root_driverfile_cache_newsmtp_params_rcpt_equalhttp_client_queue_host_lookup_failurefs_write_via_streameacces_error_getimap_get_base_subject_casedwrapper_ostream_trigger_flushuri_parser_get_tmpbufmessage_decoder_current_content_typeseq_range_array_add_rangehash_table_countfallocate@@GLIBC_2.10message_header_line_writedcrypt_key_ref_privatedict_transaction_memory_atomic_incsmtp_client_transaction_refgetsockopt@@GLIBC_2.2.5printf_format_fix_get_lenbase32_is_valid_chardefault_fatal_handlerrfc822_parse_domaini_infohttp_client_host_get_ip_idximap_escaped_utf8_to_utf7str_to_uintmax_octio_loop_context_activatehttp_server_response_request_abortstr_to_uint_hexi_strconcathttp_server_deinitmaster_service_set_die_callbackmaster_auth_requesthttp_server_payload_handler_destroyhttp_client_request_append_stats_textsmtp_client_transaction_set_eventmodule_dir_loadsmtp_proxy_data_mergemessage_part_is_equalsmtp_esmtp_value_char_mask_setjmp@@GLIBC_2.2.5program_client_disconnectedsignal_term_countermaster_service_settings_cache_readstats_unregistermaster_login_auth_set_timeoutt_realpathsmtp_client_command_newmaster_service_ssl_settings_gethttp_client_request_set_proxy_urlsmtp_params_decode_paramsmtp_server_reply_ehlo_add_enhancedstatuscodesfs_wrapper_wait_asyncstats_dist_init_with_sizeevent_filter_parser__switch_to_buffert_base64_scheme_decodeutimes@@GLIBC_2.2.5str_equalso_stream_file_writevsmtp_helo_domain_parsep_array_const_string_joincalloc@@GLIBC_2.2.5event_get_global_core_log_filterauth_master_set_timeoutsettings_find_dynamicsettings_parser_dupfs_file_fsevent_filter_createfile_preallocatemessage_decoder_initsmtp_client_transaction_add_pool_rcptstats_dist_get_countarray_idx_clear_ifs_file_last_erroripc_client_deinitsmtp_client_commands_list_fail_replyhttp_server_connection_flushfs_write_set_hashsafe_sendfilestr_to_llongdcrypt_key_get_usage_publicsmtp_server_command_unrefssl_iostream_get_security_stringstats_field_namei_stream_get_datasmtp_server_command_replied_successdcrypt_key_id_privatei_stream_get_fdlib_signal_code_to_strnfs_flush_file_handle_cacheevent_filter_parser__flush_buffersmtp_server_transaction_createrestrict_access_drop_priv_gidsettings_parser_get_changessha256_loophttp_header_get_fieldssmtp_server_connection_set_capabilitieslib_is_initializedhttp_server_connection_closei_stream_create_decrypt_callbackfs_renamerfc822_parse_dot_atomevent_get_fieldsstrcmp@@GLIBC_2.2.5imap_match_dupsyslog_facilitiesio_stream_initimap_match_deinitdns_client_connectmessage_part_envelope_headerslib_set_clean_exitstr_find_deinitmessage_decoder_deinitssl_iostream_handshakeio_loop_add_switch_callbackoauth2_validation_key_cache_lookup_hmac_keylib_signals_initstr_to_uintmaxaqueue_deinituri_cut_schemehttp_client_request_refsmtp_server_connection_start_pendingsmtp_server_command_get_reply_countstr_append_tabunescapedhttp_server_connection_shut_downmunmap_anonsignal@@GLIBC_2.2.5auth_client_send_cancelhttp_client_request_destroyauth_client_request_abortmaster_service_get_version_stringmmap_get_page_sizesmtp_params_mail_drop_extradata_stack_get_alloc_sizeio_add_istreamfs_sis_try_unlink_hash_fileio_stream_add_destroy_callbackhttp_client_connection_unrefstr_parse_ullongo_stream_create_bufferbuffer_create_dynamichttp_client_request_get_methoduri_parse_reg_nameiostream_proxy_unrefuni_utf8_partial_strlen_nsmtp_server_recipient_reply_forwardsmtp_params_rcpt_get_extrasettings_get_timefs_class_testdsasl_client_mech_externaloptarg@@GLIBC_2.2.5gethostbyname@@GLIBC_2.2.5net_set_tcp_nodelaysmtp_address_encode_patharray_lsearch_imaster_service_set_avail_overflow_callbackhex_to_binaryevent_filter_parser_get_extrabase32hex_decodetimeout_add_shorti_set_fatal_handlersmtp_client_connection_switch_ioloophttp_server_request_getsmtp_params_rcpt_encode_extraimap_arg_get_list_fulluri_append_fragmentsha1_loopuri_append_user_datasmtp_server_connection_loginevent_filter_match_iter_initio_loop_handle_removemaster_service_runnet_ip_hashevent_filter_mergedcrypt_ctx_sym_destroysmtp_xtext_encodet_str_lcaset_get_bytes_availableiostream_rawlog_createevent_strlist_appendhttp_client_connection_check_idlesettings_parse_execsmtp_server_connection_abortimap_arg_get_listsmtp_server_recipient_finished__memcpy_chk@@GLIBC_2.3.4restrict_get_process_limitfile_try_lockio_loop_context_remove_callbacksiostream_pump_switch_ioloopp_strsplit_tabescapedtest_expect_error_string_n_timessmtp_client_command_get_statestr_parse_ulongsmtp_server_connection_set_proxy_databuffer_insert_zerohttp_date_parseio_loop_have_immediate_timeoutsfd_close_on_execprogram_client_local_createsigemptyset@@GLIBC_2.2.5io_removeprocess_stat_read_starthttp_server_connection_pending_payloadimap_append_string_for_humansbsearch_strcmpi_sleep_usecsstr_parse_uint_octtest_ostream_createsmtp_client_transaction_set_timeoutconnection_update_propertiesevent_create_passthroughdata_stack_frame_idstr_truncate_utf8stats_registeri_stream_callback_append_strsettings_parse_streami_stream_create_attachment_extractoruni_utf8_data_is_validssl_iostream_get_peer_name__gmon_start__umask@@GLIBC_2.2.5io_is_pendingmaster_auth_deinitsmtp_client_transaction_destroysmtp_server_connection_list_inithttp_server_request_fail_authevent_copy_categoriesio_set_never_wait_aloneevent_drop_parent_log_prefixesuni_utf8_str_is_validimap_write_argoauth2_validation_key_cache_lookup_pubkeyhttp_client_request_get_payload_typesmtp_server_reply_sendsmtp_client_transaction_failsmtp_client_connection_update_proxy_datalib_signals_ioloop_attachfile_create_lockednet_getpeernamevar_expand_longi_strndupmaster_service_init_logdict_driver_clientmessage_parse_header_nexthttp_url_create_authoritydict_driver_filehttp_client_queue_switch_ioloopuni_utf8_data_truncatesmtp_char_lookupevent_minimizeauth_client_connection_disconnecthash2_lookupevent_filter_parser_get_lenghttp_url_parsesmtp_client_command_unlockhttp_client_peer_closesettings_var_expand_with_funcssmtp_client_connection_get_size_capabilitysmtp_client_init_ssl_ctxhash_table_try_removemessage_parser_deinit_from_partsstr_to_ullong_hexhttp_client_connection_outputt_hmac_bufferdsasl_client_mech_loginmaster_service_get_config_pathmemcpy@@GLIBC_2.14sigfillset@@GLIBC_2.2.5lib_atexit_runo_stream_flushdata_stack_inito_stream_abortuni_utf8_non1_bytesuri_data_encodenet_connect_unixevent_category_auth_clientiostream_proxy_reftimeval_diff_usecssettings_parse_environio_add_istream_toregerror@@GLIBC_2.2.5i_stream_statsocketpair@@GLIBC_2.2.5p_str_trimt_base32_decode_strsmtp_params_drop_onelog_throttle_initdict_drivers_unregister_builtinevent_get_registered_categorieshttp_server_resource_get_eventt_strftimehttp_client_request_set_urgentseq_range_array_iter_initimap_write_seq_rangefs_wrapper_renameevent_filter_parser_set_insmtp_client_connection_update_cmd_timeouti_stream_get_namessl_iostream_get_last_errorstr_to_gidsmtp_server_connection_reply_immediatewrapper_ostream_output_destroyedp_strarray_duphttp_parse_owsbinary_to_hexsmtp_address_parse_usernamemaster_login_auth_disconnecthttp_client_request_set_preserve_exact_reasoni_stream_create_seekable_pathguid_generateauth_master_deinitioloop_global_wait_usecssmtp_server_connection_timeout_resetrfc822_parse_quoted_stringbuffer_write_zeroposix_fallocate@@GLIBC_2.2.5smtp_server_connection_get_helo_datafs_read_streamsha1_padsmtp_qpair_char_maskhttp_server_request_callbackprctl@@GLIBC_2.2.5i_stream_get_sizestr_parse_llongstr_c_modifiableevent_filter_unrefimap_parser_set_streamsuri_parse_slashslash_host_authorityo_stream_get_errormaster_service_anvil_sendinet_pton@@GLIBC_2.2.5uri_parse_path_segmentfs_wrapper_write_stream_finishmessage_header_encode_qhttp_client_queue_requests_activefs_wrapper_deletesmtp_server_reply_ehlo_add_sizehttp_header_parser_initi_stream_create_fs_statsstr_append_maxkill@@GLIBC_2.2.5inotify_init@@GLIBC_2.4smtp_server_connection_input_unlockdcrypt_key_set_id_publichttp_request_parse_nexthttp_client_request_remove_headeri_strdup_printfp_memdupdcrypt_ctx_hmac_destroyhash_method_lookuphash2_countdict_transaction_commit_async_noop_callbackoauth2_request_abortt_strcutmaster_service_get_settings_parseruri_parse_host_authoritybuffer_create_dynamic_maxsmtp_server_recipient_add_hookprogram_client_net_createnet_set_send_buffer_sizeparse_jwk_key_http_value_char_maskhttp_server_resource_findsmtp_server_reply_ehlo_addo_stream_create_passthroughsmtp_server_cmd_quitevent_strlist_copy_recursivei_memcasecmphttp_parser_initauth_user_info_exportevent_find_field_recursiveimap_id_reply_generaterandom_deinitmaster_service_settings_readenv_putt_str_trimdcrypt_rsa_encryptt_strsplit_tabescaped_inplacesmtp_server_cmd_vrfybase64url_schemehash_method_sha3_512auth_client_request_get_server_pidstr_parse_uint32buffer_append_cgetgid@@GLIBC_2.2.5program_client_set_envt_strconcati_failure_parse_linefs_iter_init_with_eventfs_wrapper_prefetchsmtp_server_connection_switch_ioloopimap_parser_refhttp_client_request_set_timeoutdcrypt_is_initializeddict_escape_stringsmtp_textstr_char_masknet_str2portbuffer_get_modifiable_datatest_subprocess_notify_signal_send_parenti_stream_syncsmtp_client_transaction_rcpt_abortinet_aton@@GLIBC_2.2.5smtp_server_command_finishedevent_get_categorieshttp_server_resource_add_locationevent_filter_query_match_evalpool_get_exp_grown_sizei_set_failure_send_prefixi_strocpyhttp_client_request_set_attempt_timeout_msecsi_stream_create_base64_decodertest_subprocess_is_childimap_write_args_for_humano_stream_nsend_istreamstr_parse_ullong_hexseq_range_array_remove_seq_rangerestrict_get_fd_limito_stream_create_unixhttp_client_connection_count_pendinghttp_server_init_ssl_ctx__xstat@@GLIBC_2.2.5str_append_unescapedstr_parse_uintmax_hexfs_iter_deinitreaddir@@GLIBC_2.2.5dict_driver_fsnumpack_encodeseq_range_array_add_with_initio_loop_context_newio_addsmtp_server_connection_get_statswrapper_ostream_get_buffered_sizemaster_service_settings_cache_init_filterhttp_client_peer_gethttp_server_ostream_createhttp_server_connection_input_set_pendinghttp_header_parser_deinito_stream_create_cmpimap_match_init_multiplesettings_vars_have_keymodule_file_get_nameimap_parser_get_literal_sizetest_out_reasonssl_module_loadsmtp_client_command_vrfy_submit_afterrestrict_get_process_sizeo_stream_create_fd_fileo_stream_seeksha1_get_digestsmtp_address_parse_pathi_stream_closesmtp_server_transaction_has_rcptrestrict_get_groups_listfile_cache_freesmtp_address_init_from_msgpkcs5_pbkdfmessage_decoder_set_return_binaryhash2_iteratesmtp_server_reply_indexwrapper_ostream_set_errorrestrict_get_core_limithttp_client_connection_refdlopen@@GLIBC_2.2.5mmap_rw_filestream_cmp_blockconnection_client_connectsmtp_submit_initfs_init_from_stringmaster_service_set_client_limitsmtp_server_command_ready_to_replyimap_url_createio_loop_handler_initimap_body_parse_from_bodystructureimap_matchevent_filter_parser_get_lvalfs_unrefgetgroups@@GLIBC_2.2.5message_address_parsessl_iostream_settings_equalsnfs_flush_attr_cache_unlockedanvil_client_query_abortnfs_safe_lstatmaster_getoptfile_cache_set_sizehttp_client_peer_connection_failuresmtp_client_command_mail_submit_afteri_sleep_msecssha3_256_get_digestnet_gethostbyaddrmmap_ro_filei_stream_refsmtp_server_connection_get_statemaster_service_stopfs_file_set_async_callbackhttp_client_queue_connection_successauth_master_inithttp_client_host_switch_ioloophttp_date_parse_tmhttp_server_response_send_moresha512_get_digesthttp_server_request_submit_responsehome_expand_tildehttp_url_request_target_parseevent_reason_code_prefixt_strflocaltimemaster_service_ssl_ctx_initstr_to_uidevent_unrefevent_filter_parser__create_bufferio_loop_move_timeout_tosafe_memsetsmtp_command_parse_data_with_sizesmtp_server_reply_indexvmalloc@@GLIBC_2.2.5strncasecmp@@GLIBC_2.2.5guid_128_is_emptyfflush@@GLIBC_2.2.5test_assert_failed_idxi_sleep_secsnet_ip6_anyi_stream_try_alloc_avoid_compressoauth2_passwd_grant_starthttp_client_request_sendstr_to_uint32_hexhash_table_create_directhttp_server_request_destroyfile_dotlock_touchdcrypt_key_convert_private_to_publicsmtp_server_recipient_deniedo_stream_copy_error_from_parentmessage_search_msginotify_add_watch@@GLIBC_2.4restrict_process_countversion_string_verify_fullauth_client_get_available_mechsrfc822_parser_initipc_server_deinitt_normpath_tofs_wrapper_iter_alloct_str_ltrimsmtp_server_init_ssl_ctxrandom_inithttp_message_parse_versionsmtp_server_connection_timeout_stopuri_append_host_ipgetmntent@@GLIBC_2.2.5file_copysetmntent@@GLIBC_2.2.5http_client_peer_addr_hashstats_dist_get_percentilehttp_server_resource_set_destroy_callbacklib_deinitdict_transaction_set_timestampevent_set_always_log_sourcei_stream_get_modifiable_dataarray_idx_get_space_imaster_service_client_connection_destroyedo_stream_create_hashhttp_client_request_get_stateiostream_proxy_get_ostreamevent_get_parentt_str_ucasecharset_to_utf8_strhttp_client_queue_requests_pendingsmtp_server_reply_is_successhttp_server_request_fail_auth_basicsmtp_server_reply_index_forwardstats_dist_initstr_parse_uint32_hexfs_file_set_error_asynchttp_parse_tokenssl_iostream_server_context_cache_getmaster_service_get_idle_kill_secscrc32_str_moreuri_append_query__isoc99_sscanf@@GLIBC_2.7io_notify_fd_findmaster_service_ssl_ctx_deiniti_strdup_emptyaqueue_counthttp_server_connection_input_resumeio_loop_set_runningfile_lock_from_dotlockevent_get_min_log_levelsmtp_server_connection_set_streamshttp_client_connection_lostfs_iter_inithttp_client_request_get_statsprogram_client_set_outputsmtp_server_cmd_noop_reply_successfs_get_metadata_fulli_set_error_handlerhttp_client_peer_shared_reffile_lock_findrfc822_skip_lwspsmtp_address_create_from_msg_temphttp_server_request_set_destroy_callbackbase64_encode_get_full_spaceistream_try_createhttp_server_response_finish_payloadmaster_service_get_client_limitsmtp_server_cmd_mail_reply_successo_stream_uncorkbuffer_appendprogram_client_failtest_expect_errorssmtp_client_command_vrfy_submithash_table_insertmessage_address_parse_fullsmtp_params_mail_parse__fxstat@@GLIBC_2.2.5http_auth_parse_challengesfs_wrapper_file_get_pathi_unlink_if_existsbase64_encode_finishi_strdup_vprintfmessage_parse_header_deinitdsasl_client_mech_plaindict_driver_memcachedfs_class_sislisten@@GLIBC_2.2.5imap_match_initssl_iostream_change_contextsmtp_server_reply_submit_duplicateioloop_iolist_deloauth2_valid_tokenmaster_instance_iterate_list_deinitstr_find_resetstr_parse_uint64_hexsha384_resultsettings_parse_unaliasanvil_client_connectsmtp_params_mail_encode_extrauri_append_path_segment_datadcrypt_ctx_sym_get_key_lengthsmtp_reply_parse_enhanced_codehttp_client_context_refdsasl_client_set_parameteripc_server_initi_stream_header_filter_addimap_parser_get_erroroauth2_validation_key_cache_deinitfile_dotlock_is_lockeduri_append_query_datastats_dist_resetiso8601_date_parse_tmdata_stack_deinithttp_client_connection_createhttp_client_request_set_eventnet_getservbyporthttp_client_connection_is_activedcrypt_key_load_private_rawp_strndupdcrypt_oid2namevar_expand_extensions_initi_mallocregexec@@GLIBC_2.3.4event_filter_parser__scan_stringsafe_mkdirbuffer_append_full_istreamnet_geterrorhttp_server_request_finishedhttp_server_request_get_poolhash_table_thawstr_array_icase_findsha512_initsmtp_ehlo_line_parsegetegid@@GLIBC_2.2.5smtp_submit_runsettings_parse_is_changedtest_expect_no_more_errorssmtp_client_switch_ioloopuchar_nulsettings_get_time_msecssmtp_reply_parse_ehloseq_range_array_invertnet_receivedcrypt_ctx_sym_get_iv_lengthmktime@@GLIBC_2.2.5i_getopt_resetsmtp_server_recipient_is_repliedmaster_status_updatesmtp_server_reply_get_messagedcrypt_set_vfsfs_wrapper_write_streamstrpbrk@@GLIBC_2.2.5smtp_client_transaction_start_emptysmtp_address_createfs_wrapper_lockt_str_rtrimmaster_service_io_listeners_addarray_sort_ihttp_request_get_payload_sizeoauth2_refresh_startsmtp_submit_setting_parser_infosmtp_server_connection_trigger_outputsmtp_server_command_next_to_replytest_outhttp_auth_create_credentialssha384_get_digesthttp_server_connection_switch_ioloopssl_iostream_set_log_prefixhttp_server_connection_tunnelo_stream_flush_parent_if_neededparse_setting_from_defshttp_server_ostream_output_availableo_stream_corkimap_url_parsei_memspnlib_signals_ignoremaster_login_auth_deinitt_str_tabunescapehttp_client_peer_pool_refstr_table_unrefcrc32_strssl_iostream_set_sni_callbackfs_initsmtp_server_connection_timeout_startmemarea_init_emptyo_stream_flush_parentsmtp_server_connection_create_from_streamsimap_arg_get_astringsmtp_client_command_drop_callbackstr_find_get_match_end_posio_stream_get_ioloopstr_to_ulong_octstats_connection_createhttp_client_request_set_destroy_callbackseq_range_array_add_range_countsha3_512_get_digesthttp_client_request_delay_untilwrapper_ostream_output_availablehash_table_lookup_fullimap_to_datetimehmac_hkdfhttp_client_request_get_targetiostream_proxy_startsmtp_reply_copyo_stream_multiplex_get_channel_idio_loop_context_add_callbacksrestrict_access_allow_coredumpso_stream_create_rawlogo_stream_get_fdbuffer_get_space_unsafesafe_mkstemp_groupaqueue_initiostream_proxy_is_waiting_outputstr_parse_uint64_octhttp_server_connection_output_resumetest_expect_error_stringrfc822_skip_commentbuffer_append_space_unsafehttp_parse_token_list_nextfchdir@@GLIBC_2.2.5smtp_parser_parse_address_literaldict_transaction_commit_async_nocallbacksmtp_client_command_failmremap@@GLIBC_2.2.5i_stream_get_data_sizehttp_client_connection_request_destroyeddns_client_deinithttp_auth_challenge_clonei_stream_unset_iohttp_server_connection_unref__vsnprintf_chk@@GLIBC_2.3.4fs_statfs_wrapper_get_metadataprimes_closestoauth2_introspection_startsmtp_address_parse_mailboxuri_parse_hostsmtp_client_transaction_switch_ioloopi_stream_create_copy_from_dataprocess_title_getdlclose@@GLIBC_2.2.5test_fs_file_geti_stream_file_readfs_metadata_init_or_clearimap_envelope_parse_argsfs_file_eventnet_gethostbynamesmtp_server_connection_reply_linesi_stream_unix_unset_read_fdenv_backup_restoredcrypt_key_set_usage_privatessl_iostream_unrefsmtp_client_transaction_abortsha1_result_libmysqlclient_craps_all_overprogram_client_connectedio_loop_notify_handler_deinittest_subprocess_set_cleanup_callbackdict_transaction_set_hide_log_valuesbuffer_append_full_filei_stream_init_parentimap_parser_resetfs_file_timing_endssl_iostream_set_handshake_callbacksetrlimit@@GLIBC_2.2.5o_stream_create_multiplexhttp_server_request_refsendfile@@GLIBC_2.2.5master_service_env_cleansmtp_client_transaction_connection_destroyedsettings_parser_initssl_iostream_context_refmessage_header_decode_utf8test_run_namedfile_lock_try_updatei_stream_create_limitiostream_ssl_module_initfdatasync_pathseq_range_existso_stream_create_metawrapi_log_typevmaster_instance_list_updatesmtp_server_cmd_rsetauth_master_cache_flushsmtp_server_connection_flusho_stream_set_finish_via_childiostream_pump_get_outputp_strdupstr_tabescapehttp_client_request_set_sslsmtp_param_writetimeout_add_torealloc@@GLIBC_2.2.5dcrypt_ctx_sym_set_paddingsmtp_server_connection_closemessage_header_name_is_validsmtp_client_commands_fail_delayedstat_first_parenthash_table_copymessage_part_deserializestats_fill_ptrvstrconcathttp_server_request_is_completeqp_encoder_finishsmtp_params_equalmessage_search_deinittest_istream_createdict_op_settings_dupevent_passthrough_vfuncsdict_transaction_commit_asyncstr_matchmaster_service_get_service_counturi_parse_authoritysmtp_submit_session_inittest_istream_set_size__bss_starthook_build_deinitstr_freechild_wait_remove_pidbase32_encodedcrypt_key_store_privatemaster_instance_list_iterate_initevent_add_strdcrypt_key_unref_privatesmtp_client_command_set_repliesi_stream_create_file_commoni_set_info_filegetgrgid_r@@GLIBC_2.2.5md4_updatesha512_resultt_malloc_no0getpwnam_r@@GLIBC_2.2.5master_service_setting_parser_infoprocess_title_initiostream_rawlog_create_pathseq_range_array_iter_nthsmtp_server_command_reply_is_forwardedtest_fs_gettest_runsmtp_server_command_overridehttp_client_peer_unrefsmtp_parser_parse_atomio_stream_copyio_loop_runmunmap@@GLIBC_2.2.5event_set_global_debug_log_filterrecvmsg@@GLIBC_2.2.5smtp_address_encodehttp_server_response_sendstats_field_valuedcrypt_ctx_sym_set_key_iv_randomhttp_message_parse_headersuri_append_path_segmentdns_lookupenv_get_environ_pstats_connection_sendfile_cache_set_fddict_op_settings_private_freedcrypt_rsa_decryptpwrite@@GLIBC_2.2.5smtp_server_command_is_repliedstr_to_inosmtp_reply_get_text_lines_omit_prefixhttp_server_connection_start_idle_timeoutstr_to_timesmtp_server_connection_cleari_stream_multiplex_add_channeli_stream_set_ioanvil_client_cmdconnection_set_default_handlershttp_server_shut_downpool_system_freeauth_master_user_list_next__printf_chk@@GLIBC_2.3.4dict_drivers_register_builtinhttp_client_peer_active_connectionsmaster_login_auth_requestdcrypt_ctx_hmac_get_digest_lengthdcrypt_ctx_hmac_set_key_randombase32hex_encodeiconv_close@@GLIBC_2.2.5json_parser_deinitpriorityq_initfs_class_sis_queuesmtp_server_recipient_data_repliedi_stream_create_filemy_hostnameevent_get_global_debug_send_filtertimegm@@GLIBC_2.2.5fs_class_metawrapfchmod@@GLIBC_2.2.5http_client_request_set_timeout_msecsnet_getunixnameevent_filter_parser_set_extrafs_deinitsmtp_server_connection_ssl_inituri_parse_unreservedimap_parser_createevent_set_global_core_log_filterdns_client_lookup_ptrio_loop_move_iostr_parse_ullong_octsettings_parse_get_valuesmtp_server_command_aborti_fatal_statusevent_import_unescapedhash2_insertsmtp_client_transaction_add_mailhttp_server_payload_handler_switch_iolooparray_equal_fn_ctx_istr_printfafs_default_set_metadatadict_transaction_no_slowness_warningepoll_wait@@GLIBC_2.3.2http_client_host_check_idleauth_client_disconnectsmtp_server_reply_create_forwardhttp_server_request_connection_closepoll@@GLIBC_2.2.5smtp_server_command_failmkdir_parents_chgrpevent_filter_parser_pop_buffer_statei_stream_create_callbacksmtp_reply_writebind@@GLIBC_2.2.5smtp_server_command_input_captureutf8_replacement_charo_stream_file_sendvstr_nescapestr_append_escapedmessage_address_to_stringmaster_login_initsmtp_server_command_call_hooks__longjmp_chk@@GLIBC_2.11madvise@@GLIBC_2.2.5http_server_ostream_response_destroyedbuffer_deleteterminatingdsasl_client_inputsha3_256_initevent_filter_create_fragmenthttp_server_ostream_continuestats_connection_refstrftime@@GLIBC_2.2.5test_endmessage_part_by_idxhttp_url_copyhttp_client_request_resubmithash_method_sha384http_client_request_redirectfs_lookup_metadatalog_throttle_acceptdcrypt_initializeconnection_list_deinitp_strsplit_spacesmessage_date_parseconnection_init_serverhttp_client_request_set_payload_emptyfs_refmemmove@@GLIBC_2.2.5t_strdup_vprintf__syslog_chk@@GLIBC_2.4http_client_peer_connection_losti_stream_add_dataio_stream_ssl_global_initmaster_auth_request_aborto_stream_sendvdns_lookup_ptrp_strsplitsmtp_params_add_encodedmaster_instance_list_initsettings_parser_init_listguid_128_cmphttp_server_connection_switch_ioloop_tosmtp_server_connection_register_mail_paramhttp_server_switch_ioloopdefault_error_handlermessage_part_is_attachmentsmtp_server_command_input_unlockhttp_server_request_is_finishedevent_set_sourceimap_append_nstring_nolfauth_client_request_continuehttp_server_request_abortsmtp_ehlo_params_are_validstats_addauth_master_user_lookupnet_try_bindhttp_client_request_error_delayedstats_parser_difffs_file_set_flagshash2_destroyfs_class_registerevent_register_callbackrfc822_parse_phrasenet_hosterror_notfoundsmtp_client_command_rcpt_submit_aftermaster_service_haproxy_abortsetgid@@GLIBC_2.2.5master_service_settings_get_othersmessage_part_serializeauth_master_pass_lookuphttp_header_field_find_uniqueuni_utf8_strleno_stream_set_flush_callbacksmtp_submit_init_simplei_set_debug_fileconnection_input_readsmtp_client_command_fail_replytest_subprocesses_deinitseq_range_array_remove_nthhttp_client_remove_request_erroriso8601_date_createauth_client_set_connect_timeoutbase64_encode_morerestrict_access_get_current_chrootwaitpid@@GLIBC_2.2.5imap_arg_atom_equalsstr_equals_timing_almost_safeprogram_client_createtee_i_stream_createhttp_server_response_update_statuspool_alloconly_get_total_alloc_sizefs_writei_stream_default_snapshotsmtp_server_reply_ehlo_add_pipeliningqp_decoder_deiniti_getpwnambsearch_strcasecmppool_alloconly_get_total_used_sizefs_deletesmtp_client_connection_trigger_outputtcgetattr@@GLIBC_2.2.5ipc_cmd_successnet_ip_cmpfile_cache_new_pathconnection_init_client_ip_http_token68_char_maskhttp_client_peer_addr_cmpsmtp_client_connection_send_xclienti_my_preadconnection_verify_versionnet_ip4_loopbacksmtp_ehlo_param_is_validmessage_parser_parse_bodydsasl_client_outputhttp_client_request_connecturi_append_unreservedtcsetattr@@GLIBC_2.2.5i_stream_create_rawlog_from_streami_stream_create_base64url_decoderfailures_deinitfs_iter_init_parentsmtp_server_transaction_find_rcpt_duplicatessl_iostream_get_protocol_namehttp_transfer_chunked_ostream_createi_set_debug_handlerhttp_client_host_shared_freechild_wait_freefs_class_randomfailhttp_server_response_get_total_sizeauth_client_connection_list_initdcrypt_ctx_sym_get_tagstats_copysmtp_params_mail_copymaster_service_getopt_stringiso8601_date_parsehttp_client_request_set_max_attemptssmtp_xtext_decodestr_to_uint_octdcrypt_key_load_publicsmtp_server_cmd_datahttp_server_request_ready_to_respondrestrict_access_get_envuri_parse_fragmentmkdir_chowni_stream_create_base64url_encoderdcrypt_ecdh_derive_secret_localmaster_service_settings_read_simplehash_method_md5program_client_set_output_seekablefile_dotlock_open_groupmaster_service_sethttp_server_response_get_payload_outputaccess@@GLIBC_2.2.5master_service_get_configured_namerfc822_atext_charsio_loop_call_ionull_strcasecmpi_stream_read_copy_from_parenttee_i_stream_child_is_waitingdcrypt_key_string_get_infostr_to_uintmax_hexmaster_service_set_die_with_mastert_strdup_untiliostream_pump_unrefimap_seq_range_parsestr_parse_uint32_octio_loop_move_timeoutpriorityq_removemaster_service_get_process_min_availdsasl_client_mech_findtest_fatal_set_callbackprogram_client_net_create_ipspriorityq_popsmtp_address_add_detailhash_table_updateo_stream_create_file_commonimap_parser_enable_literal_minusfchown@@GLIBC_2.2.5hash_method_sha256charset_is_utf8smtp_server_connection_input_capturesmtp_params_mail_decode_extrao_stream_create_error_strevent_logvi_stream_create_crlfipc_cmd_failhttp_response_parse_nextdcrypt_ctx_sym_set_tagsmtp_server_connection_set_ssl_streamssmtp_server_connection_data_chunk_initmaster_service_ssl_is_enabledimap_to_datetime_tzmaster_login_auth_request_countfs_wrapper_iter_deiniti_warningfs_existssettings_parse_var_skiphome_expandrestrict_process_sizee_debugi_sleep_intr_usecstest_assert_failed_cmp_intmax_idxhttp_parse_token_or_qstringnearest_powerbuffer_create_from_datasmtp_server_reply_ehlo_add_8bitmimeio_wait_timer_get_usecsssl_iostream_context_init_servermmap_anonevent_filter_replace_countermessage_header_strdupauth_client_request_get_idi_stream_seekevent_filter_parser_set_lvalmaster_service_ssl_setting_parser_infoauth_client_deinitsmtp_params_rcpt_set_orcptgetrusage@@GLIBC_2.2.5imap_append_astringiostream_proxy_createfs_get_metadatasmtp_reply_get_enh_codei_stream_create_hashhash_table_destroyhttp_request_parser_deinitauth_client_connection_initsysconf@@GLIBC_2.2.5t_buffer_regetipc_cmd_sendmessage_parse_headerhttp_server_response_add_permanent_headerfile_lock_freemkdir_parents_chownsmtp_server_recipient_resetevent_filter_parser_parsemaster_service_settings_geti_getpwuidhttp_parser_skip_tokenfs_wrapper_set_async_callbackhttp_client_host_getprogram_client_init_streamsmd4_initrename@@GLIBC_2.2.5iostream_pump_refmessage_part_data_parse_from_headeri_stream_create_dothttp_server_response_add_authgmtime@@GLIBC_2.2.5uni_strlenmremap_anonstrcase_hashsmtp_submit_sendevent_add_categorygetopt@@GLIBC_2.2.5fs_wrapper_statlib_exitfs_write_stream_abort_parentsmtp_server_command_completedenv_clean_exceptaqueue_appendsmtp_client_command_refsmtp_server_reply_get_statushttp_server_connection_handle_output_errorimap_parser_read_tagio_stream_set_errorauth_client_request_server_inputmaster_service_get_socket_counto_stream_create_rawlog_from_streamstr_is_numericfile_dotlock_replacessl_iostream_context_cache_freeunsetenv@@GLIBC_2.2.5smtp_server_reply_ehlo_add_chunkinghttp_client_init_ssl_ctxevent_find_field_nonrecursivesmtp_params_mail_writeevent_filter_parser_get_inimap_append_quotedevent_add_fieldsmaster_servicetimeval_cmpfs_wrapper_copyimap_arg_as_listhostpid_initfs_metadata_findfs_get_driversmtp_server_initsmtp_server_connection_get_contexttest_out_quietmaster_service_io_listeners_removelib_signals_unset_handlermessage_parser_parse_headersmtp_reply_logevent_flattenevent_filter_parser_allocstats_dist_get_mediano_stream_create_fdsmtp_params_rcpt_decode_extramail_html2text_deinitsmtp_params_rcpt_add_to_eventhttp_client_queue_peer_disconnectedauth_client_request_newevent_add_categoriesmem_hashsmtp_server_connection_refi_strduphttp_client_request_set_event_headersaccept@@GLIBC_2.2.5getsockname@@GLIBC_2.2.5lib_event_deinitevent_filter_parser__delete_buffero_stream_file_closei_stream_unix_set_read_fdmaster_service_settings_parser_get_othersdec2hexstats_field_countmemarea_free_callback_noopdict_transaction_memory_setiostream_temp_finishsettings_parse_is_valid_keycharset_utf8_vfuncstest_subprocesses_inithttp_client_delay_request_errori_stream_get_max_buffer_sizeexecvp@@GLIBC_2.2.5io_loop_set_time_moved_callbackflock@@GLIBC_2.2.5event_unset_global_debug_send_filterstr_sanitize_appendio_stream_create_ssl_clienttimeout_removesmtp_reply_parser_set_stream__cxa_atexit@@GLIBC_2.2.5hash_table_iteratesmtp_server_cmd_rcpt_reply_successt_abspath_too_stream_create_fd_file_autoclosetimeout_add_short_todefault_pooli_stream_compressssl_iostream_get_compressionmd4_get_digesthttp_server_connection_outputi_stream_callback_appendfs_lookup_loaded_metadatasmtp_address_initevent_reason_codetest_fs_asynchttp_client_request_add_missing_headerfile_dotlock_openi_stream_create_failure_athttp_client_request_labelsmtp_params_get_parameacces_error_get_creatingprintf_format_fix_unsafehttp_url_copy_authoritysmtp_server_command_is_rcptsmtp_client_connection_add_transactionhash2_insert_hashpread@@GLIBC_2.2.5event_add_intt_base32hex_decode_strarray_idx_set_ii_stream_allocsmtp_client_connection_corkvar_expand_ifopenlog@@GLIBC_2.2.5smtp_client_command_vprintfbuffer_append_zeroi_rand_limithttp_client_host_refreshgetgrnam_r@@GLIBC_2.2.5seq_range_array_merge_nio_wait_timer_move_todict_iterate_has_morebase64_schemessl_iostream_settings_duplib_signals_deinitcreat@@GLIBC_2.2.5message_header_encode_dataprogram_client_runuri_parse_querystr_parse_longstr_parse_uintrandom_fillt_strfgmtimei_unlinksyslog_facility_findo_stream_create_fd_autoclosestr_table_initunix_socket_createsmtp_client_transaction_get_timesevent_filter_match_iter_deinitsmtp_server_transaction_rcpt_counti_stream_destroyevent_unset_log_message_callbacki_stream_switch_ioloop_too_stream_create_final_tricklesmtp_server_connection_reason_beginstr_to_uint32imap_arg_as_literal_sizesmtp_client_command_set_streamgethostname@@GLIBC_2.2.5restrict_access_by_envlib_signals_switch_ioloopdcrypt_ctx_hmac_inithttp_client_host_shared_switch_ioloopgetpagesize@@GLIBC_2.2.5imap_utf7_to_utf8dns_comparefs_write_stream_finishcharset_utf8onlyevent_category_find_registeredhook_build_initmaster_auth_request_fullhttp_client_waitrestrict_access_initsmtp_client_command_data_submitcharset_utf8_to_utf8stats_client_deinitfs_copy_finish_asyncistream_attachment_connector_finishfs_write_streamprogram_client_set_inputepoll_create@@GLIBC_2.3.2http_auth_create_challengesdcrypt_key_type_privatebacktrace_appendt_base64_scheme_encodeoauth2_validation_key_cache_insert_pubkey__memset_chk@@GLIBC_2.3.4event_log_http_text_char_masksmtp_server_connection_handle_output_erroro_stream_nsend_str__environ@@GLIBC_2.2.5i_stream_next_lineevent_sendiostream_pump_starthash_table_lookupmemarea_reffs_default_copysmtp_address_cmp_icasehttp_request_has_connection_optionsettings_parse_get_prev_infoglob@@GLIBC_2.27smtp_server_connection_input_haltstr_to_uint64null_strcmpmaster_login_addtimeout_addevent_filter_get_expr_for_testingmaster_service_deinit_forkedsmtp_server_recipient_get_originalfs_wrapper_get_nlinksgetppid@@GLIBC_2.2.5i_stream_create_min_sizedfs_get_statsquoted_printable_q_decodefailure_handlerconnect@@GLIBC_2.2.5smtp_server_recipient_data_commandhttp_client_request_urlbuffer_append_buft_askpasshttp_client_request_finish_payloadevent_copy_fieldssmtp_command_parser_initrestrict_access_have_priv_gidfwrite@@GLIBC_2.2.5t_strdup_printfhttp_auth_parse_credentialshttp_request_state_nameshttp_client_init_privateo_stream_create_failure_atnet_parse_rangei_stream_create_sym_decryptoauth2_token_validation_startsmtp_address_parse_path_fullseq_range_array_removedcrypt_key_type_publicimap_parse_datemodule_dir_deinitmodule_dir_initio_loop_remove_switch_callbackoauth2_request_parse_jsoni_stream_multiplex_get_channel_idguid_128_to_stringfs_wrapper_file_closeauth_client_is_disconnectedstr_append_tabescapedauth_user_fields_parseevent_filter_parser_set_debugfs_file_deinitmessage_address_initfs_wait_asyncmaster_service_ssl_server_settings_getgetrlimit@@GLIBC_2.2.5uri_parse_host_namet_strndupfile_cache_get_maphttp_server_request_fail_closesmtp_address_create_tempsmtp_server_command_reftest_ostream_create_nonblockinghttp_server_resource_freesmtp_params_rcpt_writeevent_get_last_durationsmtp_client_command_noop_submit_afterdcrypt_ecdh_derive_secret_peersmtp_xtext_parseioloop_iolist_adduri_parse_unreserved_pctstr_sanitizehttp_server_connection_refi_errormessage_parser_init_intlib_signals_syscall_error_ITM_registerTMCloneTablebinary_to_hex_ucasesmtp_server_reply_allmaster_service_is_killedt_normpathhttp_server_request_newnull_settings_section_callbackfile_lock_set_pathhttp_server_request_failfs_wrapper_unlockhash_format_deinitssl_iostream_get_cipheriostream_temp_createdns_match_wildcardstr_parse_ulong_octsmtp_capability_find_by_namehttp_client_queue_connection_failureevent_find_field_recursive_strhash2_clearbuffer_replaceqp_encoder_deinitsmtp_client_transaction_startsmtp_server_connection_corkssl_iostream_settings_drop_stream_onlyimap_url_add_urlautharray_insert_space_ihttp_server_connection_output_haltsmtp_server_command_add_hookmessage_decoder_parse_cteenv_removegetrandom@@GLIBC_2.25stats_dist_addhttp_server_response_finish_payload_outio_add_notifymessage_decoder_decode_resethttp_client_peer_have_queueio_loop_set_max_fd_countsha384_loopauth_client_set_connect_notifyrestrict_access_use_priv_gidhttp_server_request_labelhttp_client_request_abortsetuid@@GLIBC_2.2.5uri_parser_init_datamaster_service_ssl_client_settings_to_iostream_seti_stream_create_from_datatest_has_failedconnection_update_eventanvil_client_querypool_allocfree_create_cleanhttp_server_request_immune_unrefmaster_service_import_environmentstr_to_uint64_octsmtp_server_reply_ehlo_add_paramhttp_client_connection_reset_request_timeoutdcrypt_pbkdf2http_transfer_chunked_istream_createseqset_builder_initimap_arg_as_astringmessage_part_data_get_filenamegetservbyport@@GLIBC_2.2.5http_url_escape_paramsmtp_server_cmd_auth_send_challengehttp_client_queue_submit_requesto_stream_set_finish_also_parentsmtp_server_recipient_replyvoauth2_validation_key_cache_insert_hmac_keyauth_master_user_list_deinithash_method_sha3_256utc_offsetgetaddrinfo@@GLIBC_2.2.5mmap_filei_stream_read_datasha384_inithttp_parse_quoted_stringio_stream_get_disconnect_reasonhttp_server_connection_input_haltevent_get_ptrsmtp_ehlo_param_char_masktest_istream_set_max_buffer_sizet_pushsettings_dup_with_pointershash2_createdec2strhttp_client_queue_connection_setupsmtp_client_connection_abort_transactiondns_client_lookupvar_expand_merge_tablesfs_set_metadataprogram_client_switch_iolooptest_run_with_fatalsmodule_dir_try_load_missingsmtp_server_switch_ioloopdcrypt_key_unref_publicsmtp_client_transaction_unrefmaster_instance_list_set_namehttp_client_context_createdsasl_client_mech_get_namesmtp_client_command_send_moret_hmac_strimap_arg_get_atomfs_file_freeo_stream_create_filehttp_server_resource_callbackdlsym@@GLIBC_2.2.5fs_wrapper_iter_initmaster_login_auth_inithttp_server_response_abort_payloadhttp_server_request_continue_payloadfs_set_error_errnosmtp_server_recipient_call_hookssmtp_server_cmd_ehlo_reply_defaultsmtp_params_add_onesmtp_address_write_pathsmtp_server_reply_add_to_eventhttp_server_response_submit_tunnelnet_set_corkio_loop_context_deactivatesmtp_server_cmd_authenv_put_arrayhttp_client_peer_unlink_queuejson_append_escaped_dataunlink_old_filesuni_utf8_to_decomposed_titlecaseguid_128_from_uuid_stringsmtp_client_command_set_sent_callbackmessage_header_encodei_strcmp_pevent_enable_user_cpu_usecsinotify_rm_watch@@GLIBC_2.4smtp_submit_add_rcptdcrypt_ctx_hmac_updatesmtp_server_connection_data_check_statevar_has_keydcrypt_ctx_sym_get_aadiostream_proxy_switch_ioloopinitgroups@@GLIBC_2.2.5http_client_peer_pending_connectionssmtp_server_connection_get_protocol_nameuri_parse_pct_encodeddcrypt_key_id_publicevent_filter_exporthttp_response_parser_deinitsmtp_server_connection_reset_statemessage_get_header_sizet_strarray_joincurrent_ioloopsmtp_server_replychild_wait_deinitsmtp_client_command_plugimap_arg_as_nstringi_getgrnammessage_size_addhash_format_deinit_freeevent_unset_global_debug_log_filteri_stream_read_memareai_stream_last_line_crlfarray_equal_fn_ihttp_client_queue_getfile_dotlock_open_modet_buffer_alloc_last_fullfs_wrapper_writei_stream_create_min_sized_ranget_strsplitmessage_header_hash_moremodule_get_symbolhttp_client_queue_drop_requestp_strdup_untili_set_failure_timestamp_formatsmtp_client_command_submit_afterpriorityq_itemsevent_replace_log_prefixfs_metadata_initmessage_part_envelope_parse_from_headerhttp_server_connection_output_triggersmtp_string_parsemodule_dir_findi_stream_create_sizedsmtp_server_transaction_fail_datahash_method_get_digesti_stream_get_disconnect_reasonrestrict_access_set_envhttp_url_init_authority_fromio_wait_timer_adddata_stack_get_used_sizeimap_write_flagsauth_client_request_get_cookiei_unset_failure_prefixuri_append_host__cxa_finalize@@GLIBC_2.2.5settings_parse_keyvalueiostream_rawlog_writesmtp_server_connection_createi_strstr_arrsmtp_reply_get_messageimap_append_stringimap_seq_set_nostar_parsestr_to_intmaxsmtp_server_reply_quitexecv@@GLIBC_2.2.5dict_iterate_set_limitt_str_newo_stream_sendsmtp_reply_add_to_eventstr_table_is_emptysmtp_address_encode_rawmessage_decoder_decode_next_blocksmtp_server_cmd_auth_successi_nanosecondsfs_iter_have_morestr_to_uint64_hexuri_parse_schemeo_stream_get_max_buffer_sizebuffer_copyhttp_server_ostream_response_finishedsmtp_server_connection_starti_stream_create_fs_filehttp_date_createconnection_init_server_ipi_stream_create_timeoutsmtp_server_transaction_finishedsetegid@@GLIBC_2.2.5dcrypt_deinitializei_strdup_untilfork@@GLIBC_2.2.5fs_sis_path_parsehttp_server_resource_createsmtp_address_writenet_getunixcredsmtp_server_cmd_ehlo_reply_createsmtp_client_command_mail_submitsmtp_client_connection_create_unixstr_to_pidmemarea_free_without_callbackprogram_client_initrfc2231_parsedict_driver_unregisteri_stream_default_seek_nonseekablestrstr@@GLIBC_2.2.5smtp_server_deinitdsasl_client_mech_xoauth2connection_input_defaulthttp_client_request_set_portsmtp_params_mail_add_extrat_readlinkpriorityq_peekmessage_search_initconnection_input_timeout_reasoni_stream_create_failure_at_eofhttp_header_parse_next_fieldmountpoint_iter_deinitdict_transaction_memory_unsetbuffer_get_avail_sizeevent_filter_parser_set_outfailure_exitsmtp_client_connection_uncorksmtp_client_connection_get_extra_capabilitymessage_binary_part_serializet_pop_last_unsafesmtp_ehlo_keyword_is_validi_stream_set_init_buffer_sizemaster_service_ssl_io_listeners_removei_set_failure_send_iphttp_client_peer_reffs_api_module_registerwrapper_ostream_continuehttp_client_get_pending_request_countsmtp_server_reply_replace_pathevent_filter_refuri_checksmtp_server_recipient_unrefhttp_client_deinitsmtp_string_writedlerror@@GLIBC_2.2.5smtp_server_connection_data_chunk_addi_stream_create_concati_stream_create_seekable__ctype_tolower_loc@@GLIBC_2.3smtp_server_cmd_noopnet_str2port_zeroi_set_failure_filemessage_address_init_from_smtpconnection_init_from_streamsbuffer_get_writable_sizemaster_service_init_log_with_prefixmaster_service_parse_optionhttp_server_ostream_set_errorsmtp_server_reply_get_one_line__ctype_b_loc@@GLIBC_2.3http_client_requestevent_filter_parser_get_textmessage_part_to_idxio_wait_timer_add_tosmtp_reply_clonedcrypt_key_get_id_privateusleep@@GLIBC_2.2.5net_listensmtp_client_command_set_abort_callbacko_stream_unset_flush_callbackpool_allocfree_get_total_used_sizestr_array_lengthnfs_safe_linknet_ip2addrhttp_client_connection_list_initsmtp_server_cmd_helostr_parse_uoffsmtp_server_command_newiconv_open@@GLIBC_2.2.5i_stream_have_bytes_lefto_stream_create_sym_encryptfreeaddrinfo@@GLIBC_2.2.5net_acceptdcrypt_name2oidevent_filter_parser_get_debugmd5_initsmtp_reply_parser_deinitstderr@@GLIBC_2.2.5log_throttle_deinitauth_master_get_socket_pathrfc822_parse_content_typehttp_server_response_add_headersmtp_server_transaction_write_trace_recordjson_parse_nextt_hash_datamessage_header_is_addressmaster_service_get_process_limithttp_auth_credentials_copysocket@@GLIBC_2.2.5seteuid@@GLIBC_2.2.5http_server_resource_get_pathhttp_server_response_get_statusmessage_date_createfile_lock_wait_starthttp_server_request_halt_payloadprogram_client_set_extra_fduni_utf8_get_charbase64_get_full_encoded_size.symtab.strtab.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.note.gnu.property.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.comment.gnu.build.attributes88$.���o``$V8�X�X@(@ȀȀJH���o���U���oȭȭ�d����8vnB�$�$�x����s����P~@c@c@��������d�d�
������� �8�8�����`�`Xf�@�@� ��<���<�� �< �= �8	=8	�H=H�D�P=P� �d=�c�- 0�c-
ؑ}d��i`P�A	0�$�	�9.#